SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|393199216|ref|YP_006461058.1| from Solibacillus silvestris StLB046

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|393199216|ref|YP_006461058.1|
Domain Number 1 Region: 16-80,329-355
Classification Level Classification E-value
Superfamily Composite domain of metallo-dependent hydrolases 0.000000000000627
Family Hydantoinase (dihydropyrimidinase) 0.03
Further Details:      
 
Domain Number 2 Region: 80-326
Classification Level Classification E-value
Superfamily Metallo-dependent hydrolases 0.000000000492
Family Hydantoinase (dihydropyrimidinase), catalytic domain 0.058
Further Details:      
 
Weak hits

Sequence:  gi|393199216|ref|YP_006461058.1|
Domain Number - Region: 445-487
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 0.0589
Family DsrA/DsrB N-terminal-domain-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|393199216|ref|YP_006461058.1|
Sequence length 577
Comment adenine deaminase [Solibacillus silvestris StLB046]
Sequence
MPKISWKLSNIREQVSIIDGHAAPNIVLKNAKYLHSMMKSWATGNIWISNDRIVYVGKEM
PANIEGTEVVDLAGKVVVPGYIEPHVHPFQLYNPHSFAEFSAQTGTTTFISDNMTLVSLM
KNKKAFSFMDELAKLPFSFYWWSRFDSQTELENERELYSNASVLEWLDRHDVLLGGELTG
WPRLMRGDDQMLYWIQAAKHKGKKIEGHLPGASEKTLAKMRLLGVDGDHESMTIEDIEAR
ILHGYAVTLRYSSIRPDLPHLLKAVVDKGYEIFDHLMMTTDGSTPSFHEDGVMDKCIRAA
LEAGVRPVDAYNMASYNVARYYNMTNLHGLLATGRYANINILADEHSPTPEAVISKGVWL
KRDNTDLKAFPEVDLSLFGDLKIDFDLHEGDFQFSMPIGVEMVNDVITKPYSIKNFGHYQ
HTLSTDHDESYLMLVDRNGKWRINTMIKGFATHVSGFASSYSNTGDIILIGKSVQDMQYA
FQELKKMNGGIVLVEDNQIVTSIPLTLAGSIYDGTVDEVIPLELALKSALKKRGYHHTDA
IYTLLFLQSTHLPYIRITTRGIFDVMKNKVMLPAVMR
Download sequence
Identical sequences F2F7I7
gi|393199216|ref|YP_006461058.1| WP_014822589.1.32796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]