SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|393201828|ref|YP_006463670.1| from Solibacillus silvestris StLB046

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|393201828|ref|YP_006463670.1|
Domain Number 1 Region: 222-567
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 3.09e-97
Family beta-Lactamase/D-ala carboxypeptidase 0.0000224
Further Details:      
 
Domain Number 2 Region: 51-220
Classification Level Classification E-value
Superfamily Penicillin binding protein dimerisation domain 1.1e-38
Family Penicillin binding protein dimerisation domain 0.0014
Further Details:      
 
Domain Number 3 Region: 586-637
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00000103
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|393201828|ref|YP_006463670.1|
Sequence length 638
Comment cell division protein FtsI/penicillin-binding protein 2 [Solibacillus silvestris StLB046]
Sequence
MKWVTTKSKKRLTWIAIALVLYGVAIFVKLVSVQIIQYDELSTKAKENWDREIPFHTQRG
EITDRNNEVIVTNKLAPTLYFMPSQNEDKEQAADAIANVINKDRAKILERLQQRVSLVKI
APEAKNITYEQAEKIQQLQIPGLYSGVDYVRSYPHGNLLARFLGFTGADNQGLAGIEYEY
DELLKSSDAAIRLFTDAKGNALEHVDDEWKDGKDGATIQLTIDLKLQKIVERELSQAMLE
YDADQALAIAMNPNSGEILALASFPTYDPTKFSEVEPSIYNRNLPVFMSYEPGSTFKIIT
LSAAIEEGVVNMEEEHFHDQGYTMVEGARLRCWKRSGHKDQTFYEVVQNSCNPGFVELGQ
RVGSTKLLEYIHKFGFGKKTGSNIAGESSGILFSKEAFGPVEHATTSFGQGVSVTPIQQM
QAVSAAINGGTLYTPYTVSKILDSKTNEVIMEQDPEAKAQVISEETSEKVRHALELVVAK
GSGRQAFRDGLRIGGKTGTAQKVENGRYKDGDYIVSFIGFAPANDPEIIVYVAIDNPKSS
LQFGSVIAAPIVGRIIEDAAPLYNIEKQKDQIERNYVWGDELTERTPNFIGMTKEEVIPH
LYPYKIEWHGEGDKVIQQVPSADSLIHQSGSVHLYLGN
Download sequence
Identical sequences A0A1A7LWA8 F2F705
gi|393201828|ref|YP_006463670.1| WP_014824542.1.32796 WP_014824542.1.70781

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]