SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378448086|ref|YP_005235578.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378448086|ref|YP_005235578.1|
Domain Number 1 Region: 65-121
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.00000106
Family DnaQ-like 3'-5' exonuclease 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|378448086|ref|YP_005235578.1|
Sequence length 138
Comment putative DNA polymerase III epsilon subunit (3'-5' exonuclease) [Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S]
Sequence
MKPAPGAEPVRMYKSPYGGKYGVWRLADCVPMRAKRPQTEKQRLASTRLGLQARMKSERG
RFAMLAHTWLALGPVFLDTETTGLDAGAQALEIGLVNARGERIFETRLKPTVGIDPAAAA
VQIVTEPYRFPVLSVRLA
Download sequence
Identical sequences A0A0F6AW61 A0A0H3NWM3 A0A1I9S337 A0A1S7H7T3 A0A2G1P0P2 A0A2H9YDM3 A0A2J0RR62 A0A2K2KLF2 P37414 Q5J487 Q7DII8
gi|550903977|ref|YP_008673067.1| NP_490539.1.58477 WP_001541564.1.100010 WP_001541564.1.100017 WP_001541564.1.100077 WP_001541564.1.100191 WP_001541564.1.100234 WP_001541564.1.100376 WP_001541564.1.100392 WP_001541564.1.100424 WP_001541564.1.100457 WP_001541564.1.100488 WP_001541564.1.100519 WP_001541564.1.100541 WP_001541564.1.100557 WP_001541564.1.100597 WP_001541564.1.100605 WP_001541564.1.100793 WP_001541564.1.10081 WP_001541564.1.100857 WP_001541564.1.100871 WP_001541564.1.101007 WP_001541564.1.101074 WP_001541564.1.101180 WP_001541564.1.101259 WP_001541564.1.101284 WP_001541564.1.101291 WP_001541564.1.101353 WP_001541564.1.101404 WP_001541564.1.101420 WP_001541564.1.101589 WP_001541564.1.101634 WP_001541564.1.101707 WP_001541564.1.101832 WP_001541564.1.101878 WP_001541564.1.101927 WP_001541564.1.101953 WP_001541564.1.102111 WP_001541564.1.10220 WP_001541564.1.10266 WP_001541564.1.10300 WP_001541564.1.10439 WP_001541564.1.10498 WP_001541564.1.10631 WP_001541564.1.10755 WP_001541564.1.10868 WP_001541564.1.10898 WP_001541564.1.10992 WP_001541564.1.11031 WP_001541564.1.11098 WP_001541564.1.11216 WP_001541564.1.11458 WP_001541564.1.11518 WP_001541564.1.11526 WP_001541564.1.11528 WP_001541564.1.11532 WP_001541564.1.11543 WP_001541564.1.1156 WP_001541564.1.1169 WP_001541564.1.11763 WP_001541564.1.11772 WP_001541564.1.11824 WP_001541564.1.11841 WP_001541564.1.11900 WP_001541564.1.12027 WP_001541564.1.12106 WP_001541564.1.12114 WP_001541564.1.1215 WP_001541564.1.12168 WP_001541564.1.12340 WP_001541564.1.12351 WP_001541564.1.12370 WP_001541564.1.12374 WP_001541564.1.1239 WP_001541564.1.12485 WP_001541564.1.12546 WP_001541564.1.12569 WP_001541564.1.12585 WP_001541564.1.12696 WP_001541564.1.12879 WP_001541564.1.12936 WP_001541564.1.1300 WP_001541564.1.13027 WP_001541564.1.13076 WP_001541564.1.13106 WP_001541564.1.13247 WP_001541564.1.13367 WP_001541564.1.1346 WP_001541564.1.13509 WP_001541564.1.13573 WP_001541564.1.13625 WP_001541564.1.1387 WP_001541564.1.13908 WP_001541564.1.13932 WP_001541564.1.13968 WP_001541564.1.14001 WP_001541564.1.14151 WP_001541564.1.14239 WP_001541564.1.14320 WP_001541564.1.14410 WP_001541564.1.14466 WP_001541564.1.14524 WP_001541564.1.146 WP_001541564.1.14708 WP_001541564.1.14725 WP_001541564.1.14819 WP_001541564.1.14852 WP_001541564.1.1489 WP_001541564.1.14913 WP_001541564.1.14932 WP_001541564.1.15055 WP_001541564.1.15067 WP_001541564.1.15124 WP_001541564.1.15214 WP_001541564.1.15223 WP_001541564.1.15316 WP_001541564.1.15318 WP_001541564.1.15369 WP_001541564.1.1540 WP_001541564.1.15468 WP_001541564.1.15508 WP_001541564.1.1568 WP_001541564.1.15775 WP_001541564.1.15784 WP_001541564.1.16103 WP_001541564.1.16233 WP_001541564.1.16284 WP_001541564.1.1635 WP_001541564.1.16366 WP_001541564.1.16453 WP_001541564.1.16468 WP_001541564.1.16474 WP_001541564.1.16650 WP_001541564.1.16686 WP_001541564.1.16729 WP_001541564.1.16735 WP_001541564.1.16858 WP_001541564.1.16896 WP_001541564.1.16949 WP_001541564.1.16965 WP_001541564.1.16972 WP_001541564.1.17060 WP_001541564.1.17096 WP_001541564.1.17105 