SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Esi0102_0052 from Ectocarpus siliculosus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Esi0102_0052
Domain Number 1 Region: 31-253
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1.68e-40
Family PP-loop ATPase 0.00082
Further Details:      
 
Domain Number 2 Region: 445-504
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.0000000186
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Esi0102_0052
Sequence length 542
Comment conserved unknown protein [543] r:343606-355081
Sequence
MEAAPTTPSTSAVLYTYVQVLVLMAWVVAVAGKEVLVLVSGGSDSVALLLALERAAKTFQ
PPLRVEAAHFNHGLRGKDSDADQDLVVKMADSLRVPLHVRRWKGPEEGGTGGPGSGMQER
ARRWRRAEAKDILAKSMTEAGAGRGGRGVIATAHHKDDQTETVLLKALRGAHITNIQGMA
WHSDPFVRPLLGAHKTELLDFLVRGRHAWREDGSNQVAKYARNRVRLQLIPLLRELAGGT
KALDTRVEELSRQSHFARQMVEREALRWERAHLSGCRFDDEAGGCRDETDQVGGADQSAG
TRGTVDRSGGVGDVAPSGIRREEFPLQAFLRKGPGGDGSEQGWAGSDLPELVREELLHRF
IVGDLLRIEQSPADGGIMVSGLEGRTVSEQGIVRHSTDAAITPWEMVVSPWGEGGSVGLG
EEGDSGHGEGRATEAGMVLFNVAAGARLHVRRKKDGDRFRPAWRDRPAKLKDFLRGQGVP
LHRRDEVALICDHHDAVIAVYPSYPGFGVCQDSTGEEPIRVRIAGTPLFCPRPEDRGGAP
AS
Download sequence
Identical sequences D7FGW8
Esi0102_0052

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]