SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PP1S243_74V6.1 from Physcomitrella patens subsp. patens 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PP1S243_74V6.1
Domain Number 1 Region: 30-140
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.47e-18
Family B3 DNA binding domain 0.01
Further Details:      
 
Domain Number 2 Region: 232-327
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000628
Family B3 DNA binding domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PP1S243_74V6.1
Sequence length 609
Comment pep:novel scaffold:ASM242v1:DS545132.1:571105:576169:1 gene:PP1S243_74V6 transcript:PP1S243_74V6.1 description:""
Sequence
MTFSEPETVETKLSCRDFKEMLHCLQCSIYFVQKLTASNVLGIYTRRRTCQLTLPRQFVR
EHGNRIRKSVVLLSGLSHGPWNLWLSICPSRPVMPEVTFSSGWRAFVAFNGLEEGDHLIF
SLTAVSQFQVYIFNGNGHQKKPQMLEASVKWSDGIEFPQKKILNQSLGYNLAEGNAGLVC
NVCPICARRRPLSEKEFAGTASTDTCSQSSPHSSALNAQVSLEFSQKCRKYFPSFSKRIV
ARDVFRLEIPQHFAVKYGSQLLDSIQLQGIHESSPVRNLQTISHLDKARVRLYLAGAGWD
NFVTENMLRVGNELVFYLSADSFFKVVDSTVAYDSMFEKPAHSFKFVDILPRNEEMDLKG
GNMKERMGNPHSATKEGTGTTETPQISTDESSVRRFGDPMTGKKREKSSSGLHNLFLFFL
CKRYKHGTAEALVKEIDIEVADLNYISPRNSTSCESHFYGPVTQPCILTLCAKLGYVCLE
LLRSKFVDGHLARIRVRIRFSNSHPQCKLMQRILQKSPLQSCCSTEIYSERHHARECSGE
ASQRKPLTSDPSFLKLLTLTRINHLVGSCKKSSFWNHSSGFGVEPRRSQFGAGKWPQASL
LPATWRGSP
Download sequence
Identical sequences PP1S243_74V6.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]