SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Eucgr.L03570.1|PACid:23607927 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.L03570.1|PACid:23607927
Domain Number 1 Region: 2-113
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 7.46e-20
Family N-terminal domain of MutM-like DNA repair proteins 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Eucgr.L03570.1|PACid:23607927
Sequence length 119
Sequence
MPELPEVEAARRAVEDHCVGRKIKRAVVADDPKVIDGVSPADFQSALVGKTVVAARRKGK
SMWLQLDSPPFPSFQFGMAGAVYIKGVAVTKYKRSAVKDTDEWPSKYSKVFIEVRSVHK
Download sequence
Identical sequences Eucgr.L03570.1|PACid:23607927

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]