WP_001541564.1.17307 WP_001541564.1.1733 WP_001541564.1.174 WP_001541564.1.17583 WP_001541564.1.17702 WP_001541564.1.17705 WP_001541564.1.17732 WP_001541564.1.17758 WP_001541564.1.17886 WP_001541564.1.17914 WP_001541564.1.18019 WP_001541564.1.18056 WP_001541564.1.18092 WP_001541564.1.18109 WP_001541564.1.18163 WP_001541564.1.18265 WP_001541564.1.18384 WP_001541564.1.18607 WP_001541564.1.18705 WP_001541564.1.18715 WP_001541564.1.18776 WP_001541564.1.18847 WP_001541564.1.18886 WP_001541564.1.18949 WP_001541564.1.19093 WP_001541564.1.19320 WP_001541564.1.19373 WP_001541564.1.19433 WP_001541564.1.19458 WP_001541564.1.19461 WP_001541564.1.19614 WP_001541564.1.19656 WP_001541564.1.19702 WP_001541564.1.19706 WP_001541564.1.19724 WP_001541564.1.19749 WP_001541564.1.19784 WP_001541564.1.19802 WP_001541564.1.19834 WP_001541564.1.20 WP_001541564.1.20086 WP_001541564.1.2010 WP_001541564.1.20119 WP_001541564.1.20261 WP_001541564.1.20266 WP_001541564.1.20271 WP_001541564.1.2041 WP_001541564.1.20437 WP_001541564.1.20443 WP_001541564.1.2054 WP_001541564.1.20553 WP_001541564.1.20626 WP_001541564.1.20646 WP_001541564.1.20767 WP_001541564.1.20886 WP_001541564.1.2107 WP_001541564.1.21079 WP_001541564.1.21103 WP_001541564.1.21194 WP_001541564.1.21202 WP_001541564.1.21241 WP_001541564.1.21245 WP_001541564.1.21269 WP_001541564.1.21332 WP_001541564.1.21400 WP_001541564.1.21497 WP_001541564.1.21499 WP_001541564.1.21603 WP_001541564.1.21616 WP_001541564.1.21681 WP_001541564.1.21715 WP_001541564.1.21909 WP_001541564.1.21950 WP_001541564.1.22024 WP_001541564.1.22062 WP_001541564.1.22067 WP_001541564.1.22096 WP_001541564.1.22136 WP_001541564.1.22158 WP_001541564.1.22162 WP_001541564.1.2221 WP_001541564.1.22270 WP_001541564.1.22346 WP_001541564.1.2235 WP_001541564.1.22379 WP_001541564.1.22449 WP_001541564.1.22454 WP_001541564.1.22485 WP_001541564.1.22590 WP_001541564.1.22595 WP_001541564.1.22605 WP_001541564.1.22760 WP_001541564.1.22880 WP_001541564.1.22902 WP_001541564.1.22947 WP_001541564.1.23114 WP_001541564.1.2314 WP_001541564.1.23192 WP_001541564.1.23460 WP_001541564.1.23482 WP_001541564.1.2358 WP_001541564.1.23634 WP_001541564.1.23746 WP_001541564.1.23932 WP_001541564.1.24145 WP_001541564.1.24214 WP_001541564.1.24250 WP_001541564.1.24297 WP_001541564.1.24308 WP_001541564.1.24361 WP_001541564.1.24408 WP_001541564.1.24409 WP_001541564.1.24476 WP_001541564.1.24578 WP_001541564.1.24673 WP_001541564.1.24779 WP_001541564.1.24803 WP_001541564.1.25008 WP_001541564.1.25036 WP_001541564.1.25405 WP_001541564.1.25421 WP_001541564.1.25426 WP_001541564.1.25454 WP_001541564.1.25618 WP_001541564.1.2568 WP_001541564.1.25690 WP_001541564.1.2570 WP_001541564.1.25709 WP_001541564.1.25740 WP_001541564.1.25793 WP_001541564.1.25814 WP_001541564.1.25951 WP_001541564.1.25988 WP_001541564.1.26083 WP_001541564.1.26194 WP_001541564.1.26311 WP_001541564.1.26319 WP_001541564.1.26429 WP_001541564.1.26493 WP_001541564.1.26532 WP_001541564.1.26551 WP_001541564.1.26567 WP_001541564.1.26587 WP_001541564.1.2672 WP_001541564.1.26794 WP_001541564.1.27173 WP_001541564.1.27206 WP_001541564.1.27272 WP_001541564.1.27314 WP_001541564.1.27383 WP_001541564.1.27547 WP_001541564.1.27561 WP_001541564.1.2763 WP_001541564.1.27638 WP_001541564.1.27658 WP_001541564.1.27761 WP_001541564.1.2777 WP_001541564.1.27800 WP_001541564.1.27833 WP_001541564.1.27883 WP_001541564.1.27977 WP_001541564.1.28037 WP_001541564.1.28056 WP_001541564.1.28094 WP_001541564.1.28139 WP_001541564.1.28170 WP_001541564.1.28200 WP_001541564.1.28232 WP_001541564.1.28303 WP_001541564.1.2835 WP_001541564.1.28462 WP_001541564.1.2853 WP_001541564.1.28570 WP_001541564.1.28575 WP_001541564.1.28625 WP_001541564.1.28694 WP_001541564.1.2879 WP_001541564.1.2890 WP_001541564.1.28946 WP_001541564.1.29010 WP_001541564.1.2910 WP_001541564.1.29168 WP_001541564.1.2924 WP_001541564.1.29274 WP_001541564.1.2932 WP_001541564.1.29379 WP_001541564.1.29422 