SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378448079|ref|YP_005235571.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378448079|ref|YP_005235571.1|
Domain Number 1 Region: 28-138
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000555
Family Recombinase DNA-binding domain 0.057
Further Details:      
 
Weak hits

Sequence:  gi|378448079|ref|YP_005235571.1|
Domain Number - Region: 207-313
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.000114
Family Retroviral integrase, catalytic domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|378448079|ref|YP_005235571.1|
Sequence length 345
Comment putative integrase protein [Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S]
Sequence
MPIIAAIPDEERQLMRKEAQQTHDKNHARRLIAMLMLHQGMTVTDVARLLCAARSSVGRW
INWFTLHGVEGLKSLRPGRAPRWPVADILQLLPLLVQRSPKDFGWLRSRWSTELLALVIN
RLFDVTLHRSTLHRYLRQADMVWRRAAPTLKIKDPHYEEKRLVIDQALAQEQTAHPVFYQ
DEVDIDLNPKIGADWMPKGQQKRIATPGQNQKHYLAGALHSGTGRVHYVSGSSKSSDLFI
SLLETLRRTYRRAKTITLVADNYIIHKSRKVERWLEENPKFRLLFLPMYSPWLNPIERLW
LSLHETITRNHQCRYMWQLLKQVAQFMNAASLFPGNQQGLAKVER
Download sequence
Identical sequences A0A024JPQ5 A0A0F6AW54 A0A0G2NJ37 A0A0U1JZ31 A0A1S6L596 A0A1S7H7K3 A0A2D3AR29 A0A2H9YDE1 C0Q8M9 E8XLJ4 H9ACI9 H9L4L3 Q53933 Q5J4D1 Q7DAP4 Q7DII7
NP_490532.1.58477 WP_001121399.1.100010 WP_001121399.1.100234 WP_001121399.1.100376 WP_001121399.1.100424 WP_001121399.1.100488 WP_001121399.1.100541 WP_001121399.1.100597 WP_001121399.1.100793 WP_001121399.1.100871 WP_001121399.1.101007 WP_001121399.1.101074 WP_001121399.1.101180 WP_001121399.1.101259 WP_001121399.1.101284 WP_001121399.1.101353 WP_001121399.1.101404 WP_001121399.1.101420 WP_001121399.1.101589 WP_001121399.1.101707 WP_001121399.1.101878 WP_001121399.1.101953 WP_001121399.1.10220 WP_001121399.1.10266 WP_001121399.1.10439 WP_001121399.1.10992 WP_001121399.1.11031 WP_001121399.1.11458 WP_001121399.1.11518 WP_001121399.1.11532 WP_001121399.1.11543 WP_001121399.1.11763 WP_001121399.1.11772 WP_001121399.1.12351 WP_001121399.1.12370 WP_001121399.1.12546 WP_001121399.1.12879 WP_001121399.1.12936 WP_001121399.1.12995 WP_001121399.1.13106 WP_001121399.1.13509 WP_001121399.1.1387 WP_001121399.1.13908 WP_001121399.1.13932 WP_001121399.1.13968 WP_001121399.1.14001 WP_001121399.1.14151 WP_001121399.1.14239 WP_001121399.1.14320 WP_001121399.1.14410 WP_001121399.1.14466 WP_001121399.1.14524 WP_001121399.1.14725 WP_001121399.1.14852 WP_001121399.1.1489 WP_001121399.1.14932 WP_001121399.1.15055 WP_001121399.1.15124 WP_001121399.1.15223 WP_001121399.1.15316 WP_001121399.1.15369 WP_001121399.1.1540 WP_001121399.1.15468 WP_001121399.1.15508 WP_001121399.1.15637 WP_001121399.1.16103 WP_001121399.1.16233 WP_001121399.1.16284 WP_001121399.1.1635 WP_001121399.1.16468 WP_001121399.1.16650 WP_001121399.1.16686 WP_001121399.1.16735 WP_001121399.1.16858 WP_001121399.1.16896 WP_001121399.1.16965 WP_001121399.1.17096 WP_001121399.1.17307 WP_001121399.1.174 WP_001121399.1.17702 WP_001121399.1.17705 WP_001121399.1.17758 