SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378448081|ref|YP_005235573.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378448081|ref|YP_005235573.1|
Domain Number 1 Region: 155-337
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.0000000000000379
Family Retroviral integrase, catalytic domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|378448081|ref|YP_005235573.1|
Sequence length 554
Comment putative integrase protein [Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S]
Sequence
MSSRRSAIPSDSLLQLRQRLDRLPPKSPERANQIAATAQLYGISVTTVYRALHLVLKPRT
AHRSDHGQPRILPPSELEHYCELIAALKLRTTNKSGRHLSTGRAIQLLEEHGVETVQGLI
KSPKGLLRKQTVNRWLSRWRLDQPRLLREPPAVRFQAENSNDCWQFDMSPSDLKHIERPD
WVDPARGEPTLMLFSVVDDRSGVAYQEYRCVYGEDAESALRFLFNAMAPKTRSDFPFQGR
PKLLYLDNGPVAKNHVFQNVMQSLKVDWLTHTPAGKDGTRTTARSKGKVERPFRTVKEAH
ETLYHFHKPETELQANEWLWNYLSRYNAQRHRSEKHSRLEDWLANIGQEGVRDMCSWEQY
CRFAREPESRKVGVDARITIDGTAWEVEPDMAGETVILLWGLFDEEMYVEFTGETWGPYY
PVSGPVPLHRYRTFRRGKAAERADRIHALARQLNIPISALSGSDLRVVSDDTQQRIDALP
HQPFDTRKFEYHFPTVIAAKLAIADDLAIPLARMSDEDRAFIDSILTETLNRSEVLARIR
DYFRSRQSGEDHAG
Download sequence
Identical sequences A0A0B7J6M7 A0A0F6AW56 A0A0H3NWN1 A0A0U0XDB9 A0A0U1GXM9 A0A0W4U471 A0A1D8X779 A0A1S5SII0 A0A1S6L590 A0A2H9YDE3 B1MUD0 E8XLJ2 H9ACI7 M7R9T5 Q5J482 Q93GR0
gi|378987313|ref|YP_005250468.1| gi|386730719|ref|YP_006203695.1| gi|379699168|ref|YP_005245638.1| gi|198241725|ref|YP_002213860.1| gi|17233495|ref|NP_490534.1| gi|60115512|ref|YP_209304.1| AE006471|CDS_36777-35113 AY509003|CDS_46262-47926 CP001143|CDS_6799-8463 CP001362|CDS_36769-35105 APC24256 NP_490534.1.58477 WP_000098783.1.100010 WP_000098783.1.100017 WP_000098783.1.100234 WP_000098783.1.100376 WP_000098783.1.100424 WP_000098783.1.100488 WP_000098783.1.100597 WP_000098783.1.100793 WP_000098783.1.100871 WP_000098783.1.101007 WP_000098783.1.101074 WP_000098783.1.101180 WP_000098783.1.101259 WP_000098783.1.101284 WP_000098783.1.101353 WP_000098783.1.101404 WP_000098783.1.101420 WP_000098783.1.101589 WP_000098783.1.101707 WP_000098783.1.101878 WP_000098783.1.101953 WP_000098783.1.10220 WP_000098783.1.10266 WP_000098783.1.10439 WP_000098783.1.10992 WP_000098783.1.11031 WP_000098783.1.11098 WP_000098783.1.11458 WP_000098783.1.11518 WP_000098783.1.11532 WP_000098783.1.11543 WP_000098783.1.11763 WP_000098783.1.11772 WP_000098783.1.12114 WP_000098783.1.12351 WP_000098783.1.12370 WP_000098783.1.1239 WP_000098783.1.12546 WP_000098783.1.12879 WP_000098783.1.12936 WP_000098783.1.12995 WP_000098783.1.13027 WP_000098783.1.13106 WP_000098783.1.13509 WP_000098783.1.1387 WP_000098783.1.13908 WP_000098783.1.13932 WP_000098783.1.13968 WP_000098783.1.14001 WP_000098783.1.14151 WP_000098783.1.14320 WP_000098783.1.14410 