WP_001541564.1.29606 WP_001541564.1.29615 WP_001541564.1.29711 WP_001541564.1.30027 WP_001541564.1.3005 WP_001541564.1.30165 WP_001541564.1.30180 WP_001541564.1.30210 WP_001541564.1.30278 WP_001541564.1.30505 WP_001541564.1.30507 WP_001541564.1.30547 WP_001541564.1.30548 WP_001541564.1.30589 WP_001541564.1.30627 WP_001541564.1.3067 WP_001541564.1.30752 WP_001541564.1.30794 WP_001541564.1.30833 WP_001541564.1.30835 WP_001541564.1.30968 WP_001541564.1.30972 WP_001541564.1.31 WP_001541564.1.3113 WP_001541564.1.31167 WP_001541564.1.3119 WP_001541564.1.31190 WP_001541564.1.31195 WP_001541564.1.31196 WP_001541564.1.31272 WP_001541564.1.31335 WP_001541564.1.31362 WP_001541564.1.31504 WP_001541564.1.31515 WP_001541564.1.31578 WP_001541564.1.31585 WP_001541564.1.31658 WP_001541564.1.31720 WP_001541564.1.31901 WP_001541564.1.31940 WP_001541564.1.31967 WP_001541564.1.31972 WP_001541564.1.31983 WP_001541564.1.32109 WP_001541564.1.32116 WP_001541564.1.32192 WP_001541564.1.32206 WP_001541564.1.32255 WP_001541564.1.32274 WP_001541564.1.32309 WP_001541564.1.32493 WP_001541564.1.32702 WP_001541564.1.32740 WP_001541564.1.32832 WP_001541564.1.32899 WP_001541564.1.33030 WP_001541564.1.33127 WP_001541564.1.33143 WP_001541564.1.33248 WP_001541564.1.33253 WP_001541564.1.33261 WP_001541564.1.33270 WP_001541564.1.333 WP_001541564.1.33409 WP_001541564.1.33492 WP_001541564.1.335 WP_001541564.1.33553 WP_001541564.1.33586 WP_001541564.1.33592 WP_001541564.1.3364 WP_001541564.1.33865 WP_001541564.1.3396 WP_001541564.1.34 WP_001541564.1.34075 WP_001541564.1.34257 WP_001541564.1.34279 WP_001541564.1.34319 WP_001541564.1.3438 WP_001541564.1.34431 WP_001541564.1.34610 WP_001541564.1.34614 WP_001541564.1.34684 WP_001541564.1.34711 WP_001541564.1.3476 WP_001541564.1.34820 WP_001541564.1.34856 WP_001541564.1.34975 WP_001541564.1.35045 WP_001541564.1.35129 WP_001541564.1.35219 WP_001541564.1.35298 WP_001541564.1.35321 WP_001541564.1.35332 WP_001541564.1.35404 WP_001541564.1.35408 WP_001541564.1.35425 WP_001541564.1.35446 WP_001541564.1.35503 WP_001541564.1.35509 WP_001541564.1.35563 WP_001541564.1.35570 WP_001541564.1.35590 WP_001541564.1.35594 WP_001541564.1.35619 WP_001541564.1.3572 WP_001541564.1.35887 WP_001541564.1.35936 WP_001541564.1.35940 WP_001541564.1.35961 WP_001541564.1.36003 WP_001541564.1.3601 WP_001541564.1.36037 WP_001541564.1.36445 WP_001541564.1.36685 WP_001541564.1.36705 WP_001541564.1.36721 WP_001541564.1.36889 WP_001541564.1.36931 WP_001541564.1.36948 WP_001541564.1.37073 WP_001541564.1.37111 WP_001541564.1.37112 WP_001541564.1.37114 WP_001541564.1.3726 WP_001541564.1.37293 WP_001541564.1.37370 WP_001541564.1.37405 WP_001541564.1.3744 WP_001541564.1.3748 WP_001541564.1.37498 WP_001541564.1.37618 WP_001541564.1.3771 WP_001541564.1.3790 WP_001541564.1.37968 WP_001541564.1.37978 WP_001541564.1.38037 WP_001541564.1.38047 WP_001541564.1.38344 WP_001541564.1.3848 WP_001541564.1.38673 WP_001541564.1.38693 WP_001541564.1.38913 WP_001541564.1.39048 WP_001541564.1.39082 WP_001541564.1.39136 WP_001541564.1.39197 WP_001541564.1.39229 WP_001541564.1.39405 WP_001541564.1.39414 WP_001541564.1.39420 WP_001541564.1.39512 WP_001541564.1.39614 WP_001541564.1.39629 WP_001541564.1.39763 WP_001541564.1.39923 WP_001541564.1.40017 WP_001541564.1.40072 WP_001541564.1.40073 WP_001541564.1.40081 WP_001541564.1.4011 WP_001541564.1.40158 WP_001541564.1.40208 WP_001541564.1.40240 WP_001541564.1.40257 WP_001541564.1.40284 WP_001541564.1.40292 WP_001541564.1.40307 WP_001541564.1.40395 WP_001541564.1.40465 WP_001541564.1.40533 WP_001541564.1.40622 WP_001541564.1.40695 WP_001541564.1.40710 WP_001541564.1.40745 WP_001541564.1.40849 WP_001541564.1.40877 WP_001541564.1.40930 WP_001541564.1.40973 WP_001541564.1.41086 WP_001541564.1.41091 WP_001541564.1.41116 WP_001541564.1.41279 WP_001541564.1.4141 WP_001541564.1.41427 WP_001541564.1.41434 WP_001541564.1.41554 