SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|554648981|ref|YP_008717975.1| from Carnobacterium sp. WN1359

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|554648981|ref|YP_008717975.1|
Domain Number 1 Region: 4-113
Classification Level Classification E-value
Superfamily YheA/YmcA-like 7.06e-37
Family YheA-like 0.0000961
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|554648981|ref|YP_008717975.1|
Sequence length 114
Comment hypothetical protein Q783_03140 [Carnobacterium sp. WN1359]
Sequence
MSTNIYDTANTLEKELRDSEEYTTLVAAFNEVKKDEAASKMYYDFQEVQIKLQQKQMSGE
QITEEEIAEAQNLAQTSGENDVIKGLMEAEQRLSTLIEDLNRIIMKPVQDVYQA
Download sequence
Identical sequences U5S8B0
WP_023177249.1.41848 gi|554648981|ref|YP_008717975.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]