SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Eucgr.I01210.1|PACid:23595750 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.I01210.1|PACid:23595750
Domain Number 1 Region: 192-290
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.12e-27
Family B3 DNA binding domain 0.005
Further Details:      
 
Domain Number 2 Region: 3-80
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.14e-17
Family B3 DNA binding domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Eucgr.I01210.1|PACid:23595750
Sequence length 296
Sequence
MQKIPPKFARLFSEELPHRVILKGPSGGKWNAKLRKDNAGLYIHDGWREFHMDNSLGNKE
FLLFEYNGKRSFEVDIFDPTGLVRIDVPVTEGTETNLHNGKRPRGRPRKCPVVSQKTYLK
SQDKQNLKEEMDLRAIITSLEPRKRKQKKKLGKLTGGFPVSRSRFRCCSIEKNASSSEVN
ARLRAVEEKMFASKFPYFMTYMKMFSLEKAKMLYIPRAFAQAHCPLERADIVLRNLEGNT
WNVVCVINKNRHFFSGGWPAFIQDNKLGTGDICVFELISSKEFRVTIFRSPKTLHE
Download sequence
Identical sequences A0A059AND7
Eucgr.I01210.1|PACid:23595750

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]