WP_001541564.1.41572 WP_001541564.1.41591 WP_001541564.1.41688 WP_001541564.1.41761 WP_001541564.1.41799 WP_001541564.1.41882 WP_001541564.1.41911 WP_001541564.1.41949 WP_001541564.1.41978 WP_001541564.1.41979 WP_001541564.1.42136 WP_001541564.1.42320 WP_001541564.1.42322 WP_001541564.1.42392 WP_001541564.1.42422 WP_001541564.1.42675 WP_001541564.1.42683 WP_001541564.1.42734 WP_001541564.1.4276 WP_001541564.1.42864 WP_001541564.1.42932 WP_001541564.1.43018 WP_001541564.1.43041 WP_001541564.1.43244 WP_001541564.1.43312 WP_001541564.1.43334 WP_001541564.1.43437 WP_001541564.1.43613 WP_001541564.1.43668 WP_001541564.1.43711 WP_001541564.1.43785 WP_001541564.1.43886 WP_001541564.1.44005 WP_001541564.1.44010 WP_001541564.1.44043 WP_001541564.1.44099 WP_001541564.1.44121 WP_001541564.1.44187 WP_001541564.1.44291 WP_001541564.1.44310 WP_001541564.1.44337 WP_001541564.1.44397 WP_001541564.1.44474 WP_001541564.1.44640 WP_001541564.1.4467 WP_001541564.1.44705 WP_001541564.1.4485 WP_001541564.1.44877 WP_001541564.1.44943 WP_001541564.1.44997 WP_001541564.1.45067 WP_001541564.1.45079 WP_001541564.1.45177 WP_001541564.1.45184 WP_001541564.1.45259 WP_001541564.1.4531 WP_001541564.1.45349 WP_001541564.1.45365 WP_001541564.1.45550 WP_001541564.1.45571 WP_001541564.1.45583 WP_001541564.1.45585 WP_001541564.1.45660 WP_001541564.1.45690 WP_001541564.1.45706 WP_001541564.1.45844 WP_001541564.1.45918 WP_001541564.1.4592 WP_001541564.1.46069 WP_001541564.1.46112 WP_001541564.1.46174 WP_001541564.1.46187 WP_001541564.1.46215 WP_001541564.1.46303 WP_001541564.1.46595 WP_001541564.1.4674 WP_001541564.1.4686 WP_001541564.1.46976 WP_001541564.1.47057 WP_001541564.1.47067 WP_001541564.1.47214 WP_001541564.1.47429 WP_001541564.1.4747 WP_001541564.1.47472 WP_001541564.1.47478 WP_001541564.1.47507 WP_001541564.1.47567 WP_001541564.1.47576 WP_001541564.1.4758 WP_001541564.1.47799 WP_001541564.1.47829 WP_001541564.1.47850 WP_001541564.1.47875 WP_001541564.1.47911 WP_001541564.1.4795 WP_001541564.1.47988 WP_001541564.1.48268 WP_001541564.1.483 WP_001541564.1.48367 WP_001541564.1.48377 WP_001541564.1.4839 WP_001541564.1.48524 WP_001541564.1.4853 WP_001541564.1.48797 WP_001541564.1.4885 WP_001541564.1.48876 WP_001541564.1.48894 WP_001541564.1.48919 WP_001541564.1.49155 WP_001541564.1.49239 WP_001541564.1.49256 WP_001541564.1.49290 WP_001541564.1.49311 WP_001541564.1.49334 WP_001541564.1.49366 WP_001541564.1.49490 WP_001541564.1.49515 WP_001541564.1.49572 WP_001541564.1.49770 WP_001541564.1.4979 WP_001541564.1.49803 WP_001541564.1.49929 WP_001541564.1.50080 WP_001541564.1.50161 WP_001541564.1.50332 WP_001541564.1.50374 WP_001541564.1.50376 WP_001541564.1.50389 WP_001541564.1.50449 WP_001541564.1.50652 WP_001541564.1.50684 WP_001541564.1.50777 WP_001541564.1.50804 WP_001541564.1.50808 WP_001541564.1.5088 WP_001541564.1.50882 WP_001541564.1.50905 WP_001541564.1.50941 WP_001541564.1.50960 WP_001541564.1.51014 WP_001541564.1.51182 WP_001541564.1.51186 WP_001541564.1.51356 WP_001541564.1.51412 WP_001541564.1.51451 WP_001541564.1.51487 WP_001541564.1.51502 WP_001541564.1.51518 WP_001541564.1.51634 WP_001541564.1.51649 WP_001541564.1.51686 WP_001541564.1.51700 WP_001541564.1.51756 WP_001541564.1.51810 WP_001541564.1.51868 WP_001541564.1.51911 WP_001541564.1.51930 WP_001541564.1.51932 WP_001541564.1.51989 WP_001541564.1.52121 WP_001541564.1.52301 WP_001541564.1.52336 WP_001541564.1.52353 WP_001541564.1.52582 WP_001541564.1.52653 WP_001541564.1.52656 WP_001541564.1.52743 WP_001541564.1.52833 WP_001541564.1.52857 WP_001541564.1.53107 WP_001541564.1.53119 WP_001541564.1.53198 WP_001541564.1.53234 WP_001541564.1.53362 WP_001541564.1.53385 WP_001541564.1.53406 WP_001541564.1.53529 WP_001541564.1.53543 WP_001541564.1.53567 WP_001541564.1.53757 WP_001541564.1.53778 WP_001541564.1.53781 WP_001541564.1.53812 WP_001541564.1.53896 WP_001541564.1.53961 WP_001541564.1.54075 