SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378448358|ref|YP_005235717.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378448358|ref|YP_005235717.1|
Domain Number 1 Region: 9-517
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 3.14e-135
Family Acetyl-CoA synthetase-like 0.0000118
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|378448358|ref|YP_005235717.1|
Sequence length 517
Comment putative crotonobetaine/carnitine-CoA ligase [Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S]
Sequence
MDIVGGQNLRQMWDDLAGVYGDKTALIFESCEGIVRQFSYASLNEEINRTANLFYSLGIR
KGDRVALHLDNCPEFIFCWFGLAKIGAIMVPINARLLGEESAWILQNSQVSLLVTSAQFY
PMYREIRQDNSTPLNHICLIGEQLPADDGVSHFTQLQARQSATLCYTPVLSTDDTAEILF
TSGTTSRPKGVVITHYNLRFAGYYSAWQIALRDDDVYMTVMPAFHIDCQCTAAMPAFSAG
STFVLLEKYSARAFWDQVRKYQATVTECIPMMIRTLMVQPAAPTDRQHHLREVMFYLNLS
EQEKDDFTERFGVRLLTSYGMTETIVGIIGDRPGDKRRWPSIGRVGFSYEAEIRDDQNRP
LPAGEIGEICIKGIPGKTIFKEYYMQPEATAKALEPEGWLHTGDSGYQDEDGYFYFVDRR
CNMIKRGGENVSCVELENIISAHPKIQDIVVVGIKDAIRDEAIKAFIVLNEGETLSEAEF
FSFCENNMAKFKVPSFMEIRTDLPRNCSGKIIKKNLK
Download sequence
Identical sequences A0A0D6HJH0 A0A0F6AWK0 A0A0F7J396 A0A0H3N8X1 A0A0M0PMT9 A0A0U1JTT6 A0A265B1K2 A0A2D3AKN8 A0A2H9YGD5 B4TIH0 E8XG93 Q8ZRX4
gi|549722798|ref|YP_008642988.1| gi|379699290|ref|YP_005241018.1| gi|378982613|ref|YP_005245768.1| gi|526219029|ref|YP_008264330.1| gi|386589951|ref|YP_006086351.1| gi|525827876|ref|YP_008250601.1| gi|383494896|ref|YP_005395585.1| gi|525815928|ref|YP_008245946.1| gi|194450926|ref|YP_002044037.1| gi|16763461|ref|NP_459076.1| NP_459076.1.58477 WP_000355806.1.100010 WP_000355806.1.100234 WP_000355806.1.100376 WP_000355806.1.100424 WP_000355806.1.100436 WP_000355806.1.100484 WP_000355806.1.100488 WP_000355806.1.100597 WP_000355806.1.100730 WP_000355806.1.10076 WP_000355806.1.100781 WP_000355806.1.100793 WP_000355806.1.100869 WP_000355806.1.100871 WP_000355806.1.100882 WP_000355806.1.101007 WP_000355806.1.101020 WP_000355806.1.101074 WP_000355806.1.101078 WP_000355806.1.101180 WP_000355806.1.101259 WP_000355806.1.101291 WP_000355806.1.1013 WP_000355806.1.101353 WP_000355806.1.101386 WP_000355806.1.101404 WP_000355806.1.101420 WP_000355806.1.101589 WP_000355806.1.101707 WP_000355806.1.101734 WP_000355806.1.101878 WP_000355806.1.101953 WP_000355806.1.10220 WP_000355806.1.10231 WP_000355806.1.10266 WP_000355806.1.10429 WP_000355806.1.10439 WP_000355806.1.10566 WP_000355806.1.10678 WP_000355806.1.10753 WP_000355806.1.10992 WP_000355806.1.11024 WP_000355806.1.11031 WP_000355806.1.11098 WP_000355806.1.1110 WP_000355806.1.11156 WP_000355806.1.11168 WP_000355806.1.11190 WP_000355806.1.11295 WP_000355806.1.11455 WP_000355806.1.11518 WP_000355806.1.11532 WP_000355806.1.11543 WP_000355806.1.11588 WP_000355806.1.11677 WP_000355806.1.11687 WP_000355806.1.11735 WP_000355806.1.11763 WP_000355806.1.11772 WP_000355806.1.11834 WP_000355806.1.11897 WP_000355806.1.12017 WP_000355806.1.12114 WP_000355806.1.12351 WP_000355806.1.12370 WP_000355806.1.12546 WP_000355806.1.1264 WP_000355806.1.12728 WP_000355806.1.12879 WP_000355806.1.12936 