SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|393200022|ref|YP_006461864.1| from Solibacillus silvestris StLB046

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|393200022|ref|YP_006461864.1|
Domain Number 1 Region: 147-346
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 2.88e-56
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.000000708
Further Details:      
 
Domain Number 2 Region: 431-562
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 9.42e-34
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00000667
Further Details:      
 
Domain Number 3 Region: 13-146
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 2.94e-31
Family Duplicated SiR/NiR-like domains 1 and 3 0.002
Further Details:      
 
Domain Number 4 Region: 348-423
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 2.13e-20
Family Duplicated SiR/NiR-like domains 1 and 3 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|393200022|ref|YP_006461864.1|
Sequence length 579
Comment sulfite reductase subunit beta [Solibacillus silvestris StLB046]
Sequence
MSQKIILPPQPGKPNDVERIKDESNYLRGTLEKTMQYPISSGIPDDDNRLMKFHGSYLQD
DRDLRTERERQKLEPAYQFMARVRTPGGAATSEQWLVMDEMAEKYGNGSLKLTTRQAFQV
HGILKWNVKKYMQEIHEVLLDCIAACGDVNRNVMCNVNPNQSAFHEEVYNWSARLSEHLL
PRTRAYHELWLDGEKVYDGIQDTEVEPVYGALYLPRKFKIGIAVPPSNDIDVFSQDIGFI
AIVENGELLGFNVAVGGGMGMTHGDKETYPQLGRLIGYIPKDRLLETAEKILTIQRDYGN
RAERKKARFKYTVDAKGLDFIKQELNYRLGWELEQVRPYTFSRTGDEYGWIKGENGKWHF
TLFIQNGRIKDFEDYQLKSGLREIAKVHTGVFRLTPNQNLLIADVTPQKKTVIDKMLTEY
NITDGAHYSALRRNSIACVSLPTCGLAMAEAERYLPSLITKIDEVLADNGLRDTEIGIRM
SGCPNGCSRAAMGEIGFIGKGPGKYNLYLGGDFKGQRLNKIYKENIGEEEILNTLSPIFS
EYAKERFEGEHFGDFTIRKGYVEAVTDGRQFHGMSEVKS
Download sequence
Identical sequences F2F0E3
WP_014823195.1.32796 gi|393200022|ref|YP_006461864.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]