WP_001541564.1.54196 WP_001541564.1.54209 WP_001541564.1.54274 WP_001541564.1.54283 WP_001541564.1.54319 WP_001541564.1.54364 WP_001541564.1.54366 WP_001541564.1.54469 WP_001541564.1.54615 WP_001541564.1.54662 WP_001541564.1.54722 WP_001541564.1.54764 WP_001541564.1.54833 WP_001541564.1.54936 WP_001541564.1.55008 WP_001541564.1.55152 WP_001541564.1.5527 WP_001541564.1.55285 WP_001541564.1.55475 WP_001541564.1.5555 WP_001541564.1.55559 WP_001541564.1.55640 WP_001541564.1.55647 WP_001541564.1.55743 WP_001541564.1.55768 WP_001541564.1.5577 WP_001541564.1.55853 WP_001541564.1.55948 WP_001541564.1.56002 WP_001541564.1.56012 WP_001541564.1.56105 WP_001541564.1.56286 WP_001541564.1.56304 WP_001541564.1.56560 WP_001541564.1.56601 WP_001541564.1.56614 WP_001541564.1.56671 WP_001541564.1.56682 WP_001541564.1.56851 WP_001541564.1.56861 WP_001541564.1.56875 WP_001541564.1.56877 WP_001541564.1.56898 WP_001541564.1.56950 WP_001541564.1.57026 WP_001541564.1.57039 WP_001541564.1.57056 WP_001541564.1.57143 WP_001541564.1.57168 WP_001541564.1.57187 WP_001541564.1.57296 WP_001541564.1.57362 WP_001541564.1.57377 WP_001541564.1.57433 WP_001541564.1.57576 WP_001541564.1.57601 WP_001541564.1.57607 WP_001541564.1.57631 WP_001541564.1.57835 WP_001541564.1.57862 WP_001541564.1.57890 WP_001541564.1.57891 WP_001541564.1.57893 WP_001541564.1.57902 WP_001541564.1.58041 WP_001541564.1.5828 WP_001541564.1.58290 WP_001541564.1.58418 WP_001541564.1.58442 WP_001541564.1.58443 WP_001541564.1.58486 WP_001541564.1.58489 WP_001541564.1.58548 WP_001541564.1.5858 WP_001541564.1.58662 WP_001541564.1.58669 WP_001541564.1.58675 WP_001541564.1.587 WP_001541564.1.58745 WP_001541564.1.58749 WP_001541564.1.58803 WP_001541564.1.58884 WP_001541564.1.58926 WP_001541564.1.59094 WP_001541564.1.59224 WP_001541564.1.59321 WP_001541564.1.59335 WP_001541564.1.59427 WP_001541564.1.59490 WP_001541564.1.59508 WP_001541564.1.59538 WP_001541564.1.59548 WP_001541564.1.59684 WP_001541564.1.59694 WP_001541564.1.60008 WP_001541564.1.60021 WP_001541564.1.60069 WP_001541564.1.60126 WP_001541564.1.60137 WP_001541564.1.60320 WP_001541564.1.60379 WP_001541564.1.60464 WP_001541564.1.60486 WP_001541564.1.60794 WP_001541564.1.608 WP_001541564.1.60866 WP_001541564.1.60897 WP_001541564.1.6129 WP_001541564.1.61345 WP_001541564.1.61417 WP_001541564.1.61501 WP_001541564.1.61574 WP_001541564.1.61595 WP_001541564.1.61671 WP_001541564.1.61712 WP_001541564.1.61730 WP_001541564.1.61908 WP_001541564.1.61918 WP_001541564.1.61952 WP_001541564.1.62007 WP_001541564.1.62158 WP_001541564.1.62204 WP_001541564.1.62245 WP_001541564.1.62304 WP_001541564.1.62364 WP_001541564.1.62374 WP_001541564.1.62403 WP_001541564.1.62404 WP_001541564.1.62412 WP_001541564.1.6253 WP_001541564.1.627 WP_001541564.1.62745 WP_001541564.1.62757 WP_001541564.1.62853 WP_001541564.1.62903 WP_001541564.1.6292 WP_001541564.1.62955 WP_001541564.1.62983 WP_001541564.1.62988 WP_001541564.1.63045 WP_001541564.1.63102 WP_001541564.1.63181 WP_001541564.1.63203 WP_001541564.1.63358 WP_001541564.1.63382 WP_001541564.1.63432 WP_001541564.1.63461 WP_001541564.1.63509 WP_001541564.1.63585 WP_001541564.1.63603 WP_001541564.1.6370 WP_001541564.1.63718 WP_001541564.1.63748 WP_001541564.1.63757 WP_001541564.1.63834 WP_001541564.1.63851 WP_001541564.1.63863 WP_001541564.1.64046 WP_001541564.1.64109 WP_001541564.1.64121 WP_001541564.1.64157 WP_001541564.1.64229 WP_001541564.1.6423 WP_001541564.1.64244 WP_001541564.1.64350 WP_001541564.1.64385 WP_001541564.1.64403 WP_001541564.1.64500 WP_001541564.1.64649 WP_001541564.1.64702 WP_001541564.1.64711 WP_001541564.1.64757 WP_001541564.1.64781 WP_001541564.1.64831 WP_001541564.1.65028 WP_001541564.1.65171 WP_001541564.1.65248 WP_001541564.1.6535 WP_001541564.1.65357 WP_001541564.1.65474 WP_001541564.1.65633 WP_001541564.1.65696 WP_001541564.1.65698 WP_001541564.1.65771 WP_001541564.1.65881 WP_001541564.1.65883 