WP_001121399.1.18019 WP_001121399.1.18163 WP_001121399.1.18265 WP_001121399.1.18607 WP_001121399.1.18705 WP_001121399.1.18715 WP_001121399.1.18949 WP_001121399.1.19320 WP_001121399.1.19458 WP_001121399.1.19461 WP_001121399.1.19702 WP_001121399.1.19706 WP_001121399.1.19724 WP_001121399.1.19749 WP_001121399.1.19784 WP_001121399.1.19802 WP_001121399.1.20 WP_001121399.1.2010 WP_001121399.1.20266 WP_001121399.1.20271 WP_001121399.1.20443 WP_001121399.1.20525 WP_001121399.1.2054 WP_001121399.1.20553 WP_001121399.1.20626 WP_001121399.1.20646 WP_001121399.1.20886 WP_001121399.1.21269 WP_001121399.1.21400 WP_001121399.1.21497 WP_001121399.1.21499 WP_001121399.1.21603 WP_001121399.1.22024 WP_001121399.1.22062 WP_001121399.1.22067 WP_001121399.1.2221 WP_001121399.1.22270 WP_001121399.1.2235 WP_001121399.1.22379 WP_001121399.1.22485 WP_001121399.1.23114 WP_001121399.1.2314 WP_001121399.1.23192 WP_001121399.1.23460 WP_001121399.1.23482 WP_001121399.1.23634 WP_001121399.1.2364 WP_001121399.1.23932 WP_001121399.1.24308 WP_001121399.1.24476 WP_001121399.1.24578 WP_001121399.1.24779 WP_001121399.1.25008 WP_001121399.1.25405 WP_001121399.1.25454 WP_001121399.1.25690 WP_001121399.1.2570 WP_001121399.1.25740 WP_001121399.1.25793 WP_001121399.1.25814 WP_001121399.1.25988 WP_001121399.1.26311 WP_001121399.1.26319 WP_001121399.1.26429 WP_001121399.1.26493 WP_001121399.1.26551 WP_001121399.1.26567 WP_001121399.1.27173 WP_001121399.1.27206 WP_001121399.1.27561 WP_001121399.1.2763 WP_001121399.1.27761 WP_001121399.1.2777 WP_001121399.1.27977 WP_001121399.1.28094 WP_001121399.1.28170 WP_001121399.1.2835 WP_001121399.1.28575 WP_001121399.1.28625 WP_001121399.1.28694 WP_001121399.1.2879 WP_001121399.1.2890 WP_001121399.1.28946 WP_001121399.1.29010 WP_001121399.1.2910 WP_001121399.1.29606 WP_001121399.1.29615 WP_001121399.1.29711 WP_001121399.1.30027 WP_001121399.1.30180 WP_001121399.1.30505 WP_001121399.1.30507 WP_001121399.1.30794 WP_001121399.1.30833 WP_001121399.1.30835 WP_001121399.1.30972 WP_001121399.1.31 WP_001121399.1.3113 WP_001121399.1.3119 WP_001121399.1.31190 WP_001121399.1.31195 WP_001121399.1.31196 WP_001121399.1.31362 WP_001121399.1.31504 WP_001121399.1.31515 WP_001121399.1.31578 WP_001121399.1.31658 WP_001121399.1.31940 WP_001121399.1.31967 WP_001121399.1.31972 WP_001121399.1.32192 WP_001121399.1.32255 WP_001121399.1.32493 WP_001121399.1.32702 WP_001121399.1.33030 WP_001121399.1.33127 WP_001121399.1.33143 WP_001121399.1.33248 WP_001121399.1.33261 WP_001121399.1.333 WP_001121399.1.33492 WP_001121399.1.33592 WP_001121399.1.34 WP_001121399.1.34075 WP_001121399.1.34257 WP_001121399.1.34279 WP_001121399.1.34319 WP_001121399.1.34610 WP_001121399.1.3476 WP_001121399.1.34856 WP_001121399.1.34975 WP_001121399.1.35045 WP_001121399.1.35129 WP_001121399.1.35219 WP_001121399.1.35404 WP_001121399.1.35408 WP_001121399.1.35425 WP_001121399.1.35446 WP_001121399.1.35503 WP_001121399.1.35509 WP_001121399.1.35590 WP_001121399.1.35940 WP_001121399.1.36003 