WP_000098783.1.14524 WP_000098783.1.14725 WP_000098783.1.14852 WP_000098783.1.1489 WP_000098783.1.14932 WP_000098783.1.15055 WP_000098783.1.15214 WP_000098783.1.15223 WP_000098783.1.15316 WP_000098783.1.15369 WP_000098783.1.1540 WP_000098783.1.15468 WP_000098783.1.15508 WP_000098783.1.16103 WP_000098783.1.16233 WP_000098783.1.16284 WP_000098783.1.1635 WP_000098783.1.16468 WP_000098783.1.16650 WP_000098783.1.16686 WP_000098783.1.16735 WP_000098783.1.16858 WP_000098783.1.16896 WP_000098783.1.16965 WP_000098783.1.17307 WP_000098783.1.174 WP_000098783.1.17702 WP_000098783.1.17705 WP_000098783.1.17758 WP_000098783.1.18019 WP_000098783.1.18163 WP_000098783.1.18607 WP_000098783.1.18705 WP_000098783.1.18715 WP_000098783.1.18776 WP_000098783.1.18949 WP_000098783.1.19320 WP_000098783.1.19458 WP_000098783.1.19461 WP_000098783.1.19702 WP_000098783.1.19706 WP_000098783.1.19724 WP_000098783.1.19784 WP_000098783.1.19802 WP_000098783.1.2010 WP_000098783.1.20119 WP_000098783.1.20266 WP_000098783.1.20271 WP_000098783.1.20443 WP_000098783.1.2054 WP_000098783.1.20553 WP_000098783.1.20626 WP_000098783.1.20646 WP_000098783.1.20767 WP_000098783.1.20886 WP_000098783.1.21269 WP_000098783.1.21400 WP_000098783.1.21497 WP_000098783.1.21499 WP_000098783.1.21603 WP_000098783.1.21616 WP_000098783.1.22024 WP_000098783.1.22062 WP_000098783.1.22067 WP_000098783.1.2221 WP_000098783.1.22270 WP_000098783.1.22379 WP_000098783.1.22485 WP_000098783.1.23114 WP_000098783.1.2314 WP_000098783.1.23192 WP_000098783.1.23460 WP_000098783.1.23634 WP_000098783.1.2364 WP_000098783.1.23932 WP_000098783.1.24308 WP_000098783.1.24578 WP_000098783.1.24779 WP_000098783.1.24803 WP_000098783.1.25008 WP_000098783.1.25036 WP_000098783.1.25405 WP_000098783.1.2568 WP_000098783.1.25690 WP_000098783.1.2570 WP_000098783.1.25709 WP_000098783.1.25740 WP_000098783.1.25793 WP_000098783.1.25814 WP_000098783.1.25988 WP_000098783.1.26311 WP_000098783.1.26319 WP_000098783.1.26429 WP_000098783.1.26493 WP_000098783.1.26532 WP_000098783.1.26551 WP_000098783.1.26567 WP_000098783.1.26587 WP_000098783.1.27173 WP_000098783.1.27206 WP_000098783.1.27561 WP_000098783.1.2763 WP_000098783.1.27761 WP_000098783.1.2777 WP_000098783.1.27977 WP_000098783.1.28094 WP_000098783.1.28170 WP_000098783.1.2835 WP_000098783.1.28575 WP_000098783.1.28625 WP_000098783.1.28694 WP_000098783.1.2879 WP_000098783.1.2890 WP_000098783.1.28946 WP_000098783.1.29010 WP_000098783.1.2910 WP_000098783.1.29274 WP_000098783.1.29606 WP_000098783.1.29615 WP_000098783.1.30027 WP_000098783.1.30180 WP_000098783.1.30505 WP_000098783.1.30507 WP_000098783.1.3067 WP_000098783.1.30794 WP_000098783.1.30833 WP_000098783.1.30835 WP_000098783.1.30972 WP_000098783.1.31 WP_000098783.1.3113 