SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Esi0393_0014 from Ectocarpus siliculosus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Esi0393_0014
Domain Number 1 Region: 409-519
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.83e-31
Family Calponin-homology domain, CH-domain 0.0003
Further Details:      
 
Domain Number 2 Region: 35-137
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.3e-29
Family Calponin-homology domain, CH-domain 0.00026
Further Details:      
 
Domain Number 3 Region: 748-841
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.53e-19
Family Calponin-homology domain, CH-domain 0.00092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Esi0393_0014
Sequence length 886
Comment calponin domain-containing protein [887] f:55650-60966
Sequence
MGTMSPSRGQAAWAMLPSPSTPSARFARDASAGLKARNWVEEVIGRRLPEGDFAAGFKDG
QGLCELVNTFRPASIPKIERSASPFHQMANISSFLKACRMLGVSEHVLFETLDLFNENRL
PQVVRCLFSLSELVRTTMPSYHGPYLGAPDKPEVDPAVLHLVDIAKGNVVPAAGVAPADA
GVASSGKKGSRAAAAAAAAGLEPLSLPKHDGEDGATSSRCCLSPAAHEAGKLTYGVYEGG
GGGGGGGPAPAKPPRTPGAARTARLRAARTPGPDDAGVVSGEQAAGGGTTDAHRRQAQEP
ASAAALGGKRSGGAGAVAREGSEGGGGGGGGAVEYAESALSVANTPRRCNPMMMPSPRAE
GASTPRGEVGGGGSGGSDGGAVASDYYGFGRSSSSVEDQARRRREATAQNDAEMEVALWI
EGVTGETFPGKFWSSLKDGVLLCDVLNSIKPGLVPQVNPSRGTFVELENISAFLSGCRKV
GVPEHSLFDTKDLHEKRDMQVVVHCLHVLGAAVQSTVPDFRGPLLGKKSEALSIVNARGL
RKRLGKGPGARGGIHTLTAHKGGAGEYVGSGDVPIEQPDPTATMTPAESPSGKRASRRRE
ASDSAGGSGVVAAGTPASPRAIAEGLSGGVLPAVILEEEAPAGMTSAVVRVERQGRRGAR
PAEEAGGGGSGRQNLAGLFADAALAADPRESRGRGGAVALRRTASGASGVSGNQQRRSRG
AHRQRHHQQRKDEDGEGVVSQVQRFVELHTRQPWRVSGDMHESLRDGWQLALLANALRPG
AVRCVHNSIQPVKHIQNIAGFLIACRRMGVARALLFDIEDLYEKRSNTRVARTLLALRAL
AADPDFALARPSSLIGTSLLVNAAAAAAKTGLASGPPSAASAGGRR
Download sequence
Identical sequences D7G043
Esi0393_0014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]