SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Eucgr.I01213.1|PACid:23595752 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.I01213.1|PACid:23595752
Domain Number 1 Region: 6-104
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.39e-21
Family B3 DNA binding domain 0.0005
Further Details:      
 
Domain Number 2 Region: 173-273
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.79e-18
Family B3 DNA binding domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Eucgr.I01213.1|PACid:23595752
Sequence length 277
Sequence
MENTRRKIPDFFKAYRPEYSSQRMHVPRAFLAQLDGPLPGEILLRHRMGRQWHVKVTLEA
QDAYFEDGWQEFVRENLVETNDYMVFSYQSPGVFRVVIYGHSACEKKECALPGEVGEGSE
VQEHDSDDDDEDYNEEEQEEEEDEGRSKRSKKEGNVEERKAANEDPTNVKRYIDLKNPYF
VTVVQALRSSCLYVPRSVLIDYELKLPQAVLFHDPTGRTWRGTVKVWTDRRTWITGWGAL
CRHNNLKINDRCICELLEENGVTDRIIKVHIIGGNST
Download sequence
Identical sequences A0A059ANK8
XP_018718139.1.83385 Eucgr.I01213.1|PACid:23595752

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]