WP_001121399.1.3601 WP_001121399.1.36705 WP_001121399.1.36931 WP_001121399.1.36948 WP_001121399.1.37073 WP_001121399.1.37111 WP_001121399.1.37112 WP_001121399.1.37293 WP_001121399.1.37370 WP_001121399.1.3744 WP_001121399.1.37498 WP_001121399.1.37618 WP_001121399.1.37968 WP_001121399.1.37978 WP_001121399.1.3848 WP_001121399.1.38673 WP_001121399.1.38693 WP_001121399.1.38913 WP_001121399.1.39136 WP_001121399.1.39197 WP_001121399.1.39229 WP_001121399.1.39385 WP_001121399.1.39405 WP_001121399.1.39420 WP_001121399.1.39512 WP_001121399.1.39629 WP_001121399.1.39763 WP_001121399.1.39923 WP_001121399.1.40017 WP_001121399.1.40072 WP_001121399.1.40073 WP_001121399.1.4011 WP_001121399.1.40208 WP_001121399.1.40240 WP_001121399.1.40257 WP_001121399.1.40292 WP_001121399.1.40395 WP_001121399.1.40465 WP_001121399.1.40710 WP_001121399.1.40877 WP_001121399.1.41086 WP_001121399.1.41091 WP_001121399.1.41279 WP_001121399.1.41554 WP_001121399.1.41572 WP_001121399.1.41761 WP_001121399.1.41882 WP_001121399.1.42320 WP_001121399.1.42422 WP_001121399.1.4276 WP_001121399.1.42864 WP_001121399.1.43018 WP_001121399.1.43041 WP_001121399.1.43244 WP_001121399.1.43312 WP_001121399.1.43334 WP_001121399.1.43437 WP_001121399.1.43613 WP_001121399.1.43668 WP_001121399.1.43886 WP_001121399.1.44005 WP_001121399.1.44043 WP_001121399.1.44099 WP_001121399.1.44121 WP_001121399.1.44187 WP_001121399.1.44291 WP_001121399.1.44310 WP_001121399.1.44640 WP_001121399.1.4467 WP_001121399.1.4485 WP_001121399.1.44877 WP_001121399.1.44943 WP_001121399.1.45067 WP_001121399.1.45079 WP_001121399.1.45177 WP_001121399.1.45184 WP_001121399.1.45259 WP_001121399.1.45349 WP_001121399.1.45365 WP_001121399.1.45550 WP_001121399.1.45585 WP_001121399.1.45660 WP_001121399.1.45690 WP_001121399.1.45706 WP_001121399.1.46069 WP_001121399.1.46112 WP_001121399.1.46174 WP_001121399.1.46187 WP_001121399.1.46303 WP_001121399.1.46595 WP_001121399.1.47057 WP_001121399.1.47214 WP_001121399.1.47429 WP_001121399.1.4747 WP_001121399.1.47472 WP_001121399.1.47478 WP_001121399.1.47799 WP_001121399.1.483 WP_001121399.1.48367 WP_001121399.1.48377 WP_001121399.1.48524 WP_001121399.1.4853 WP_001121399.1.4885 WP_001121399.1.48876 WP_001121399.1.48894 WP_001121399.1.48919 WP_001121399.1.49155 WP_001121399.1.49239 WP_001121399.1.49256 WP_001121399.1.49290 WP_001121399.1.49366 WP_001121399.1.49490 WP_001121399.1.49515 WP_001121399.1.49572 WP_001121399.1.4979 WP_001121399.1.49803 WP_001121399.1.49929 WP_001121399.1.50080 WP_001121399.1.50161 WP_001121399.1.50376 WP_001121399.1.50389 WP_001121399.1.50777 WP_001121399.1.50804 WP_001121399.1.50808 WP_001121399.1.5088 WP_001121399.1.50941 WP_001121399.1.51014 WP_001121399.1.51182 WP_001121399.1.51186 WP_001121399.1.51487 WP_001121399.1.51518 WP_001121399.1.51634 WP_001121399.1.51649 WP_001121399.1.51686 WP_001121399.1.51756 WP_001121399.1.51911 WP_001121399.1.51932 WP_001121399.1.51989 WP_001121399.1.52121 WP_001121399.1.52353 WP_001121399.1.52653 WP_001121399.1.52656 WP_001121399.1.52743 