WP_000355806.1.12995 WP_000355806.1.13027 WP_000355806.1.13106 WP_000355806.1.13130 WP_000355806.1.13207 WP_000355806.1.13414 WP_000355806.1.13488 WP_000355806.1.13509 WP_000355806.1.13661 WP_000355806.1.13669 WP_000355806.1.13741 WP_000355806.1.1387 WP_000355806.1.13908 WP_000355806.1.13932 WP_000355806.1.13968 WP_000355806.1.14001 WP_000355806.1.14111 WP_000355806.1.14151 WP_000355806.1.14239 WP_000355806.1.14320 WP_000355806.1.14379 WP_000355806.1.14406 WP_000355806.1.14410 WP_000355806.1.14436 WP_000355806.1.14458 WP_000355806.1.14466 WP_000355806.1.14524 WP_000355806.1.14554 WP_000355806.1.14618 WP_000355806.1.14725 WP_000355806.1.14852 WP_000355806.1.1489 WP_000355806.1.14932 WP_000355806.1.15046 WP_000355806.1.15055 WP_000355806.1.15124 WP_000355806.1.15223 WP_000355806.1.15226 WP_000355806.1.15316 WP_000355806.1.15369 WP_000355806.1.1540 WP_000355806.1.15508 WP_000355806.1.15784 WP_000355806.1.15830 WP_000355806.1.15862 WP_000355806.1.15910 WP_000355806.1.15986 WP_000355806.1.16004 WP_000355806.1.16047 WP_000355806.1.16062 WP_000355806.1.16063 WP_000355806.1.16103 WP_000355806.1.16226 WP_000355806.1.16233 WP_000355806.1.16284 WP_000355806.1.1635 WP_000355806.1.16361 WP_000355806.1.16468 WP_000355806.1.16525 WP_000355806.1.16614 WP_000355806.1.16650 WP_000355806.1.16686 WP_000355806.1.16691 WP_000355806.1.16732 WP_000355806.1.16735 WP_000355806.1.16786 WP_000355806.1.16858 WP_000355806.1.16873 WP_000355806.1.16896 WP_000355806.1.16903 WP_000355806.1.16916 WP_000355806.1.16965 WP_000355806.1.1700 WP_000355806.1.17093 WP_000355806.1.17307 WP_000355806.1.174 WP_000355806.1.17480 WP_000355806.1.17546 WP_000355806.1.17702 WP_000355806.1.17705 WP_000355806.1.17743 WP_000355806.1.17891 WP_000355806.1.1798 WP_000355806.1.18019 WP_000355806.1.18111 WP_000355806.1.18122 WP_000355806.1.18163 WP_000355806.1.1818 WP_000355806.1.18254 WP_000355806.1.18265 WP_000355806.1.18267 WP_000355806.1.18468 WP_000355806.1.18607 WP_000355806.1.18705 WP_000355806.1.18715 WP_000355806.1.18776 WP_000355806.1.18822 WP_000355806.1.18881 WP_000355806.1.18940 WP_000355806.1.18949 WP_000355806.1.19053 WP_000355806.1.19273 WP_000355806.1.19320 WP_000355806.1.19458 WP_000355806.1.19460 WP_000355806.1.19461 WP_000355806.1.19588 WP_000355806.1.19614 WP_000355806.1.19616 WP_000355806.1.19702 WP_000355806.1.19706 WP_000355806.1.19724 WP_000355806.1.19749 WP_000355806.1.19784 WP_000355806.1.19793 WP_000355806.1.19802 WP_000355806.1.19809 WP_000355806.1.19867 WP_000355806.1.19975 WP_000355806.1.1998 WP_000355806.1.20 WP_000355806.1.2010 WP_000355806.1.20212 WP_000355806.1.20266 WP_000355806.1.20271 WP_000355806.1.20362 WP_000355806.1.20418 WP_000355806.1.20443 WP_000355806.1.20446 WP_000355806.1.20525 WP_000355806.1.2054 WP_000355806.1.20553 WP_000355806.1.20614 WP_000355806.1.20626 WP_000355806.1.20646 WP_000355806.1.20886 WP_000355806.1.20908 WP_000355806.1.21049 WP_000355806.1.21136 WP_000355806.1.21146 WP_000355806.1.21245 WP_000355806.1.21246 WP_000355806.1.21269 WP_000355806.1.21351 WP_000355806.1.21400 