SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Eucgr.I02131.1|PACid:23596859 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.I02131.1|PACid:23596859
Domain Number 1 Region: 318-662
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 5.76e-87
Family IF2B-like 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Eucgr.I02131.1|PACid:23596859
Sequence length 669
Sequence
MDPRRNPRSVSDPKVRQVGFFAPPPDRFQSGPPDPISAAASPPPAASAAAAAAAASISPS
GNSLSPVMIPPPRHHSDNLALLSRPVLVPVPVPVSVPVSFPAATPSSYTAASDFSPTPTA
ATAALSSYAGKLAAAAGADGEPGDDVAMSPGRVGRGRVMASSVPASGLTTVSVVTMPPGI
TEKVGGASVEVQNERPANSKPQKEKMTKAERRALQEAQRAAKAAAKGEGSKAATAAPGAV
SSEITKPIKVVKPSQKKSDSASVAPSEKKGPGGERPPEKERKKDVPHPRMQYDDESRVEK
AKRKAVVKQTEARNRVQLFRHLPQYEHGSQLPDLESKFFQLDQMHPAVYKVGLQYLSGDV
CGGNARCIAMLKAFQEVIKEYSTPLEKTLSRDLTTKINSYVSFFTECRPLSVSMGNAIRF
LKSRIAKLPLTMSELEAKTTLQLDIDQFISEKIILADKVIVSHAVTKIRDGDVLLTYGSP
SAVEMILLHAHELGKQFRVVVVDSRPKLEGQLLLRRLIGTGINCTYININAVSYIMHEVT
RVFLGASAVLSNGTVYSRVGTACVAMVAHAFRVPVLVCCEAYKFHERVQLDSICSNELGD
PDVIAKVPGREESIGWDSLPNSGNLQLLNLIYDATPSDYVSMIITDYGMVPPTSVPVIVR
EYRREHLWI
Download sequence
Identical sequences A0A059ASL3
XP_010029475.1.83385 Eucgr.I02131.1|PACid:23596859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]