WP_001121399.1.52857 WP_001121399.1.53406 WP_001121399.1.53529 WP_001121399.1.53543 WP_001121399.1.53757 WP_001121399.1.53812 WP_001121399.1.54075 WP_001121399.1.54196 WP_001121399.1.54209 WP_001121399.1.54274 WP_001121399.1.54319 WP_001121399.1.54364 WP_001121399.1.54662 WP_001121399.1.54722 WP_001121399.1.54764 WP_001121399.1.55008 WP_001121399.1.55152 WP_001121399.1.5527 WP_001121399.1.55285 WP_001121399.1.55475 WP_001121399.1.55647 WP_001121399.1.55743 WP_001121399.1.55768 WP_001121399.1.56002 WP_001121399.1.56012 WP_001121399.1.56105 WP_001121399.1.56304 WP_001121399.1.56560 WP_001121399.1.56601 WP_001121399.1.56614 WP_001121399.1.56671 WP_001121399.1.56682 WP_001121399.1.56875 WP_001121399.1.57168 WP_001121399.1.57187 WP_001121399.1.57377 WP_001121399.1.57433 WP_001121399.1.57576 WP_001121399.1.57601 WP_001121399.1.57607 WP_001121399.1.57862 WP_001121399.1.57890 WP_001121399.1.57891 WP_001121399.1.57902 WP_001121399.1.58041 WP_001121399.1.58418 WP_001121399.1.58548 WP_001121399.1.5858 WP_001121399.1.58662 WP_001121399.1.58669 WP_001121399.1.58745 WP_001121399.1.58803 WP_001121399.1.59094 WP_001121399.1.59224 WP_001121399.1.59321 WP_001121399.1.59490 WP_001121399.1.59508 WP_001121399.1.59684 WP_001121399.1.59694 WP_001121399.1.60008 WP_001121399.1.60021 WP_001121399.1.60069 WP_001121399.1.60464 WP_001121399.1.60486 WP_001121399.1.61345 WP_001121399.1.61417 WP_001121399.1.61574 WP_001121399.1.61712 WP_001121399.1.61730 WP_001121399.1.61918 WP_001121399.1.61952 WP_001121399.1.62007 WP_001121399.1.62204 WP_001121399.1.62304 WP_001121399.1.62364 WP_001121399.1.62374 WP_001121399.1.62403 WP_001121399.1.62404 WP_001121399.1.6253 WP_001121399.1.62853 WP_001121399.1.62903 WP_001121399.1.62955 WP_001121399.1.63181 WP_001121399.1.63203 WP_001121399.1.63382 WP_001121399.1.63432 WP_001121399.1.63718 WP_001121399.1.63757 WP_001121399.1.63834 WP_001121399.1.64046 WP_001121399.1.6423 WP_001121399.1.64244 WP_001121399.1.64403 WP_001121399.1.64649 WP_001121399.1.64702 WP_001121399.1.64757 WP_001121399.1.64781 WP_001121399.1.64831 WP_001121399.1.65028 WP_001121399.1.65171 WP_001121399.1.65248 WP_001121399.1.6535 WP_001121399.1.65474 WP_001121399.1.65633 WP_001121399.1.65696 WP_001121399.1.6630 WP_001121399.1.66314 WP_001121399.1.66358 WP_001121399.1.66362 WP_001121399.1.6638 WP_001121399.1.66698 WP_001121399.1.66834 WP_001121399.1.67181 WP_001121399.1.67347 WP_001121399.1.67465 WP_001121399.1.67552 WP_001121399.1.67829 WP_001121399.1.68206 WP_001121399.1.6827 WP_001121399.1.6849 WP_001121399.1.68547 WP_001121399.1.68589 WP_001121399.1.68655 WP_001121399.1.68778 WP_001121399.1.68787 WP_001121399.1.68928 WP_001121399.1.68975 WP_001121399.1.69006 WP_001121399.1.6913 WP_001121399.1.69146 WP_001121399.1.69255 WP_001121399.1.69644 WP_001121399.1.69704 WP_001121399.1.7021 WP_001121399.1.70241 WP_001121399.1.70269 WP_001121399.1.70643 WP_001121399.1.70683 WP_001121399.1.70922 WP_001121399.1.70948 WP_001121399.1.71116 WP_001121399.1.71146 