SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|393202023|ref|YP_006463865.1| from Solibacillus silvestris StLB046

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|393202023|ref|YP_006463865.1|
Domain Number 1 Region: 3-131
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.55e-41
Family YigZ N-terminal domain-like 0.00012
Further Details:      
 
Domain Number 2 Region: 135-200
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 0.000000000331
Family YigZ C-terminal domain-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|393202023|ref|YP_006463865.1|
Sequence length 211
Comment hypothetical protein SSIL_3296 [Solibacillus silvestris StLB046]
Sequence
MRNNYITVKGYGESEIIISKSRFLTYVERVETEEEAILFIDKIKKMHTSATHNCSCYMIG
EHDQIQKANDDGEPSGTAGVPMLEVLKKQGLKDTVVVVTRYFGGIKLGGGGLIRAYSKAT
TEGIAAAQVVERKLHYLMKIEIDYVWLGKLENEIRGSHYPLHDIQYAENVEIYVHVLKEE
EQTFIDWITELTNGQAAIKNEDALFIEFSKE
Download sequence
Identical sequences F2F331
WP_014824664.1.32796 gi|393202023|ref|YP_006463865.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]