WP_000355806.1.21497 WP_000355806.1.21499 WP_000355806.1.21603 WP_000355806.1.21751 WP_000355806.1.21757 WP_000355806.1.21991 WP_000355806.1.22024 WP_000355806.1.22030 WP_000355806.1.2205 WP_000355806.1.22062 WP_000355806.1.22067 WP_000355806.1.2221 WP_000355806.1.22235 WP_000355806.1.2235 WP_000355806.1.22379 WP_000355806.1.22427 WP_000355806.1.2246 WP_000355806.1.22485 WP_000355806.1.22620 WP_000355806.1.22692 WP_000355806.1.22758 WP_000355806.1.22864 WP_000355806.1.22870 WP_000355806.1.22979 WP_000355806.1.23102 WP_000355806.1.23114 WP_000355806.1.2314 WP_000355806.1.23192 WP_000355806.1.23259 WP_000355806.1.23460 WP_000355806.1.23472 WP_000355806.1.23482 WP_000355806.1.23509 WP_000355806.1.23634 WP_000355806.1.2364 WP_000355806.1.23932 WP_000355806.1.23959 WP_000355806.1.24017 WP_000355806.1.24082 WP_000355806.1.24206 WP_000355806.1.24308 WP_000355806.1.24578 WP_000355806.1.24737 WP_000355806.1.24779 WP_000355806.1.25008 WP_000355806.1.25015 WP_000355806.1.25119 WP_000355806.1.25405 WP_000355806.1.25454 WP_000355806.1.25493 WP_000355806.1.25668 WP_000355806.1.25690 WP_000355806.1.2570 WP_000355806.1.25740 WP_000355806.1.25814 WP_000355806.1.25988 WP_000355806.1.26311 WP_000355806.1.26319 WP_000355806.1.26429 WP_000355806.1.26440 WP_000355806.1.26493 WP_000355806.1.26551 WP_000355806.1.26567 WP_000355806.1.26741 WP_000355806.1.26919 WP_000355806.1.27010 WP_000355806.1.27084 WP_000355806.1.27173 WP_000355806.1.27206 WP_000355806.1.27223 WP_000355806.1.27423 WP_000355806.1.27544 WP_000355806.1.27561 WP_000355806.1.2763 WP_000355806.1.27665 WP_000355806.1.27707 WP_000355806.1.27761 WP_000355806.1.2777 WP_000355806.1.27857 WP_000355806.1.27977 WP_000355806.1.28032 WP_000355806.1.28094 WP_000355806.1.28170 WP_000355806.1.28302 WP_000355806.1.2835 WP_000355806.1.28370 WP_000355806.1.28538 WP_000355806.1.28575 WP_000355806.1.28625 WP_000355806.1.28655 WP_000355806.1.28694 WP_000355806.1.2879 WP_000355806.1.2890 WP_000355806.1.28938 WP_000355806.1.28946 WP_000355806.1.29006 WP_000355806.1.29010 WP_000355806.1.2910 WP_000355806.1.29113 WP_000355806.1.29509 WP_000355806.1.29588 WP_000355806.1.29601 WP_000355806.1.29606 WP_000355806.1.29615 WP_000355806.1.29619 WP_000355806.1.29704 WP_000355806.1.29827 WP_000355806.1.29969 WP_000355806.1.29990 WP_000355806.1.30006 WP_000355806.1.30022 WP_000355806.1.30027 WP_000355806.1.30180 WP_000355806.1.30202 WP_000355806.1.30469 WP_000355806.1.30505 WP_000355806.1.30507 WP_000355806.1.30535 WP_000355806.1.30547 WP_000355806.1.30794 WP_000355806.1.30833 WP_000355806.1.30835 WP_000355806.1.30972 WP_000355806.1.31 WP_000355806.1.31092 WP_000355806.1.31122 WP_000355806.1.3113 WP_000355806.1.31185 WP_000355806.1.3119 WP_000355806.1.31190 WP_000355806.1.31195 WP_000355806.1.31196 WP_000355806.1.31281 WP_000355806.1.31362 WP_000355806.1.31451 WP_000355806.1.31504 WP_000355806.1.31515 WP_000355806.1.31578 WP_000355806.1.31658 WP_000355806.1.31940 WP_000355806.1.31967 WP_000355806.1.31972 WP_000355806.1.32192 WP_000355806.1.32206 WP_000355806.1.32260 WP_000355806.1.32438 