SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|393200100|ref|YP_006461942.1| from Solibacillus silvestris StLB046

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|393200100|ref|YP_006461942.1|
Domain Number 1 Region: 1-158
Classification Level Classification E-value
Superfamily Glutamyl tRNA-reductase catalytic, N-terminal domain 1.44e-45
Family Glutamyl tRNA-reductase catalytic, N-terminal domain 0.00031
Further Details:      
 
Domain Number 2 Region: 162-315
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 3.82e-36
Family Aminoacid dehydrogenase-like, C-terminal domain 0.00023
Further Details:      
 
Domain Number 3 Region: 318-420
Classification Level Classification E-value
Superfamily Glutamyl tRNA-reductase dimerization domain 5.23e-16
Family Glutamyl tRNA-reductase dimerization domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|393200100|ref|YP_006461942.1|
Sequence length 451
Comment glutamyl-tRNA reductase [Solibacillus silvestris StLB046]
Sequence
MHTLVVGLNYKTAPVEIREKLSFIESDLPNAMEALQKQKSILENVIISTCNRTEIYAVVD
QLHTGRYYIKQFLANWFNIPMEQFEDHLFIREEDDSLNHLFRVTAGIDSMVLGETQILGQ
VKKSFLQGQEIGTTGTVYNQLFKQAVTFAKRAHSETAIGENAVSVSYAAVELAKKIFGSL
KDKHVAILGAGKMGELAIQNLYGNGVGKVTVINRTFEKAQNLASKFDGDAKAMNELQCTL
LEADILISSTGATDYVIDYDLMKDVAKFRKGDPLFMVDIAVPRDLDPRIGDVSNVFLYDI
DDLQGIVQANLAERERAANEITAMIQEEIIQFKDWFNTLGVVPVISALRKKAASIQEETM
LSIENKMPNLTERERKILNKHTKSIINQLLKTPILQAKELANEKNAEAQLALFQQIFGIE
DEVQHEVQQLRPEVKRSETAKEVTLKPGLSY
Download sequence
Identical sequences A0A1A7M1I3 F2F2F8 K1LNY3
gi|393200100|ref|YP_006461942.1| WP_008405180.1.16583 WP_008405180.1.32796 WP_008405180.1.55795 WP_008405180.1.70781 WP_008405180.1.91521

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]