WP_000098783.1.3119 WP_000098783.1.31190 WP_000098783.1.31195 WP_000098783.1.31196 WP_000098783.1.31362 WP_000098783.1.31504 WP_000098783.1.31515 WP_000098783.1.31578 WP_000098783.1.31658 WP_000098783.1.31720 WP_000098783.1.31940 WP_000098783.1.31967 WP_000098783.1.31972 WP_000098783.1.32116 WP_000098783.1.32192 WP_000098783.1.32206 WP_000098783.1.32493 WP_000098783.1.32702 WP_000098783.1.33030 WP_000098783.1.33127 WP_000098783.1.33143 WP_000098783.1.33248 WP_000098783.1.33261 WP_000098783.1.333 WP_000098783.1.33492 WP_000098783.1.33553 WP_000098783.1.33592 WP_000098783.1.33865 WP_000098783.1.34075 WP_000098783.1.34257 WP_000098783.1.34279 WP_000098783.1.34319 WP_000098783.1.34684 WP_000098783.1.34975 WP_000098783.1.35045 WP_000098783.1.35129 WP_000098783.1.35332 WP_000098783.1.35404 WP_000098783.1.35408 WP_000098783.1.35425 WP_000098783.1.35446 WP_000098783.1.35503 WP_000098783.1.35509 WP_000098783.1.35590 WP_000098783.1.35619 WP_000098783.1.3572 WP_000098783.1.35940 WP_000098783.1.36003 WP_000098783.1.3601 WP_000098783.1.36705 WP_000098783.1.36931 WP_000098783.1.36948 WP_000098783.1.37073 WP_000098783.1.37111 WP_000098783.1.37112 WP_000098783.1.3726 WP_000098783.1.37293 WP_000098783.1.3744 WP_000098783.1.37498 WP_000098783.1.37618 WP_000098783.1.37968 WP_000098783.1.37978 WP_000098783.1.3848 WP_000098783.1.38673 WP_000098783.1.38693 WP_000098783.1.38913 WP_000098783.1.39136 WP_000098783.1.39197 WP_000098783.1.39229 WP_000098783.1.39385 WP_000098783.1.39405 WP_000098783.1.39414 WP_000098783.1.39420 WP_000098783.1.39512 WP_000098783.1.39614 WP_000098783.1.39629 WP_000098783.1.39763 WP_000098783.1.39923 WP_000098783.1.40017 WP_000098783.1.40072 WP_000098783.1.40073 WP_000098783.1.4011 WP_000098783.1.40158 WP_000098783.1.40208 WP_000098783.1.40240 WP_000098783.1.40257 WP_000098783.1.40284 WP_000098783.1.40292 WP_000098783.1.40395 WP_000098783.1.40465 WP_000098783.1.40710 WP_000098783.1.40877 WP_000098783.1.41086 WP_000098783.1.41091 WP_000098783.1.41279 WP_000098783.1.4141 WP_000098783.1.41434 WP_000098783.1.41554 WP_000098783.1.41591 WP_000098783.1.41688 WP_000098783.1.41761 WP_000098783.1.41882 WP_000098783.1.41979 WP_000098783.1.42422 WP_000098783.1.42864 WP_000098783.1.43018 WP_000098783.1.43041 WP_000098783.1.43244 WP_000098783.1.43312 WP_000098783.1.43437 WP_000098783.1.43613 WP_000098783.1.43668 WP_000098783.1.43886 WP_000098783.1.44005 WP_000098783.1.44043 WP_000098783.1.44099 WP_000098783.1.44121 WP_000098783.1.44187 WP_000098783.1.44310 WP_000098783.1.44397 WP_000098783.1.44640 WP_000098783.1.4467 WP_000098783.1.4485 WP_000098783.1.44877 WP_000098783.1.44943 WP_000098783.1.45067 WP_000098783.1.45079 WP_000098783.1.45177 WP_000098783.1.45184 