WP_000355806.1.32515 WP_000355806.1.32660 WP_000355806.1.32702 WP_000355806.1.32714 WP_000355806.1.32786 WP_000355806.1.32804 WP_000355806.1.32907 WP_000355806.1.33030 WP_000355806.1.33127 WP_000355806.1.33143 WP_000355806.1.33248 WP_000355806.1.33261 WP_000355806.1.333 WP_000355806.1.33492 WP_000355806.1.33553 WP_000355806.1.33580 WP_000355806.1.33592 WP_000355806.1.33894 WP_000355806.1.3394 WP_000355806.1.34043 WP_000355806.1.34075 WP_000355806.1.34257 WP_000355806.1.34279 WP_000355806.1.34319 WP_000355806.1.34417 WP_000355806.1.34453 WP_000355806.1.34610 WP_000355806.1.34856 WP_000355806.1.34975 WP_000355806.1.35045 WP_000355806.1.35129 WP_000355806.1.35184 WP_000355806.1.35193 WP_000355806.1.35404 WP_000355806.1.35408 WP_000355806.1.35425 WP_000355806.1.35446 WP_000355806.1.35463 WP_000355806.1.35503 WP_000355806.1.35509 WP_000355806.1.35590 WP_000355806.1.35892 WP_000355806.1.35940 WP_000355806.1.36003 WP_000355806.1.3601 WP_000355806.1.36017 WP_000355806.1.36547 WP_000355806.1.36609 WP_000355806.1.36690 WP_000355806.1.3670 WP_000355806.1.36705 WP_000355806.1.36918 WP_000355806.1.36931 WP_000355806.1.37073 WP_000355806.1.37111 WP_000355806.1.37112 WP_000355806.1.37256 WP_000355806.1.37293 WP_000355806.1.37370 WP_000355806.1.37376 WP_000355806.1.3744 WP_000355806.1.37498 WP_000355806.1.37504 WP_000355806.1.37618 WP_000355806.1.37968 WP_000355806.1.37978 WP_000355806.1.38125 WP_000355806.1.38145 WP_000355806.1.383 WP_000355806.1.38393 WP_000355806.1.3848 WP_000355806.1.38569 WP_000355806.1.38613 WP_000355806.1.38673 WP_000355806.1.38693 WP_000355806.1.38773 WP_000355806.1.38781 WP_000355806.1.38882 WP_000355806.1.38913 WP_000355806.1.39003 WP_000355806.1.39136 WP_000355806.1.39197 WP_000355806.1.39229 WP_000355806.1.39265 WP_000355806.1.39405 WP_000355806.1.39420 WP_000355806.1.39449 WP_000355806.1.39512 WP_000355806.1.39584 WP_000355806.1.39629 WP_000355806.1.39724 WP_000355806.1.39763 WP_000355806.1.39862 WP_000355806.1.39921 WP_000355806.1.39923 WP_000355806.1.40017 WP_000355806.1.40072 WP_000355806.1.40073 WP_000355806.1.4011 WP_000355806.1.40208 WP_000355806.1.40240 WP_000355806.1.40257 WP_000355806.1.40292 WP_000355806.1.40305 WP_000355806.1.40311 WP_000355806.1.40341 WP_000355806.1.40380 WP_000355806.1.40395 WP_000355806.1.40465 WP_000355806.1.40710 WP_000355806.1.4075 WP_000355806.1.4087 WP_000355806.1.40877 WP_000355806.1.40996 WP_000355806.1.41017 WP_000355806.1.41018 WP_000355806.1.41086 WP_000355806.1.41091 WP_000355806.1.41226 WP_000355806.1.41279 WP_000355806.1.41516 WP_000355806.1.41554 WP_000355806.1.41572 WP_000355806.1.41591 WP_000355806.1.41662 WP_000355806.1.41708 WP_000355806.1.41761 WP_000355806.1.41882 WP_000355806.1.41979 WP_000355806.1.41985 WP_000355806.1.42104 WP_000355806.1.42156 WP_000355806.1.4222 WP_000355806.1.42243 WP_000355806.1.42320 WP_000355806.1.42342 WP_000355806.1.42422 WP_000355806.1.42444 WP_000355806.1.42676 WP_000355806.1.4276 WP_000355806.1.42864 WP_000355806.1.4288 WP_000355806.1.43018 WP_000355806.1.43041 WP_000355806.1.43077 