SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Eucgr.J01184.1|PACid:23599138 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.J01184.1|PACid:23599138
Domain Number 1 Region: 266-635
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 6.21e-86
Family Regulator of chromosome condensation RCC1 0.0011
Further Details:      
 
Domain Number 2 Region: 23-129
Classification Level Classification E-value
Superfamily PH domain-like 7.99e-27
Family Pleckstrin-homology domain (PH domain) 0.0042
Further Details:      
 
Domain Number 3 Region: 634-705
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.49e-16
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Eucgr.J01184.1|PACid:23599138
Sequence length 1075
Sequence
MRAAMRMTAADQSKVGPLERDVELAITALKKGACLLKYGRRGKPKFCPFRLANDESVLIW
LSGKEEKHLKINHISKIIPGQRTPIFQRYPQPEKEYQSFSLIYDDRSLDLICKDKDEAEV
WFTGLKALITRRNHQKVRGGSRSGVSSEATSPRAQGQSSSAFSSPFASGDSSQKTDNSCL
HTPVESPTKIGLSNGLSDVSLCALPPKIFYPSETASSSIHSRSSGGSDGMTGRINGNNVD
AFRVSLSSAVSSSSHGSGHDEGDALGDVFLWGEGTGDGIMGGGIHRIGSSSGTKVDSLFP
KALESAVVLDVQNIACGGGLGHGVDSDVAHPKLIEGLKNVNVELVACGEYHSCAVTLGGD
LYTWGGNSSNFGVLGHGSKSSQWIPKKLNGPLEGIHVSSVSCGPWHTAVVTSAGQLFTFG
DGTFGVLGHGDRTSVSVPREVESLKGLRTVRAACGAWHTAAVVEVMVGSSSSSNCSSGKL
FTWGDGDKGRLGHGDRETKLVPTCVAALVDPNFCQVACGHSLTVALTTTGHVYTMGSPVY
GQLGNPQADGKLPNRVDGKLLKNFVEEIACGAHHVVVLTSRTEVYTWGKGLNGRLGHGDT
DDKNMPTLVEALKDKQVKSVVCGANFTAAICLHKWVSGVDQSMCSGCRLPFNFKRKRHNC
YNCGLVFCHSCSGKKSLKASMAPNPNKAYRVCDSCFGKLTRSPDTDSSSHSSLSRRGSMN
QGLNGLIERNDKSHIMVGSNFSVDLSKKVETEPSSRYKKLDVNVGRVSPVPNGVMNNGLL
NSSRSWNPVFGTSKKFFSVSLPGSRIVSRATSPTSRRSSPPRAATPTHSVLTPSKAVDDD
AKKTNSSLSEEVLKLRSQVEDLNRKAQLQEVELEQTRKELQEAMRIAGEESAKCKAAKEV
IKSLTAQLKDMAERLPMGTARNSPPSGLSSVILPNDDKFSGASEHASYTVSCHEPDENVL
NGLVMPDPSSDNGNSISKHTDQALEAMARNKTRGLKAEPGNGDWVEQDEPGVYITFVLLP
GGIKDLKRVRFSRKRFTEKQAEQWWAANRSRVYQQYNVPMADKSSTVFGKEMLAH
Download sequence
Identical sequences A0A059AC91
Eucgr.J01184.1|PACid:23599138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]