WP_000098783.1.45259 WP_000098783.1.45349 WP_000098783.1.45365 WP_000098783.1.45550 WP_000098783.1.45585 WP_000098783.1.45660 WP_000098783.1.45690 WP_000098783.1.4592 WP_000098783.1.46069 WP_000098783.1.46112 WP_000098783.1.46174 WP_000098783.1.46187 WP_000098783.1.46303 WP_000098783.1.46595 WP_000098783.1.47057 WP_000098783.1.47067 WP_000098783.1.47214 WP_000098783.1.47429 WP_000098783.1.4747 WP_000098783.1.47472 WP_000098783.1.47478 WP_000098783.1.47799 WP_000098783.1.48268 WP_000098783.1.48367 WP_000098783.1.48377 WP_000098783.1.48524 WP_000098783.1.4853 WP_000098783.1.48876 WP_000098783.1.48894 WP_000098783.1.48919 WP_000098783.1.49155 WP_000098783.1.49239 WP_000098783.1.49256 WP_000098783.1.49290 WP_000098783.1.49366 WP_000098783.1.49490 WP_000098783.1.49515 WP_000098783.1.49572 WP_000098783.1.4979 WP_000098783.1.49803 WP_000098783.1.49929 WP_000098783.1.50080 WP_000098783.1.50161 WP_000098783.1.50374 WP_000098783.1.50376 WP_000098783.1.50389 WP_000098783.1.50777 WP_000098783.1.50804 WP_000098783.1.50808 WP_000098783.1.5088 WP_000098783.1.50905 WP_000098783.1.50941 WP_000098783.1.51014 WP_000098783.1.51182 WP_000098783.1.51186 WP_000098783.1.51487 WP_000098783.1.51518 WP_000098783.1.51634 WP_000098783.1.51649 WP_000098783.1.51686 WP_000098783.1.51700 WP_000098783.1.51756 WP_000098783.1.51911 WP_000098783.1.51932 WP_000098783.1.51989 WP_000098783.1.52121 WP_000098783.1.52353 WP_000098783.1.52653 WP_000098783.1.52656 WP_000098783.1.52743 WP_000098783.1.52857 WP_000098783.1.53406 WP_000098783.1.53529 WP_000098783.1.53543 WP_000098783.1.53757 WP_000098783.1.53812 WP_000098783.1.54075 WP_000098783.1.54196 WP_000098783.1.54209 WP_000098783.1.54274 WP_000098783.1.54319 WP_000098783.1.54364 WP_000098783.1.54469 WP_000098783.1.54662 WP_000098783.1.54722 WP_000098783.1.54764 WP_000098783.1.55008 WP_000098783.1.55152 WP_000098783.1.5527 WP_000098783.1.55285 WP_000098783.1.55475 WP_000098783.1.5555 WP_000098783.1.55647 WP_000098783.1.55743 WP_000098783.1.55768 WP_000098783.1.55853 WP_000098783.1.56002 WP_000098783.1.56012 WP_000098783.1.56105 WP_000098783.1.56304 WP_000098783.1.56560 WP_000098783.1.56601 WP_000098783.1.56614 WP_000098783.1.56671 WP_000098783.1.56682 WP_000098783.1.56875 WP_000098783.1.56877 WP_000098783.1.56950 WP_000098783.1.57168 WP_000098783.1.57187 WP_000098783.1.57377 WP_000098783.1.57433 WP_000098783.1.57576 WP_000098783.1.57601 WP_000098783.1.57607 WP_000098783.1.57862 WP_000098783.1.57890 WP_000098783.1.57891 WP_000098783.1.57902 WP_000098783.1.58041 WP_000098783.1.58418 WP_000098783.1.58442 WP_000098783.1.58548 WP_000098783.1.5858 WP_000098783.1.58662 WP_000098783.1.58669 WP_000098783.1.587 WP_000098783.1.58745 WP_000098783.1.58749 WP_000098783.1.58803 