WP_000355806.1.43244 WP_000355806.1.43312 WP_000355806.1.43334 WP_000355806.1.43339 WP_000355806.1.43371 WP_000355806.1.43437 WP_000355806.1.43522 WP_000355806.1.43613 WP_000355806.1.43668 WP_000355806.1.43778 WP_000355806.1.43886 WP_000355806.1.43951 WP_000355806.1.44005 WP_000355806.1.44043 WP_000355806.1.44099 WP_000355806.1.44121 WP_000355806.1.44291 WP_000355806.1.44310 WP_000355806.1.44386 WP_000355806.1.44433 WP_000355806.1.44479 WP_000355806.1.44640 WP_000355806.1.4467 WP_000355806.1.44747 WP_000355806.1.4485 WP_000355806.1.44877 WP_000355806.1.44927 WP_000355806.1.44933 WP_000355806.1.45067 WP_000355806.1.45074 WP_000355806.1.45079 WP_000355806.1.45098 WP_000355806.1.45145 WP_000355806.1.45177 WP_000355806.1.45184 WP_000355806.1.45259 WP_000355806.1.45349 WP_000355806.1.45365 WP_000355806.1.45434 WP_000355806.1.45550 WP_000355806.1.45582 WP_000355806.1.45585 WP_000355806.1.45622 WP_000355806.1.45660 WP_000355806.1.45690 WP_000355806.1.458 WP_000355806.1.45848 WP_000355806.1.46011 WP_000355806.1.46069 WP_000355806.1.46112 WP_000355806.1.46173 WP_000355806.1.46174 WP_000355806.1.46187 WP_000355806.1.46278 WP_000355806.1.46303 WP_000355806.1.46434 WP_000355806.1.46595 WP_000355806.1.46675 WP_000355806.1.47008 WP_000355806.1.47057 WP_000355806.1.47214 WP_000355806.1.47429 WP_000355806.1.47448 WP_000355806.1.4747 WP_000355806.1.47472 WP_000355806.1.47478 WP_000355806.1.47579 WP_000355806.1.47621 WP_000355806.1.47799 WP_000355806.1.48242 WP_000355806.1.48253 WP_000355806.1.483 WP_000355806.1.48367 WP_000355806.1.48377 WP_000355806.1.4853 WP_000355806.1.48788 WP_000355806.1.4885 WP_000355806.1.48876 WP_000355806.1.48894 WP_000355806.1.48919 WP_000355806.1.49084 WP_000355806.1.49113 WP_000355806.1.49155 WP_000355806.1.49204 WP_000355806.1.49239 WP_000355806.1.49256 WP_000355806.1.49290 WP_000355806.1.49340 WP_000355806.1.49366 WP_000355806.1.49490 WP_000355806.1.49515 WP_000355806.1.49572 WP_000355806.1.49686 WP_000355806.1.4979 WP_000355806.1.49803 WP_000355806.1.49805 WP_000355806.1.49929 WP_000355806.1.50080 WP_000355806.1.50161 WP_000355806.1.50211 WP_000355806.1.50376 WP_000355806.1.50389 WP_000355806.1.50404 WP_000355806.1.50676 WP_000355806.1.50804 WP_000355806.1.50808 WP_000355806.1.5088 WP_000355806.1.50908 WP_000355806.1.50918 WP_000355806.1.50941 WP_000355806.1.50999 WP_000355806.1.51014 WP_000355806.1.51022 WP_000355806.1.51066 WP_000355806.1.51179 WP_000355806.1.51182 WP_000355806.1.51186 WP_000355806.1.51224 WP_000355806.1.51487 WP_000355806.1.51488 WP_000355806.1.51634 WP_000355806.1.51649 WP_000355806.1.51686 WP_000355806.1.51831 WP_000355806.1.51911 WP_000355806.1.51932 WP_000355806.1.51989 WP_000355806.1.52121 WP_000355806.1.52170 WP_000355806.1.52336 WP_000355806.1.52346 WP_000355806.1.52353 WP_000355806.1.52361 WP_000355806.1.52653 WP_000355806.1.52692 WP_000355806.1.52743 WP_000355806.1.52857 WP_000355806.1.52866 WP_000355806.1.52898 WP_000355806.1.52915 WP_000355806.1.52949 WP_000355806.1.52985 WP_000355806.1.53190 WP_000355806.1.53272 WP_000355806.1.53406 