SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|393200326|ref|YP_006462168.1| from Solibacillus silvestris StLB046

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|393200326|ref|YP_006462168.1|
Domain Number 1 Region: 115-296,425-584
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.13e-108
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000000531
Further Details:      
 
Domain Number 2 Region: 293-420
Classification Level Classification E-value
Superfamily GAD domain-like 4.58e-42
Family GAD domain 0.0000646
Further Details:      
 
Domain Number 3 Region: 4-107
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.86e-31
Family Anticodon-binding domain 0.0000426
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|393200326|ref|YP_006462168.1|
Sequence length 590
Comment aspartyl-tRNA synthetase [Solibacillus silvestris StLB046]
Sequence
MAQRTHACGLVTAAEAGQEVVLKGWVQKRRDLGGLIFVDMRDREGIVQVVFGDQAKDALE
LANKIRNEFVIEVKGTVVLRDASQINKNMKTGEIEVVASELTIINEAKNPPFAIDNNAEV
SEELRLKYRYLDLRRPVMYDTFKMRSDVTRTIRNFLQNEGFLEVETPILTKSTPEGARDY
LVPSRVHDGEFYALPQSPQLFKQLLMVGGFEKYFQIARCFRDEDLRADRQPEFTQVDIET
SFLSMDEIIEMNERLLTQVMKDVKGIDVVTPFPRMSYKEAMDRFGSDKPDVRFGLELKQL
SDIVKESAFGVFANAVANGGEVKAINVKGAAANYSRKDIDALGEFAGRYGAKGLAWLKVT
EEGLNGPIAKFFEGEAADTIIQATEAQAGDLLLFVADKSSVVADALGALRLKLGKELGLI
DESKFEFLWIVDWPLFEYDEAEGRYYAAHHPFTRPFDEDLELMNTNPKEVRAQAYDIVLN
GYELGGGSLRIYEPDLQAKMFELLGFTEEEARAQFGFLLEAFDYGVPPHGGLAMGLDRLV
MLLAGRTNLRDTIAFPKTATASCLLTDAPSQVSDAQLEELSLRIAATAKK
Download sequence
Identical sequences A0A1A7M127 F2F4N8 K1KM47
gi|393200326|ref|YP_006462168.1| WP_008408547.1.16583 WP_008408547.1.32796 WP_008408547.1.55795 WP_008408547.1.70781 WP_008408547.1.91521

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]