WP_000098783.1.59094 WP_000098783.1.59224 WP_000098783.1.59321 WP_000098783.1.59335 WP_000098783.1.59490 WP_000098783.1.59508 WP_000098783.1.59684 WP_000098783.1.59694 WP_000098783.1.60008 WP_000098783.1.60021 WP_000098783.1.60379 WP_000098783.1.60464 WP_000098783.1.60486 WP_000098783.1.60794 WP_000098783.1.6129 WP_000098783.1.61345 WP_000098783.1.61417 WP_000098783.1.61712 WP_000098783.1.61730 WP_000098783.1.61918 WP_000098783.1.61952 WP_000098783.1.62007 WP_000098783.1.62204 WP_000098783.1.62245 WP_000098783.1.62304 WP_000098783.1.62364 WP_000098783.1.62374 WP_000098783.1.62403 WP_000098783.1.62404 WP_000098783.1.6253 WP_000098783.1.62853 WP_000098783.1.62955 WP_000098783.1.63203 WP_000098783.1.63358 WP_000098783.1.63382 WP_000098783.1.63432 WP_000098783.1.63718 WP_000098783.1.63834 WP_000098783.1.64046 WP_000098783.1.64121 WP_000098783.1.6423 WP_000098783.1.64244 WP_000098783.1.64403 WP_000098783.1.64649 WP_000098783.1.64702 WP_000098783.1.64757 WP_000098783.1.64781 WP_000098783.1.64831 WP_000098783.1.65028 WP_000098783.1.65171 WP_000098783.1.65248 WP_000098783.1.6535 WP_000098783.1.65474 WP_000098783.1.65633 WP_000098783.1.65696 WP_000098783.1.66122 WP_000098783.1.66289 WP_000098783.1.6630 WP_000098783.1.66314 WP_000098783.1.66362 WP_000098783.1.6638 WP_000098783.1.66698 WP_000098783.1.66834 WP_000098783.1.66937 WP_000098783.1.67181 WP_000098783.1.67347 WP_000098783.1.67465 WP_000098783.1.67552 WP_000098783.1.67829 WP_000098783.1.68201 WP_000098783.1.68206 WP_000098783.1.6827 WP_000098783.1.6849 WP_000098783.1.68547 WP_000098783.1.68589 WP_000098783.1.68591 WP_000098783.1.68655 WP_000098783.1.68778 WP_000098783.1.68787 WP_000098783.1.68928 WP_000098783.1.68975 WP_000098783.1.69006 WP_000098783.1.6913 WP_000098783.1.69146 WP_000098783.1.69255 WP_000098783.1.69644 WP_000098783.1.69704 WP_000098783.1.7021 WP_000098783.1.70241 WP_000098783.1.70269 WP_000098783.1.70303 WP_000098783.1.70643 WP_000098783.1.70683 WP_000098783.1.70922 WP_000098783.1.70929 WP_000098783.1.70948 WP_000098783.1.70977 WP_000098783.1.71116 WP_000098783.1.71146 WP_000098783.1.71188 WP_000098783.1.71306 WP_000098783.1.71337 WP_000098783.1.71368 WP_000098783.1.71378 WP_000098783.1.71401 WP_000098783.1.71418 WP_000098783.1.71600 WP_000098783.1.71702 WP_000098783.1.71750 WP_000098783.1.71908 WP_000098783.1.71952 WP_000098783.1.71973 WP_000098783.1.72376 WP_000098783.1.72470 WP_000098783.1.72594 WP_000098783.1.72625 WP_000098783.1.72975 WP_000098783.1.7315 WP_000098783.1.7334 WP_000098783.1.73377 WP_000098783.1.7356 WP_000098783.1.73617 WP_000098783.1.73669 WP_000098783.1.73758 WP_000098783.1.73764 WP_000098783.1.73956 WP_000098783.1.74191 WP_000098783.1.74379 WP_000098783.1.74410 