WP_000355806.1.53466 WP_000355806.1.53529 WP_000355806.1.53543 WP_000355806.1.53757 WP_000355806.1.53812 WP_000355806.1.53905 WP_000355806.1.54033 WP_000355806.1.54075 WP_000355806.1.54196 WP_000355806.1.54209 WP_000355806.1.54271 WP_000355806.1.54274 WP_000355806.1.54319 WP_000355806.1.54364 WP_000355806.1.54400 WP_000355806.1.54526 WP_000355806.1.54644 WP_000355806.1.54662 WP_000355806.1.54722 WP_000355806.1.54749 WP_000355806.1.54764 WP_000355806.1.55008 WP_000355806.1.55152 WP_000355806.1.55156 WP_000355806.1.55285 WP_000355806.1.55325 WP_000355806.1.55430 WP_000355806.1.55475 WP_000355806.1.5560 WP_000355806.1.55647 WP_000355806.1.55743 WP_000355806.1.55768 WP_000355806.1.55782 WP_000355806.1.55796 WP_000355806.1.55973 WP_000355806.1.56002 WP_000355806.1.56012 WP_000355806.1.56105 WP_000355806.1.56238 WP_000355806.1.56244 WP_000355806.1.56286 WP_000355806.1.56304 WP_000355806.1.56414 WP_000355806.1.56438 WP_000355806.1.56559 WP_000355806.1.56560 WP_000355806.1.56601 WP_000355806.1.56614 WP_000355806.1.56660 WP_000355806.1.56671 WP_000355806.1.56682 WP_000355806.1.56875 WP_000355806.1.56877 WP_000355806.1.57168 WP_000355806.1.57187 WP_000355806.1.57356 WP_000355806.1.57377 WP_000355806.1.57418 WP_000355806.1.57433 WP_000355806.1.57515 WP_000355806.1.57529 WP_000355806.1.57576 WP_000355806.1.57601 WP_000355806.1.57607 WP_000355806.1.5774 WP_000355806.1.57763 WP_000355806.1.57862 WP_000355806.1.57890 WP_000355806.1.57891 WP_000355806.1.57978 WP_000355806.1.5801 WP_000355806.1.58358 WP_000355806.1.58407 WP_000355806.1.58418 WP_000355806.1.58548 WP_000355806.1.5858 WP_000355806.1.58662 WP_000355806.1.58669 WP_000355806.1.58745 WP_000355806.1.58803 WP_000355806.1.5886 WP_000355806.1.59094 WP_000355806.1.59224 WP_000355806.1.59321 WP_000355806.1.59375 WP_000355806.1.59420 WP_000355806.1.59458 WP_000355806.1.59490 WP_000355806.1.59508 WP_000355806.1.59684 WP_000355806.1.59694 WP_000355806.1.59771 WP_000355806.1.5979 WP_000355806.1.59953 WP_000355806.1.60008 WP_000355806.1.60021 WP_000355806.1.60069 WP_000355806.1.60140 WP_000355806.1.60155 WP_000355806.1.60285 WP_000355806.1.60379 WP_000355806.1.60464 WP_000355806.1.60545 WP_000355806.1.60561 WP_000355806.1.60772 WP_000355806.1.60874 WP_000355806.1.60941 WP_000355806.1.61078 WP_000355806.1.6114 WP_000355806.1.61232 WP_000355806.1.6129 WP_000355806.1.61296 WP_000355806.1.61345 WP_000355806.1.61417 WP_000355806.1.61574 WP_000355806.1.61712 WP_000355806.1.61714 WP_000355806.1.61730 WP_000355806.1.61857 WP_000355806.1.61918 WP_000355806.1.61952 WP_000355806.1.62007 WP_000355806.1.62020 WP_000355806.1.62025 WP_000355806.1.6209 WP_000355806.1.62257 WP_000355806.1.62304 WP_000355806.1.62364 WP_000355806.1.62374 WP_000355806.1.62403 WP_000355806.1.6253 WP_000355806.1.62853 WP_000355806.1.62903 WP_000355806.1.62910 WP_000355806.1.62955 WP_000355806.1.63181 WP_000355806.1.63203 WP_000355806.1.63256 WP_000355806.1.63290 WP_000355806.1.63382 WP_000355806.1.63432 WP_000355806.1.63461 WP_000355806.1.63479 WP_000355806.1.63577 WP_000355806.1.63664 WP_000355806.1.63718 