WP_001121399.1.71188 WP_001121399.1.71306 WP_001121399.1.71337 WP_001121399.1.71378 WP_001121399.1.71401 WP_001121399.1.71418 WP_001121399.1.71702 WP_001121399.1.71750 WP_001121399.1.71908 WP_001121399.1.71952 WP_001121399.1.71973 WP_001121399.1.72376 WP_001121399.1.72594 WP_001121399.1.72975 WP_001121399.1.7315 WP_001121399.1.7356 WP_001121399.1.73617 WP_001121399.1.73758 WP_001121399.1.74191 WP_001121399.1.74410 WP_001121399.1.74529 WP_001121399.1.74545 WP_001121399.1.75129 WP_001121399.1.75187 WP_001121399.1.75334 WP_001121399.1.75362 WP_001121399.1.75385 WP_001121399.1.75760 WP_001121399.1.75764 WP_001121399.1.75837 WP_001121399.1.76020 WP_001121399.1.76445 WP_001121399.1.7660 WP_001121399.1.76673 WP_001121399.1.76721 WP_001121399.1.76760 WP_001121399.1.76875 WP_001121399.1.76899 WP_001121399.1.77038 WP_001121399.1.77047 WP_001121399.1.77180 WP_001121399.1.77244 WP_001121399.1.77292 WP_001121399.1.77514 WP_001121399.1.77529 WP_001121399.1.77549 WP_001121399.1.77898 WP_001121399.1.77960 WP_001121399.1.77987 WP_001121399.1.78076 WP_001121399.1.78096 WP_001121399.1.78100 WP_001121399.1.78383 WP_001121399.1.78735 WP_001121399.1.78802 WP_001121399.1.78830 WP_001121399.1.78871 WP_001121399.1.78874 WP_001121399.1.78918 WP_001121399.1.78930 WP_001121399.1.79335 WP_001121399.1.79462 WP_001121399.1.79472 WP_001121399.1.79490 WP_001121399.1.79495 WP_001121399.1.79529 WP_001121399.1.79570 WP_001121399.1.7964 WP_001121399.1.79659 WP_001121399.1.79668 WP_001121399.1.79708 WP_001121399.1.80077 WP_001121399.1.80137 WP_001121399.1.80296 WP_001121399.1.80366 WP_001121399.1.80780 WP_001121399.1.80831 WP_001121399.1.80881 WP_001121399.1.8096 WP_001121399.1.81069 WP_001121399.1.81149 WP_001121399.1.81175 WP_001121399.1.8119 WP_001121399.1.81193 WP_001121399.1.81354 WP_001121399.1.81425 WP_001121399.1.81750 WP_001121399.1.81902 WP_001121399.1.82337 WP_001121399.1.82395 WP_001121399.1.82503 WP_001121399.1.82515 WP_001121399.1.82676 WP_001121399.1.83092 WP_001121399.1.83413 WP_001121399.1.83491 WP_001121399.1.8354 WP_001121399.1.83760 WP_001121399.1.83995 WP_001121399.1.84103 WP_001121399.1.8441 WP_001121399.1.84532 WP_001121399.1.84554 WP_001121399.1.84659 WP_001121399.1.84899 WP_001121399.1.8497 WP_001121399.1.85040 WP_001121399.1.85180 WP_001121399.1.85483 WP_001121399.1.85541 WP_001121399.1.85617 WP_001121399.1.85663 WP_001121399.1.85671 WP_001121399.1.85672 WP_001121399.1.85777 WP_001121399.1.85886 WP_001121399.1.85900 WP_001121399.1.85904 WP_001121399.1.85976 WP_001121399.1.86306 WP_001121399.1.86356 WP_001121399.1.86450 WP_001121399.1.86469 WP_001121399.1.86588 WP_001121399.1.86661 WP_001121399.1.8672 WP_001121399.1.87095 WP_001121399.1.8736 WP_001121399.1.87460 WP_001121399.1.87552 WP_001121399.1.87945 WP_001121399.1.88019 WP_001121399.1.88073 WP_001121399.1.8809 WP_001121399.1.88291 WP_001121399.1.88293 WP_001121399.1.88703 WP_001121399.1.88902 WP_001121399.1.8891 WP_001121399.1.88981 WP_001121399.1.89008 WP_001121399.1.89116 WP_001121399.1.89138 