SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Eucgr.J00702.1|PACid:23598530 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.J00702.1|PACid:23598530
Domain Number 1 Region: 267-658
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 4.32e-97
Family Regulator of chromosome condensation RCC1 0.0011
Further Details:      
 
Domain Number 2 Region: 21-129
Classification Level Classification E-value
Superfamily PH domain-like 1.85e-27
Family Pleckstrin-homology domain (PH domain) 0.0042
Further Details:      
 
Domain Number 3 Region: 658-727
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.06e-17
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0033
Further Details:      
 
Weak hits

Sequence:  Eucgr.J00702.1|PACid:23598530
Domain Number - Region: 886-943
Classification Level Classification E-value
Superfamily Tropomyosin 0.0981
Family Tropomyosin 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Eucgr.J00702.1|PACid:23598530
Sequence length 1102
Sequence
MMSRTERMASDLGRAGPIERDIEQAITALKKGAYLLKYGRRGKPKFCPFRLANDESVLIW
FSGKEEKHLKLSHVDRIISGQRTPIFQRYPRPEKEYQSFSLIYGDRSLDLICKDKDEAEA
WFSGLKALISRCRHRKGRTESRSDGIPSEATSPRTYTRSSPLNSPFGSNDGMQKDSGDQL
RLQSPFGSPPKNGLNKAFSDVILYAVPPKSFFPPDSATESVHSLSSGGSDSMHGQMRPPS
ADAFRVSLSSAVSSSSQGSGHDEGDAMGDVFIWGEGTGDGVLGGGLHRLGSNLGVKMDSS
LPKALESAVVLDVQNIACGGRHAALVTKQGEIFSWGEEWGGRLGHGVDADVLHPKLIDAL
SNMNIELVACGEYHTCAVTLSGDLYTWGDGAYNFGLLGHGNEVSHWVPKRVNGPLEGIHV
SSISCGLWHTAVVTSAGQLFTFGDGTFGVLGHDDRKSVSIPKEVESLKGLRTVRAACGVW
HTAAVVEVMVGNPSSSNCSLGKLFTWGDGDKGRLGHGDKEAKLVPTCVAALVEPNFCQVV
CGHSLTVALTTSGHVYTMGSPVYGQLGNPHADGKLPTRVEGKLSKSFVEEIACGAYHVAV
LTSRTEVYTWGKGANGRLGHADTDDKNSPTLVEALKDKQVKSIACGTNFTAAICLHKWIS
GIDQSMCSGCRQPFNFKRKRHNCYNCGLVFCHSCSSKKSMKASMAPNPNKPYRVCDGCYS
KLMKTIENDASSQSSVSRRGIISQQPNETTDKDEKFESKSRTQLTRLSSMEYIKPVESRT
SKRNKRLEFNSSRVSPVPSNGSQWGALTISKSFNPVFGSSKKFFSASVPGSRIVSRATSP
ISRRPSPPRSTTPTPTLAGLTSPKIVVDDTKRTNDSLSQEVVKLRVQVENLSRKTQLQEV
ELERTTKQLKEAMAFAAEETAKCKAAKEVIKSLTAQLKDMAERLPLGTARNVRSPSSTSL
VSPAASDDTFHTSMDRLSGQITSQEPDLNISNTSILPNGSSSYHSSSHSRQVNSEAVSRN
STRGKESESRSESEWVEQDEPGVYITFTSLPGGAKDLKRVRFSRKRFSEKQAEQWWAENR
ARVYEQYNVRTIDKSSIAGSED
Download sequence
Identical sequences A0A059ABI2
XP_010031729.1.83385 Eucgr.J00702.1|PACid:23598530

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]