SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|393199371|ref|YP_006461213.1| from Solibacillus silvestris StLB046

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|393199371|ref|YP_006461213.1|
Domain Number 1 Region: 2-103
Classification Level Classification E-value
Superfamily Hypothetical protein YfhH 3.27e-39
Family Hypothetical protein YfhH 0.00009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|393199371|ref|YP_006461213.1|
Sequence length 109
Comment hypothetical protein SSIL_0644 [Solibacillus silvestris StLB046]
Sequence
MNELTYSAMSEPELRQEIANLRERARKAEQLGIVNEYAVYERKALLAEAYLVDLSTIIPG
EIYRLNGSPGEFFQVDYLKGRFAWGHRLGSERFEEALPVSILRPMKEGK
Download sequence
Identical sequences A0A1A7LCH3 F2F9U7 K1LMP8
gi|393199371|ref|YP_006461213.1| WP_008405719.1.16583 WP_008405719.1.32796 WP_008405719.1.55795 WP_008405719.1.70781 WP_008405719.1.91521

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]