SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Eucgr.J02177.3|PACid:23600258 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.J02177.3|PACid:23600258
Domain Number 1 Region: 150-273
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.52e-30
Family Ribonuclease H 0.0026
Further Details:      
 
Domain Number 2 Region: 9-57
Classification Level Classification E-value
Superfamily L9 N-domain-like 0.0000497
Family N-terminal domain of RNase HI 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Eucgr.J02177.3|PACid:23600258
Sequence length 290
Sequence
MSKKGGADAFYVVRKGDLIGIYKTLKDCQAQAGSSVHSPSVSVYKGHGLAEEAEEHLKSH
GLKNASYTISAADLKNDIFGELVPCPFQQPASTRGASLNKALPTKRSVEALQWDHKAVGP
TSALINHQSKHLKLNDGTASQPASSNCSSCSLEFDGASKGNPGPAGAGAILRADDGSSVW
RLREGVGIATNNVAEYRALIMGLRQALQKGFKKIQVRGDSMLVCMQIQGKWKLKNQNMAD
LCQVAKELKDRFTTFQIDHVRREFNSEADAQANLAIALKVWTVEGECGQQ
Download sequence
Identical sequences A0A059AHJ1
Eucgr.J02177.3|PACid:23600258

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]