WP_001541564.1.66122 WP_001541564.1.66289 WP_001541564.1.6630 WP_001541564.1.66314 WP_001541564.1.66315 WP_001541564.1.66358 WP_001541564.1.66362 WP_001541564.1.6638 WP_001541564.1.66385 WP_001541564.1.66428 WP_001541564.1.66698 WP_001541564.1.66733 WP_001541564.1.66834 WP_001541564.1.66937 WP_001541564.1.6710 WP_001541564.1.67181 WP_001541564.1.67279 WP_001541564.1.67347 WP_001541564.1.67465 WP_001541564.1.67552 WP_001541564.1.67829 WP_001541564.1.68159 WP_001541564.1.68201 WP_001541564.1.68206 WP_001541564.1.6827 WP_001541564.1.6849 WP_001541564.1.68547 WP_001541564.1.68589 WP_001541564.1.68591 WP_001541564.1.68655 WP_001541564.1.68677 WP_001541564.1.68778 WP_001541564.1.68787 WP_001541564.1.68893 WP_001541564.1.68928 WP_001541564.1.68975 WP_001541564.1.69006 WP_001541564.1.69086 WP_001541564.1.69131 WP_001541564.1.69146 WP_001541564.1.69255 WP_001541564.1.69273 WP_001541564.1.69357 WP_001541564.1.69485 WP_001541564.1.69575 WP_001541564.1.69616 WP_001541564.1.69644 WP_001541564.1.69704 WP_001541564.1.69767 WP_001541564.1.69965 WP_001541564.1.70088 WP_001541564.1.7021 WP_001541564.1.70241 WP_001541564.1.70269 WP_001541564.1.70272 WP_001541564.1.70303 WP_001541564.1.70440 WP_001541564.1.70485 WP_001541564.1.70596 WP_001541564.1.70643 WP_001541564.1.70678 WP_001541564.1.70683 WP_001541564.1.70785 WP_001541564.1.70922 WP_001541564.1.70929 WP_001541564.1.70948 WP_001541564.1.70977 WP_001541564.1.71116 WP_001541564.1.71146 WP_001541564.1.71172 WP_001541564.1.71184 WP_001541564.1.71188 WP_001541564.1.71201 WP_001541564.1.71248 WP_001541564.1.71305 WP_001541564.1.71306 WP_001541564.1.71337 WP_001541564.1.71378 WP_001541564.1.71401 WP_001541564.1.71418 WP_001541564.1.71600 WP_001541564.1.71649 WP_001541564.1.71702 WP_001541564.1.71750 WP_001541564.1.71908 WP_001541564.1.71952 WP_001541564.1.71973 WP_001541564.1.720 WP_001541564.1.72182 WP_001541564.1.72190 WP_001541564.1.72221 WP_001541564.1.72300 WP_001541564.1.72325 WP_001541564.1.72339 WP_001541564.1.72376 WP_001541564.1.72470 WP_001541564.1.72532 WP_001541564.1.72594 WP_001541564.1.72625 WP_001541564.1.72718 WP_001541564.1.7295 WP_001541564.1.72975 WP_001541564.1.73068 WP_001541564.1.7315 WP_001541564.1.7334 WP_001541564.1.73377 WP_001541564.1.7356 WP_001541564.1.73617 WP_001541564.1.73669 WP_001541564.1.73708 WP_001541564.1.73758 WP_001541564.1.73764 WP_001541564.1.73956 WP_001541564.1.74174 WP_001541564.1.74191 WP_001541564.1.74207 WP_001541564.1.743 WP_001541564.1.74379 WP_001541564.1.74410 WP_001541564.1.74529 WP_001541564.1.74545 WP_001541564.1.74972 WP_001541564.1.75056 WP_001541564.1.75129 WP_001541564.1.75148 WP_001541564.1.75187 WP_001541564.1.75334 WP_001541564.1.75362 WP_001541564.1.75385 WP_001541564.1.75400 WP_001541564.1.75450 WP_001541564.1.75607 WP_001541564.1.75760 WP_001541564.1.75764 WP_001541564.1.75794 WP_001541564.1.75810 WP_001541564.1.75863 WP_001541564.1.75874 WP_001541564.1.75884 WP_001541564.1.75902 WP_001541564.1.76020 WP_001541564.1.76024 WP_001541564.1.76108 WP_001541564.1.76137 WP_001541564.1.76162 WP_001541564.1.76345 WP_001541564.1.76445 WP_001541564.1.76451 WP_001541564.1.76495 WP_001541564.1.7660 WP_001541564.1.76673 WP_001541564.1.76721 WP_001541564.1.76760 WP_001541564.1.76776 WP_001541564.1.76875 WP_001541564.1.76899 WP_001541564.1.76913 WP_001541564.1.76968 WP_001541564.1.77038 WP_001541564.1.77047 WP_001541564.1.77067 WP_001541564.1.77180 WP_001541564.1.77244 WP_001541564.1.77292 WP_001541564.1.77349 WP_001541564.1.77496 WP_001541564.1.77514 WP_001541564.1.77529 WP_001541564.1.77549 WP_001541564.1.77898 WP_001541564.1.7793 WP_001541564.1.77951 WP_001541564.1.77960 WP_001541564.1.77983 WP_001541564.1.77987 WP_001541564.1.77989 WP_001541564.1.78033 WP_001541564.1.78051 WP_001541564.1.78076 WP_001541564.1.78096 WP_001541564.1.78100 WP_001541564.1.78383 WP_001541564.1.78443 WP_001541564.1.78501 WP_001541564.1.78603 