SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Esi0107_0056 from Ectocarpus siliculosus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Esi0107_0056
Domain Number 1 Region: 5-129
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 8.64e-43
Family Calponin-homology domain, CH-domain 0.0000311
Further Details:      
 
Domain Number 2 Region: 212-272
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 0.00000000000000144
Family EB1 dimerisation domain-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Esi0107_0056
Sequence length 317
Comment putative microtubule-associated protein EB1 [318] r:384882-394068
Sequence
MSTSIGMMDPAYFVGRKEILDWLNSYLSLNLSKVEETCSGAVACQLVDSLFPGKVPMSKV
NWDARNDSEYINNYKVLQSAFDRLHIDKHIDVQRLTRGKYMDNLEFMQWFKNFHDTTGAM
EGYDAVERRSKGRGGAKYGGGGARRPVGGQAASRASRPAASAARGGASSSSTASAAAAAR
APASSTLKSRAAPARSSARAPSPDPQLVAKCDELTQERDELLTTMAAVEKERDFYFDKLR
DIELLFQNDEQESGESDLTKNAFKILYATDEDHDQAAEGEEPLEADQAQTLAGDTEDLLA
EDGDDQAAGVAGVDLEL
Download sequence
Identical sequences D7FHD5
Esi0107_0056

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]