SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|393202014|ref|YP_006463856.1| from Solibacillus silvestris StLB046

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|393202014|ref|YP_006463856.1|
Domain Number 1 Region: 1-137
Classification Level Classification E-value
Superfamily FlgN-like 0.0000000000000144
Family FlgN-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|393202014|ref|YP_006463856.1|
Sequence length 167
Comment hypothetical protein SSIL_3287 [Solibacillus silvestris StLB046]
Sequence
MSIANIVVTLEKLEKMHKSLLELALAKTEYIKQGDMEKLDQLIKNEQSHVAAINTIEQQR
QVMVTDYLRAKGIALTDTPSVADVITAAENSESTEKLVSVRERLIALLNQLKMQNDLNQK
LVMNSLQFINITLDAIRPQQTEQFNYSGAQIRGNNEVAKRSFNDFKA
Download sequence
Identical sequences F2F322
WP_014824655.1.32796 gi|393202014|ref|YP_006463856.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]