WP_000098783.1.74529 WP_000098783.1.74545 WP_000098783.1.75129 WP_000098783.1.75187 WP_000098783.1.75334 WP_000098783.1.75362 WP_000098783.1.75385 WP_000098783.1.75760 WP_000098783.1.75764 WP_000098783.1.75837 WP_000098783.1.75884 WP_000098783.1.76020 WP_000098783.1.76024 WP_000098783.1.76445 WP_000098783.1.7660 WP_000098783.1.76673 WP_000098783.1.76721 WP_000098783.1.76760 WP_000098783.1.76875 WP_000098783.1.76899 WP_000098783.1.77047 WP_000098783.1.77067 WP_000098783.1.77180 WP_000098783.1.77244 WP_000098783.1.77292 WP_000098783.1.77349 WP_000098783.1.77514 WP_000098783.1.77549 WP_000098783.1.77960 WP_000098783.1.77987 WP_000098783.1.78033 WP_000098783.1.78076 WP_000098783.1.78096 WP_000098783.1.78100 WP_000098783.1.78383 WP_000098783.1.78443 WP_000098783.1.78735 WP_000098783.1.78802 WP_000098783.1.78830 WP_000098783.1.78835 WP_000098783.1.78871 WP_000098783.1.78874 WP_000098783.1.78918 WP_000098783.1.78930 WP_000098783.1.79335 WP_000098783.1.79462 WP_000098783.1.79472 WP_000098783.1.79490 WP_000098783.1.79495 WP_000098783.1.79529 WP_000098783.1.7964 WP_000098783.1.79642 WP_000098783.1.79659 WP_000098783.1.79668 WP_000098783.1.79708 WP_000098783.1.79757 WP_000098783.1.80077 WP_000098783.1.80137 WP_000098783.1.80296 WP_000098783.1.80366 WP_000098783.1.80780 WP_000098783.1.80831 WP_000098783.1.80881 WP_000098783.1.8096 WP_000098783.1.81069 WP_000098783.1.81149 WP_000098783.1.81175 WP_000098783.1.8119 WP_000098783.1.81354 WP_000098783.1.81425 WP_000098783.1.81455 WP_000098783.1.81750 WP_000098783.1.81902 WP_000098783.1.82337 WP_000098783.1.82395 WP_000098783.1.82503 WP_000098783.1.82515 WP_000098783.1.82676 WP_000098783.1.82761 WP_000098783.1.83092 WP_000098783.1.83491 WP_000098783.1.8354 WP_000098783.1.83760 WP_000098783.1.83995 WP_000098783.1.84103 WP_000098783.1.8425 WP_000098783.1.8441 WP_000098783.1.84532 WP_000098783.1.84659 WP_000098783.1.84899 WP_000098783.1.8497 WP_000098783.1.85040 WP_000098783.1.8545 WP_000098783.1.85483 WP_000098783.1.85541 WP_000098783.1.8556 WP_000098783.1.85617 WP_000098783.1.85663 WP_000098783.1.85671 WP_000098783.1.85672 WP_000098783.1.85886 WP_000098783.1.85900 WP_000098783.1.85904 WP_000098783.1.85976 WP_000098783.1.86159 WP_000098783.1.86240 WP_000098783.1.86306 WP_000098783.1.86356 WP_000098783.1.86450 WP_000098783.1.86469 WP_000098783.1.86588 WP_000098783.1.86661 WP_000098783.1.8672 WP_000098783.1.87095 WP_000098783.1.8736 WP_000098783.1.87460 WP_000098783.1.87552 WP_000098783.1.87760 WP_000098783.1.87936 WP_000098783.1.87945 WP_000098783.1.88019 WP_000098783.1.88073 WP_000098783.1.8809 WP_000098783.1.88291 WP_000098783.1.88293 WP_000098783.1.88703 WP_000098783.1.88902 WP_000098783.1.8891 WP_000098783.1.88982 