WP_001121399.1.89304 WP_001121399.1.89570 WP_001121399.1.89622 WP_001121399.1.89659 WP_001121399.1.8996 WP_001121399.1.90252 WP_001121399.1.90453 WP_001121399.1.90585 WP_001121399.1.90641 WP_001121399.1.90983 WP_001121399.1.91003 WP_001121399.1.91069 WP_001121399.1.91278 WP_001121399.1.91512 WP_001121399.1.91564 WP_001121399.1.91655 WP_001121399.1.91724 WP_001121399.1.91788 WP_001121399.1.92013 WP_001121399.1.92093 WP_001121399.1.92310 WP_001121399.1.92443 WP_001121399.1.92531 WP_001121399.1.92669 WP_001121399.1.92671 WP_001121399.1.93101 WP_001121399.1.93136 WP_001121399.1.93365 WP_001121399.1.93543 WP_001121399.1.93656 WP_001121399.1.93662 WP_001121399.1.937 WP_001121399.1.93804 WP_001121399.1.9389 WP_001121399.1.93994 WP_001121399.1.94168 WP_001121399.1.94198 WP_001121399.1.94354 WP_001121399.1.94380 WP_001121399.1.94458 WP_001121399.1.94584 WP_001121399.1.94674 WP_001121399.1.94798 WP_001121399.1.95051 WP_001121399.1.95085 WP_001121399.1.95282 WP_001121399.1.95546 WP_001121399.1.95630 WP_001121399.1.95911 WP_001121399.1.96139 WP_001121399.1.96203 WP_001121399.1.96317 WP_001121399.1.9644 WP_001121399.1.96469 WP_001121399.1.96500 WP_001121399.1.96555 WP_001121399.1.96563 WP_001121399.1.96771 WP_001121399.1.97145 WP_001121399.1.97185 WP_001121399.1.97620 WP_001121399.1.97736 WP_001121399.1.9775 WP_001121399.1.97846 WP_001121399.1.98019 WP_001121399.1.98022 WP_001121399.1.98219 WP_001121399.1.9841 WP_001121399.1.98531 WP_001121399.1.98577 WP_001121399.1.98677 WP_001121399.1.98843 WP_001121399.1.9898 WP_001121399.1.99184 WP_001121399.1.99267 WP_001121399.1.99276 WP_001121399.1.99426 WP_001121399.1.99646 WP_001121399.1.99657 WP_001121399.1.99660 WP_001121399.1.99712 WP_001121399.1.99858 WP_001121399.1.99889 WP_001121399.1.99958 gi|60115463|ref|YP_209255.1| gi|378448079|ref|YP_005235571.1| gi|550903970|ref|YP_008673060.1| gi|379699170|ref|YP_005245640.1| gi|12084980|ref|NP_073225.1|NC_002638 gi|17233422|ref|NP_490532.1|NC_003277 gi|224504297|ref|YP_002635637.1|NC_012124 gi|261888708|ref|YP_003264395.1|NC_013437 gi|305696877|ref|YP_003864192.1|NC_014476 gi|378448079|ref|YP_005235571.1|NC_016855 gi|378987311|ref|YP_005250466.1|NC_016861 gi|378991878|ref|YP_005255041.1|NC_016864 gi|379699170|ref|YP_005245640.1|NC_016858 gi|383499189|ref|YP_005412537.1|NC_017054 gi|410652142|ref|YP_006955262.1|NC_019108 gi|410652284|ref|YP_006955402.1|NC_019109 gi|410652613|ref|YP_006955894.1|NC_019112 gi|410654618|ref|YP_006955580.1|NC_019001 gi|447044143|ref|WP_001121399.1|NZ_CM001154 gi|550903970|ref|YP_008673060.1|NC_022570 gi|60115463|ref|YP_209255.1|NC_006855 321314.SCV01 476213.SPC_p065 99287.PSLT042 gi|378991878|ref|YP_005255041.1| gi|378987311|ref|YP_005250466.1| gi|17233422|ref|NP_490532.1| APC25607 gi|224504297|ref|YP_002635637.1| gi|383499189|ref|YP_005412537.1| ABAO01000058|CDS_13075-14112 AE006471|CDS_32929-33966 AY509003|CDS_552-49073 CP000858|CDS_54807-53770 CP001362|CDS_32921-33958

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]