SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|554650847|ref|YP_008719557.1| from Carnobacterium sp. WN1359

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|554650847|ref|YP_008719557.1|
Domain Number 1 Region: 12-82
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.0000000824
Family DNA-binding N-terminal domain of transcription activators 0.026
Further Details:      
 
Weak hits

Sequence:  gi|554650847|ref|YP_008719557.1|
Domain Number - Region: 90-147
Classification Level Classification E-value
Superfamily YheA/YmcA-like 0.068
Family YmcA-like 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|554650847|ref|YP_008719557.1|
Sequence length 191
Comment hypothetical protein Q783_11580 [Carnobacterium sp. WN1359]
Sequence
MKEIQAIEYISTKLVCEKLKIQPSTLRKYASMLDEKAKTEFYFTRDDSNNRVYTKEDIAV
LQRIIELKNRPGYTLEAAINEVVGLSYNSDIQDAIAVNEENDNYLKALHSFVAQQNKYFE
DYQSVLQKKDEQIDRLESLVSSLIENNINDMSVSTEDSTTNFEEPKEFEKMSSEESMTIS
TPKKKKWWNFK
Download sequence
Identical sequences U5SCF4
gi|554650847|ref|YP_008719557.1|NC_022607 gi|554650847|ref|YP_008719557.1| WP_023179909.1.41848

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]