WP_000098783.1.89008 WP_000098783.1.89116 WP_000098783.1.89138 WP_000098783.1.89304 WP_000098783.1.89570 WP_000098783.1.89622 WP_000098783.1.89659 WP_000098783.1.8996 WP_000098783.1.90252 WP_000098783.1.90453 WP_000098783.1.90641 WP_000098783.1.91003 WP_000098783.1.91069 WP_000098783.1.91512 WP_000098783.1.91564 WP_000098783.1.91724 WP_000098783.1.91732 WP_000098783.1.91788 WP_000098783.1.92013 WP_000098783.1.92093 WP_000098783.1.92183 WP_000098783.1.92310 WP_000098783.1.92443 WP_000098783.1.92531 WP_000098783.1.92669 WP_000098783.1.92671 WP_000098783.1.92738 WP_000098783.1.92754 WP_000098783.1.93101 WP_000098783.1.93136 WP_000098783.1.93365 WP_000098783.1.93410 WP_000098783.1.93543 WP_000098783.1.93656 WP_000098783.1.93662 WP_000098783.1.93804 WP_000098783.1.9389 WP_000098783.1.93994 WP_000098783.1.94168 WP_000098783.1.94198 WP_000098783.1.94354 WP_000098783.1.94380 WP_000098783.1.94458 WP_000098783.1.94584 WP_000098783.1.94674 WP_000098783.1.94798 WP_000098783.1.94983 WP_000098783.1.95051 WP_000098783.1.95085 WP_000098783.1.95282 WP_000098783.1.95546 WP_000098783.1.95558 WP_000098783.1.95630 WP_000098783.1.95911 WP_000098783.1.96139 WP_000098783.1.96203 WP_000098783.1.96317 WP_000098783.1.9644 WP_000098783.1.96469 WP_000098783.1.96490 WP_000098783.1.96500 WP_000098783.1.96555 WP_000098783.1.96563 WP_000098783.1.96584 WP_000098783.1.96771 WP_000098783.1.96902 WP_000098783.1.97145 WP_000098783.1.97185 WP_000098783.1.97620 WP_000098783.1.97736 WP_000098783.1.9775 WP_000098783.1.97846 WP_000098783.1.98019 WP_000098783.1.98022 WP_000098783.1.98219 WP_000098783.1.9841 WP_000098783.1.98446 WP_000098783.1.98531 WP_000098783.1.98577 WP_000098783.1.98677 WP_000098783.1.9899 WP_000098783.1.99184 WP_000098783.1.99276 WP_000098783.1.99426 WP_000098783.1.99577 WP_000098783.1.99646 WP_000098783.1.99657 WP_000098783.1.99660 WP_000098783.1.99712 WP_000098783.1.99858 WP_000098783.1.99889 WP_000098783.1.99958 gi|378991880|ref|YP_005255043.1| gi|378448081|ref|YP_005235573.1| gi|550903972|ref|YP_008673062.1| gi|169647025|ref|YP_001716195.1|NC_010422 gi|17233495|ref|NP_490534.1|NC_003277 gi|198241725|ref|YP_002213860.1|NC_011204 gi|378448081|ref|YP_005235573.1|NC_016855 gi|378987313|ref|YP_005250468.1|NC_016861 gi|378991880|ref|YP_005255043.1|NC_016864 gi|379699168|ref|YP_005245638.1|NC_016858 gi|386730719|ref|YP_006203695.1|NC_017720 gi|410651790|ref|YP_006954910.1|NC_019106 gi|410652611|ref|YP_006955892.1|NC_019112 gi|446020928|ref|WP_000098783.1|NZ_CM001063 gi|446020928|ref|WP_000098783.1|NZ_CM001152 gi|550903972|ref|YP_008673062.1|NC_022570 gi|60115512|ref|YP_209304.1|NC_006855 321314.SCV50 439851.SeD_B0013 99287.PSLT044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]