WP_001541564.1.78632 WP_001541564.1.78658 WP_001541564.1.78697 WP_001541564.1.78734 WP_001541564.1.78735 WP_001541564.1.7877 WP_001541564.1.78802 WP_001541564.1.78815 WP_001541564.1.78830 WP_001541564.1.78835 WP_001541564.1.78871 WP_001541564.1.78874 WP_001541564.1.78877 WP_001541564.1.78896 WP_001541564.1.78918 WP_001541564.1.78930 WP_001541564.1.79289 WP_001541564.1.79335 WP_001541564.1.79462 WP_001541564.1.79468 WP_001541564.1.79472 WP_001541564.1.79490 WP_001541564.1.79495 WP_001541564.1.79529 WP_001541564.1.79570 WP_001541564.1.79580 WP_001541564.1.79586 WP_001541564.1.7964 WP_001541564.1.79642 WP_001541564.1.79659 WP_001541564.1.79668 WP_001541564.1.79708 WP_001541564.1.79757 WP_001541564.1.7982 WP_001541564.1.7991 WP_001541564.1.80077 WP_001541564.1.80137 WP_001541564.1.80249 WP_001541564.1.80254 WP_001541564.1.80296 WP_001541564.1.80366 WP_001541564.1.80380 WP_001541564.1.80609 WP_001541564.1.80780 WP_001541564.1.80831 WP_001541564.1.80874 WP_001541564.1.80876 WP_001541564.1.80881 WP_001541564.1.8096 WP_001541564.1.81069 WP_001541564.1.81109 WP_001541564.1.81110 WP_001541564.1.81149 WP_001541564.1.81175 WP_001541564.1.8119 WP_001541564.1.81193 WP_001541564.1.81197 WP_001541564.1.81225 WP_001541564.1.8130 WP_001541564.1.81354 WP_001541564.1.81425 WP_001541564.1.81455 WP_001541564.1.81750 WP_001541564.1.81768 WP_001541564.1.81902 WP_001541564.1.82149 WP_001541564.1.82337 WP_001541564.1.82395 WP_001541564.1.82401 WP_001541564.1.82420 WP_001541564.1.82434 WP_001541564.1.82474 WP_001541564.1.82503 WP_001541564.1.82515 WP_001541564.1.82569 WP_001541564.1.82676 WP_001541564.1.82761 WP_001541564.1.83005 WP_001541564.1.83006 WP_001541564.1.83092 WP_001541564.1.83204 WP_001541564.1.83354 WP_001541564.1.83491 WP_001541564.1.8354 WP_001541564.1.83558 WP_001541564.1.83760 WP_001541564.1.8399 WP_001541564.1.83995 WP_001541564.1.84000 WP_001541564.1.84075 WP_001541564.1.84083 WP_001541564.1.84086 WP_001541564.1.84103 WP_001541564.1.84154 WP_001541564.1.8425 WP_001541564.1.8441 WP_001541564.1.84497 WP_001541564.1.84515 WP_001541564.1.84532 WP_001541564.1.84598 WP_001541564.1.84659 WP_001541564.1.84876 WP_001541564.1.84899 WP_001541564.1.8497 WP_001541564.1.84983 WP_001541564.1.85040 WP_001541564.1.85079 WP_001541564.1.85180 WP_001541564.1.8526 WP_001541564.1.85271 WP_001541564.1.8545 WP_001541564.1.85483 WP_001541564.1.85541 WP_001541564.1.8556 WP_001541564.1.85617 WP_001541564.1.85663 WP_001541564.1.85671 WP_001541564.1.85672 WP_001541564.1.85777 WP_001541564.1.85886 WP_001541564.1.85900 WP_001541564.1.85904 WP_001541564.1.85976 WP_001541564.1.85982 WP_001541564.1.86157 WP_001541564.1.86159 WP_001541564.1.8616 WP_001541564.1.86240 WP_001541564.1.86306 WP_001541564.1.86356 WP_001541564.1.86450 WP_001541564.1.86469 WP_001541564.1.8647 WP_001541564.1.86514 WP_001541564.1.86588 WP_001541564.1.86610 WP_001541564.1.86661 WP_001541564.1.8672 WP_001541564.1.86915 WP_001541564.1.87038 WP_001541564.1.87095 WP_001541564.1.87187 WP_001541564.1.8736 WP_001541564.1.87460 WP_001541564.1.87484 WP_001541564.1.87552 WP_001541564.1.87712 WP_001541564.1.87760 WP_001541564.1.87936 WP_001541564.1.87945 WP_001541564.1.88019 WP_001541564.1.88052 WP_001541564.1.88073 WP_001541564.1.8809 WP_001541564.1.88185 WP_001541564.1.88291 WP_001541564.1.88293 WP_001541564.1.88474 WP_001541564.1.88508 WP_001541564.1.88703 WP_001541564.1.88731 WP_001541564.1.88902 WP_001541564.1.8891 WP_001541564.1.88966 WP_001541564.1.88968 WP_001541564.1.88982 WP_001541564.1.88998 WP_001541564.1.89008 WP_001541564.1.89116 WP_001541564.1.89138 WP_001541564.1.89177 WP_001541564.1.89221 WP_001541564.1.89304 WP_001541564.1.89362 WP_001541564.1.89408 WP_001541564.1.89425 WP_001541564.1.89570 WP_001541564.1.89622 WP_001541564.1.89634 WP_001541564.1.89659 WP_001541564.1.89680 WP_001541564.1.8996 WP_001541564.1.9003 WP_001541564.1.90097 WP_001541564.1.90252 WP_001541564.1.90421 