SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PP1S392_41V6.1 from Physcomitrella patens subsp. patens 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PP1S392_41V6.1
Domain Number 1 Region: 341-445
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.8e-18
Family Ankyrin repeat 0.0019
Further Details:      
 
Domain Number 2 Region: 127-210,269-296
Classification Level Classification E-value
Superfamily POZ domain 2.59e-17
Family BTB/POZ domain 0.017
Further Details:      
 
Weak hits

Sequence:  PP1S392_41V6.1
Domain Number - Region: 241-280
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 0.0334
Family Skp1 dimerisation domain-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PP1S392_41V6.1
Sequence length 686
Comment pep:known scaffold:ASM242v1:DS545279.1:241557:245376:-1 gene:PP1S392_41V6 transcript:PP1S392_41V6.1 description:"Predicted protein "
Sequence
MLSNLEPVHFSCIWLSWNSFGLKIAHEALVTIHPHFHEFVQWNREFSVHAGFARILDLGV
AYCHCGKLPGLLDYIATQSSSIDLCYTALLSLKDLCTRRAVIGAMQISQKHSYMSPEDQS
LKTLSADFLALLDKGQAFSDVTFKVEDRHVFAHRCVLAARSPFFRMVFCDDQQLNSAQPR
PGIPNVISVGVVGYDVFMLLLQFLYSGNYSNFFSPQNCGRQCKDKSCWHTHCSSAVEFGL
DTMKAALFFGLDQLSTLTQKHLAAMAEKASVEDVMRILTTAHTQENKHLWNVCSKLVAKS
GPFSEILQKHLPANIVCELEDIRRKSGFGFEAAMSSNTTSEQKTKRMQKALDSSDVELVQ
LMINGEGLNLDKAFALHYAVSKCSRKVVKTLLDLGKANVNLRGPDGLTPLHIAAKLGDPE
KIVMLLNHEADPHVQSASGATAMGIVQFGMTEIVSAGGYNSKGDQNRLRLCMELLERAIL
APTSSLHARYNKVESGSPASILTGHGSSTFLPEESDTDFRWSMRRTMSGSNQGVYVGNND
ISSSFSHGLTDKVYGKEPERPETSDSISRLLYPSSVAIDLSESQLQAESRSLTGSYSVLD
TSILEERPRKMQRSFADLKNLPVLREAVLKDFSNEAMESFKTVCNPNHVDEEVSSGWQLF
LQERSEAHYARGDTSVKICPKKPDRQ
Download sequence
Identical sequences PP1S392_41V6.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]