SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Eucgr.I01834.5|PACid:23596540 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.I01834.5|PACid:23596540
Domain Number 1 Region: 116-239
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.26e-31
Family Ribonuclease H 0.003
Further Details:      
 
Domain Number 2 Region: 7-39
Classification Level Classification E-value
Superfamily L9 N-domain-like 0.0000209
Family N-terminal domain of RNase HI 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Eucgr.I01834.5|PACid:23596540
Sequence length 254
Sequence
MEEEKNAFYVVRKGDVVGVYKSLSDCQAQVGSSQPASFRRSTVNKEYPLQSPQRLLTSGL
NAVGSSAISPSSLRSASFCFVQAVGSSTISPGSLQKNFNLENVIASPTISSNHLSCIIEF
DGASKGNPGQAGAGAVLRAADGSVFCRLREGVGIATNNVAEYRAVILGLRYALQKGFNHV
RVRGDSQLVCMQIQGLWKTKKQNMADLCKAAKELTDQFSSFEISHIVRDLNSEADAQANL
AIYLREGQVEVDHI
Download sequence
Identical sequences A0A059ARN4
Eucgr.I01834.5|PACid:23596540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]