WP_001541564.1.90453 WP_001541564.1.90540 WP_001541564.1.90563 WP_001541564.1.90585 WP_001541564.1.90641 WP_001541564.1.90734 WP_001541564.1.90959 WP_001541564.1.90973 WP_001541564.1.90983 WP_001541564.1.91003 WP_001541564.1.91278 WP_001541564.1.9137 WP_001541564.1.91424 WP_001541564.1.91474 WP_001541564.1.91512 WP_001541564.1.91564 WP_001541564.1.91655 WP_001541564.1.91724 WP_001541564.1.91732 WP_001541564.1.91742 WP_001541564.1.91772 WP_001541564.1.91776 WP_001541564.1.91788 WP_001541564.1.91795 WP_001541564.1.91898 WP_001541564.1.91904 WP_001541564.1.91974 WP_001541564.1.92013 WP_001541564.1.92093 WP_001541564.1.92129 WP_001541564.1.92183 WP_001541564.1.92310 WP_001541564.1.92443 WP_001541564.1.92452 WP_001541564.1.92531 WP_001541564.1.92557 WP_001541564.1.92628 WP_001541564.1.92671 WP_001541564.1.92738 WP_001541564.1.92754 WP_001541564.1.92806 WP_001541564.1.92890 WP_001541564.1.92929 WP_001541564.1.93076 WP_001541564.1.93101 WP_001541564.1.93136 WP_001541564.1.93350 WP_001541564.1.93365 WP_001541564.1.93410 WP_001541564.1.93524 WP_001541564.1.93543 WP_001541564.1.93577 WP_001541564.1.93656 WP_001541564.1.93662 WP_001541564.1.937 WP_001541564.1.93804 WP_001541564.1.93809 WP_001541564.1.9389 WP_001541564.1.93994 WP_001541564.1.94168 WP_001541564.1.94198 WP_001541564.1.94354 WP_001541564.1.94380 WP_001541564.1.94458 WP_001541564.1.94473 WP_001541564.1.94584 WP_001541564.1.94649 WP_001541564.1.94670 WP_001541564.1.94674 WP_001541564.1.94798 WP_001541564.1.94983 WP_001541564.1.95051 WP_001541564.1.95085 WP_001541564.1.95136 WP_001541564.1.95282 WP_001541564.1.95434 WP_001541564.1.95447 WP_001541564.1.95456 WP_001541564.1.95546 WP_001541564.1.95558 WP_001541564.1.95607 WP_001541564.1.95630 WP_001541564.1.95656 WP_001541564.1.95757 WP_001541564.1.95911 WP_001541564.1.95963 WP_001541564.1.96107 WP_001541564.1.96139 WP_001541564.1.96203 WP_001541564.1.9624 WP_001541564.1.96317 WP_001541564.1.96340 WP_001541564.1.96348 WP_001541564.1.96349 WP_001541564.1.96380 WP_001541564.1.9644 WP_001541564.1.96469 WP_001541564.1.96490 WP_001541564.1.96500 WP_001541564.1.96521 WP_001541564.1.96555 WP_001541564.1.96563 WP_001541564.1.96584 WP_001541564.1.96588 WP_001541564.1.96771 WP_001541564.1.96876 WP_001541564.1.96902 WP_001541564.1.97103 WP_001541564.1.97145 WP_001541564.1.97185 WP_001541564.1.97328 WP_001541564.1.97547 WP_001541564.1.97620 WP_001541564.1.97648 WP_001541564.1.97656 WP_001541564.1.97736 WP_001541564.1.9774 WP_001541564.1.9775 WP_001541564.1.97846 WP_001541564.1.9793 WP_001541564.1.97991 WP_001541564.1.98006 WP_001541564.1.98019 WP_001541564.1.98022 WP_001541564.1.98119 WP_001541564.1.98219 WP_001541564.1.98338 WP_001541564.1.9841 WP_001541564.1.98440 WP_001541564.1.98446 WP_001541564.1.98472 WP_001541564.1.98531 WP_001541564.1.98570 WP_001541564.1.98577 WP_001541564.1.98676 WP_001541564.1.98677 WP_001541564.1.98843 WP_001541564.1.9898 WP_001541564.1.9899 WP_001541564.1.99057 WP_001541564.1.99164 WP_001541564.1.99184 WP_001541564.1.99215 WP_001541564.1.99267 WP_001541564.1.99276 WP_001541564.1.99426 WP_001541564.1.99456 WP_001541564.1.99490 WP_001541564.1.99493 WP_001541564.1.99577 WP_001541564.1.99613 WP_001541564.1.99630 WP_001541564.1.99646 WP_001541564.1.99657 WP_001541564.1.99660 WP_001541564.1.99712 WP_001541564.1.99858 WP_001541564.1.99889 WP_001541564.1.99924 WP_001541564.1.99958 WP_001541564.1.99961 321314.SCV45 APC25609 gi|12084972|ref|NP_073265.1|NC_002638 gi|378448086|ref|YP_005235578.1|NC_016855 gi|378991885|ref|YP_005255048.1|NC_016864 gi|386730714|ref|YP_006203690.1|NC_017720 gi|550903977|ref|YP_008673067.1|NC_022570 gi|60115507|ref|YP_209299.1|NC_006855 gi|60115507|ref|YP_209299.1| gi|378991885|ref|YP_005255048.1| gi|378448086|ref|YP_005235578.1| gi|386730714|ref|YP_006203690.1| AE006471|CDS_40871-41287 AY509003|CDS_42168-41752 CP001362|CDS_40863-41279

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]