SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Esi0134_0011 from Ectocarpus siliculosus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Esi0134_0011
Domain Number 1 Region: 130-400
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.72e-54
Family Calponin-homology domain, CH-domain 0.00000336
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Esi0134_0011
Sequence length 831
Comment Fimbrin [832] r:49453-60829
Sequence
MKWPKGKKKNGSAKKKKVGSQQPTPTKSAAADQRSQVSTPGGSAGGSLGLGTLRLGTLRA
DSSSAPMCTPTPTSRRQSISDLLGPDTDGEGEDLSTVTASPALRNIISNRKSLSGSFDTK
RGKGDSITTYTSEEKAVFACHLNAHLVGDPFLTHLMPLDPGGADLFDSFKDGVLMCRIVC
LAIPGSIADTNVNTPTNDEPLSLYKANENLNVALEAAEKHGLQVVNIGATDIIQGRPASI
LGLTWQLIRIHLLAQINLKGCPDLIHLMEGGESKEAFFELPVEEVLLRWFNHHLRWGGSE
RRVANFGDDLADGRCYVTLIKELNDKFKGEEVDPTEEEDAKRAQFRRACLVISGAEGIGL
APLIRANHITGKAHLYNIAFVAQLLNRRPRIHRESLHLDASVTMQAWFRMVSVMRRTNPV
LEERRRSAQTLTRACRRWMTARNRLRAATALQALWRGGEGRAIAANRRFLAAKRLADQAE
AKAARQAAKRKREAAALQREKETAAARSMQALARGVATRQAVSEALESRGLPLLLAEQRR
RGSYGSNLKGSKVMQGISPRTSAASSIRMSEDSPAGEGGQDHSFGGGSITPAYDGEEPQG
SPSWFDRVFSGISFGMPDRGNKNPKRTAAAAAMVIQRWQRRVAAARVETARARQEVANRR
WAVDKLHSAYANRWRFEVAARRERRQKWEEEARRNIGDKGGRGLRGLWADITSLASSDDF
FSFKGWLARRQARQLQQKDMEEADADCCDVAGEHVLASEIDAWKLPNQVFGGAGMGWAQE
ERARALCSIKDDAAWSSPEKALSPVKVFAMVSVLLTVAFEGVLPNAAAIGL
Download sequence
Identical sequences D7FJH8
Esi0134_0011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]