SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|393200269|ref|YP_006462111.1| from Solibacillus silvestris StLB046

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|393200269|ref|YP_006462111.1|
Domain Number 1 Region: 255-551
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 5.23e-85
Family DNA repair protein MutS, domain III 0.00000127
Further Details:      
 
Domain Number 2 Region: 557-788
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.51e-62
Family ABC transporter ATPase domain-like 0.000000742
Further Details:      
 
Domain Number 3 Region: 2-110
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain I 1.44e-41
Family DNA repair protein MutS, domain I 0.0000211
Further Details:      
 
Domain Number 4 Region: 114-267
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain II 6.02e-23
Family DNA repair protein MutS, domain II 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|393200269|ref|YP_006462111.1|
Sequence length 871
Comment mismatch repair ATPase [Solibacillus silvestris StLB046]
Sequence
MTTYTPMMQQYLLVKQDYKDAFLFYRLGDFYELFFDDAIKASQLLEITLTARSGNTDNPI
PMCGVPHHSAQGYIETLVSKGFKVAVCEQTEDPKHAKGVVKREVVQVITPGTITEGKALD
GKSNHFIAAAESNENDEMVFAYLDVSTGEANCSVIEGSAKQLIQQVQAYAIKELIVNEQL
QLLLADYAEAGGIVLSLETEEMDPVKANQYVAHLPVQLQGVAKRLLQYVERTQMRSLSHI
QPFTYTEAHNFLRIDTNSKRNLELIQSIRGGDSKGTLLWLLDETVTAMGGRKLKQWMHQP
LAKKNAIEARQAIVTELLEDFFLRDELMSLLKNVYDLERLAGRVAFGSVGGRDLAQLRES
LRQVPMIQQKLVNSGLEKCTALGQKLDVCADIEQLLAEAITDQPPISIKEGDVIRDGYNA
QLDEYRDASRNGKDWIAQLEQKERELTGIKNLKIGYNRVFGYYIEITKSHLNNTDLARFE
RKQTLANAERFITEELKEKEALILNAEEQSLALEYDLFVALREQLKGYIPRVQALAAQIS
ELDVLMSFAMVTDKYRFTKPVFHDGRALKIIEGRHPVVEKMLNKQSYVPNDCVLTNDKNM
MLITGPNMSGKSTYMRQVALIVVLAQMGCYVPADEAILPITDQIFTRIGAADDLAAGQST
FMVEMLESQHAITHATKNSLLLFDEIGRGTSTYDGMSLAQAMMEYIHDEIGANTLFSTHY
HELTDLENELSRLQNVHVSATEQDGRVVFLHKVKKGAADKSYGVHVAELAEMPETILQRA
RVLLEQFEAANEEKPQAINYKQEPPQNPQMPEQVMENDQQLSLFTIEEESAIAPEQQEVL
DALAKLNVMGTTPMQAMTLLYELQQKLLGNQ
Download sequence
Identical sequences F2F4I1
gi|393200269|ref|YP_006462111.1| WP_014823381.1.32796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]