SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Esi0037_0092 from Ectocarpus siliculosus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Esi0037_0092
Domain Number 1 Region: 512-656,777-833,870-917
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 7.42e-37
Family Calponin-homology domain, CH-domain 0.0018
Further Details:      
 
Domain Number 2 Region: 1546-1638
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000023
Family Motor proteins 0.064
Further Details:      
 
Domain Number 3 Region: 1483-1553
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000204
Family Motor proteins 0.066
Further Details:      
 
Domain Number 4 Region: 1634-1714
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000743
Family Motor proteins 0.072
Further Details:      
 
Domain Number 5 Region: 1408-1505
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000531
Family Motor proteins 0.066
Further Details:      
 
Domain Number 6 Region: 1290-1369
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000797
Family Motor proteins 0.046
Further Details:      
 
Weak hits

Sequence:  Esi0037_0092
Domain Number - Region: 2119-2193
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000125
Family Motor proteins 0.022
Further Details:      
 
Domain Number - Region: 1081-1152
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000138
Family Motor proteins 0.037
Further Details:      
 
Domain Number - Region: 2008-2097
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000143
Family Motor proteins 0.03
Further Details:      
 
Domain Number - Region: 1757-1820
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000248
Family Extended AAA-ATPase domain 0.087
Further Details:      
 
Domain Number - Region: 2169-2255
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0069
Family Motor proteins 0.094
Further Details:      
 
Domain Number - Region: 2330-2442
Classification Level Classification E-value
Superfamily ARM repeat 0.023
Family Armadillo repeat 0.06
Further Details:      
 
Domain Number - Region: 1168-1263
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0345
Family Motor proteins 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Esi0037_0092
Sequence length 2511
Comment similar to asp (abnormal spindle)-like, microcephaly associated [2512] f:503441-522556
Sequence
MSSSAEGRLGDGRGRGGGQVPETAVLVLGNFQGAVVLDMGLVTVGEGKGATLRIEVPEGA
RKAVTTIGFDPRHPLSGGLEVADFDGELSLGRGEYREVHVAWRPERVGKFRGNLAFKVDG
RFPAQVSVVGETVDVGGGGKRRKGDAREGRKRVRGGLPVGARAGRSLSQEAASRGAGPHT
SMYGKENRLSLSSTALPPAASVLGPSPDSFAAALCPRTANNKRQQMLKYSKSRRLSLKPG
HKREKSDGGGSAGEESSGGGSKATLLRKSLSDKGWAEKQTAGFTNWLNFTLVGAEQLRHG
AGDDGEEEDGGLTAEIGGVSSSPLKAMVAMRHEARQRMRAMRLFRSVEVRTATEAVADRA
YDGTISLRRDRVLHADVGLSGALIDLVLCYEPRWLLLGLETVFGEIVPMPAGGVPAAART
KAGGRVDRALRTFVAERLVKCPEMKARYGFRGRVASGASEVEYNDELGRHALTHFLDLVL
FLDRAKAENLLHPCPCLFRKTAEVKSSVGMLKVFCQFLHGEGDFVRHLKKMGYVVGHVQS
YIDEFDFRVSNLAVDLRDGVRLTRLMEVVTGEWGLAIGLRVPAVSRLQKIFNTKRALERL
EADAGPITLGSNSSGSGGGGGGAVTPKEIVDGDRHATLRLLWFIITRYSLSALLDRDALA
REAEGVVSAARKWRRAGFSPARPERAMRKMGAIGAAAAAAAAAGAAAAAGVGEATVVDFG
VMSPGSPASPVAPPAGGRAVAGEEHPPLELPDVAAMVEGWEEKAGGGNGDGGRRDGGGGG
DEELLSALLVWCQAVCHGYGVPVRNFTTSFADGRALCLLLHYYHPRIIPLNAIRRTTAHL
PRIGGGRGELEDWSASLDASKITEAECKAALDGERANVALARHCVAELGGVPSMLAPFDS
TNRPEEKTIITVVAHLCARLLESSAEIRSTILVQRVYRSFLERTGRGDLVERARAAKARA
RSKAAAERAAAAAALARAGDGAVPFTPPATRRGPAAAAAAAAAERVLPEQTMYVSEKQRV
HLAAVTIQGWWAAGAEGRLRRLGRSAAATAVQAAWRGKAARRAASSRREELAEQAERELE
KRIIEAAGSIQAAVRGRFERKAFLRARDASAVLQMWTRGRLQRTRYLALIRQVSAAVLLQ
SWARGLAGRRRADAAREVRQMQLQAAAENSAATTVQAWRRMLSARRQLSAARQAAVRIQA
VARGRAEASLYRKKRAAVIAVQAAQRGTAARARLTRERAAKRAAAKHTAAVRLQALCRGV
LARGRRHRQETAATLLQARARGAAARKQATRRGIAVAVLQRWGRAALERRRYRRAVAAAC
VVQGWARGSVARRAVSERRDAVVRVQAWARGALEAGRYRRRLRAAVVLQAWRRGVVERAR
MDARRRAAVRVQAIARGRREASLFRGKRAAAVRVQAWSRATVVRGELAARQRASVRLQAW
ARARRQERGFQEAKRAAVVVQAWWRGASAARSFRKLVRAAVVAQARARAVVAAARYRRTV
DAAKMIQSHWRGALAVARYRKDVSDVVRIQANWRAALEKSRYRRTKEAAVVVQAYVRGAA
QAASYRRSLAAVVVIQSGLRRAAAVARYRKDVSAVVRIQACWRAALERSRYRRTKEAAVV
VQAYLRGAAEAARYRRTVAAVVVIQSGLRRAAAVARYRKDVSALVRIQACWRAALEKSRY
RRTKEAAVVVQAHARGAAEAARYRKTLAAIVVVQSGFRRAAAVARYRKDAKAVVRIQALW
RAALERSHYRRTVAAAVVVQARRRRAVAQTCYRKLVGAAVVIQSRRRGAAAATAYRRDRD
AAVTVQSAMRGASARRELARQAGRATQIEAWWRMVTARSLARRQKRSAVRLQAAWRGAVV
RAAYRRAVDGTARFQALVRGAQSRARLARERQEIEAAVLLARAQEAEAAAASAIQARARG
QRARRDQARRAVAVTRIQSAARAAAACARVARRREQRRAMLASAVIQRVWRGAAARAMLS
RRTVAAAAVQRWWRSVLGEARRQQALEQSSATLLQACSRGHLARAALRREASAAVAIQAC
WRGASARSRAAGRFAAAVRLQAFGRGALATTRFRRTRAAAAAVQARWRGAAARSRLAAET
AAAAAAAAVAAEIRAAREESAARTLQAFARGTLERAQLRRAEAAAVVVQQAWRGRLLRRR
RREREVATAAVAVQAWWRMASARAEYRQARRGTVALQAAVRGKAARGALKAERDASTRIA
AWWRAAAEAARYRRTRRRVVMLQSLVRGRRAREEAAARWLVLGRRFSRAKAATMIQAAAR
GMAARKKTGPGIASARARIEKANANALADPSQILGTRVNDALTALEHCTHLTAIIRACIA
LELTSRYSKVCCEVMARSRCPQVLYDLIRGLNRSPPHQKILKYAITTFRNIAQRGDGLPA
LLAAPPVAAETYVDLLQMYRERQEVFLPTVRLLQQLLNAHKPTKDECNSVKHRPRLESIR
DILARKAAVEAKSIAARGGGGGVSSGCGGGGGRASKSLKAVQGLLDELARD
Download sequence
Identical sequences D8LLN9
Esi0037_0092

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]