SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Esi0212_0061 from Ectocarpus siliculosus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Esi0212_0061
Domain Number 1 Region: 774-881
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.96e-25
Family Calponin-homology domain, CH-domain 0.00075
Further Details:      
 
Weak hits

Sequence:  Esi0212_0061
Domain Number - Region: 1042-1111
Classification Level Classification E-value
Superfamily EF-hand 0.000137
Family Calmodulin-like 0.076
Further Details:      
 
Domain Number - Region: 964-993
Classification Level Classification E-value
Superfamily ARM repeat 0.0921
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Esi0212_0061
Sequence length 1121
Comment conserved unknown protein [1122] r:270842-279859
Sequence
MSVVLQALNRQDALSWASHLYQASAVANGGGYLLDQERDQEVAYEEERRRRLAQEALERE
RFARSKRNSPQRPRSQAEEEQKEEGLPQQPQQQEGEDGQPAADGAPVPAAGSDDVVLEDK
AAVAEAAGGAAAEAETATATVSAESATAGPLGFSTTDPTAAAAAAAAAAPAVDDAAAAAA
RDGDEQQRSLDGDNADDVVVVVAPDAAASAGDDDGVGSEKDDADESPSSPTAAAAASAGR
PELTVEVGDVVNGGTSAAAAAASGGAAAALSAPSEESTIGDLGGGRRPSGSVGGRPTFER
KSSSVMDLIREREKAAQSARLPPSARKETSATHSPSLAAALTRGKVGAKPWMGASDNNNT
PAADAAAAAAASTPRWGSSVFSSSTPKASAAAAAAASGFSSTTPAVASTGGDDATAGEEE
EEEEEQEKVASLAAAEASAGAGGGGVGEKALSPSMAAARMRKTVDRSMWSSAPSSSGAGS
GPGLSATWAFNSAAGKQQKSSDESAQESGPAEETEDGASGAPPAAVADCPPPAGFAAAKA
LFASTGGIPSGSKASLPPPSKPRTSTGAAAAAYARAAATSNSTSAPAPREPVHRATTKPW
EKKTTTAGGGGGGGGGATGASWGSAAAPASAAAVTTTDSSSSSSDDDGEPSSSAGGGRSL
SPVTTPGAGGAAAKGSTSRHHQKSSEPRASPAVAAAAAAEPSLSSSSVFGSTGGSVKAMS
RDVFGSSSSGFKRPPTGGVALAGFGLTAPAASARKVPEVAAPPLESRPIGGPWDEEEVLK
WVRDVTKLDIDPECGVAYSLKDGVALCRLMSKLQPGAPITAPSDSSLAYKQMANICIFLR
CCRTLGLGESILFETADLYEEKDIPNVVKTLVALGEHVPRSCPAFKGPHLNMSKFAWSTV
LAQPSSTSGGSGKASSLRASTGGISGRGGGGVSGSWPRRGGSTGGNGNVGAVWRRAVGSD
HPASSGDEGSSEDDDDDDFDSDEDDEEYDDEDEAVGSGSSSAAAAANGGSRAAAATGGGA
RDGELTDEMLSKAYDSVEAASQSGGLSTIQFSSLWRSLSGDRQNLFAEMKMFHKFNTSGD
SVVNFEEFKAGFRLIAQENAKEHEQVLKNLKDWTDSQPAAF
Download sequence
Identical sequences D7FRC5
Esi0212_0061

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]