SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Eucgr.L01474.1|PACid:23606431 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.L01474.1|PACid:23606431
Domain Number 1 Region: 50-110
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000051
Family B3 DNA binding domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Eucgr.L01474.1|PACid:23606431
Sequence length 202
Sequence
MAAPALASSPPLATHSFGSQARGRNQLLPRYWPRITDQELQQISGEYPFDAKGSEWIVQF
GFRFRPNNNSRMYVLDGVTPCIQSMQLQAGDTVTFSRLEPEGKLVMGFKKASTDQAKPSQ
APGKKGRDGEEPREEEDASISEQRPEQQLEESFEQSDAHFQGNMGRAEPRLRPEKRSRDC
NRGEAVSGTSHARRNKRIRDGL
Download sequence
Identical sequences Eucgr.L01474.1|PACid:23606431

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]