WP_000355806.1.6375 WP_000355806.1.63757 WP_000355806.1.63797 WP_000355806.1.63834 WP_000355806.1.64018 WP_000355806.1.64046 WP_000355806.1.6423 WP_000355806.1.64244 WP_000355806.1.64387 WP_000355806.1.64403 WP_000355806.1.64649 WP_000355806.1.64702 WP_000355806.1.64757 WP_000355806.1.64781 WP_000355806.1.64831 WP_000355806.1.6489 WP_000355806.1.64894 WP_000355806.1.65018 WP_000355806.1.65028 WP_000355806.1.65171 WP_000355806.1.65248 WP_000355806.1.65269 WP_000355806.1.6535 WP_000355806.1.65474 WP_000355806.1.65572 WP_000355806.1.65633 WP_000355806.1.6565 WP_000355806.1.65696 WP_000355806.1.6575 WP_000355806.1.65782 WP_000355806.1.65940 WP_000355806.1.65956 WP_000355806.1.66049 WP_000355806.1.6630 WP_000355806.1.66314 WP_000355806.1.66330 WP_000355806.1.66358 WP_000355806.1.66362 WP_000355806.1.6638 WP_000355806.1.6640 WP_000355806.1.66678 WP_000355806.1.66698 WP_000355806.1.6680 WP_000355806.1.66834 WP_000355806.1.66901 WP_000355806.1.66962 WP_000355806.1.67037 WP_000355806.1.67045 WP_000355806.1.67100 WP_000355806.1.67181 WP_000355806.1.67235 WP_000355806.1.67268 WP_000355806.1.67347 WP_000355806.1.6739 WP_000355806.1.67465 WP_000355806.1.67552 WP_000355806.1.67682 WP_000355806.1.67829 WP_000355806.1.67887 WP_000355806.1.68073 WP_000355806.1.68201 WP_000355806.1.68206 WP_000355806.1.6827 WP_000355806.1.68275 WP_000355806.1.68401 WP_000355806.1.68477 WP_000355806.1.6849 WP_000355806.1.68547 WP_000355806.1.68589 WP_000355806.1.68655 WP_000355806.1.68656 WP_000355806.1.68778 WP_000355806.1.68787 WP_000355806.1.68894 WP_000355806.1.68928 WP_000355806.1.68975 WP_000355806.1.69001 WP_000355806.1.69006 WP_000355806.1.6904 WP_000355806.1.6913 WP_000355806.1.69146 WP_000355806.1.69151 WP_000355806.1.69255 WP_000355806.1.69359 WP_000355806.1.69397 WP_000355806.1.6954 WP_000355806.1.69564 WP_000355806.1.69644 WP_000355806.1.69704 WP_000355806.1.69758 WP_000355806.1.7021 WP_000355806.1.70241 WP_000355806.1.70269 WP_000355806.1.70289 WP_000355806.1.70447 WP_000355806.1.70485 WP_000355806.1.70643 WP_000355806.1.70683 WP_000355806.1.70883 WP_000355806.1.70922 WP_000355806.1.70948 WP_000355806.1.70959 WP_000355806.1.71023 WP_000355806.1.71116 WP_000355806.1.71146 WP_000355806.1.71165 WP_000355806.1.71188 WP_000355806.1.71202 WP_000355806.1.71243 WP_000355806.1.71306 WP_000355806.1.71337 WP_000355806.1.71363 WP_000355806.1.71378 WP_000355806.1.71401 WP_000355806.1.71636 WP_000355806.1.71702 WP_000355806.1.71750 WP_000355806.1.71798 WP_000355806.1.71845 WP_000355806.1.71881 WP_000355806.1.71908 WP_000355806.1.71952 WP_000355806.1.71973 WP_000355806.1.72105 WP_000355806.1.72203 WP_000355806.1.72281 WP_000355806.1.72376 WP_000355806.1.72403 WP_000355806.1.72594 WP_000355806.1.72728 WP_000355806.1.72871 WP_000355806.1.72872 WP_000355806.1.72975 WP_000355806.1.73125 WP_000355806.1.7315 WP_000355806.1.73200 WP_000355806.1.7334 WP_000355806.1.73377 WP_000355806.1.73461 WP_000355806.1.73481 WP_000355806.1.7356 WP_000355806.1.73581 WP_000355806.1.73617 WP_000355806.1.73753 WP_000355806.1.73758 WP_000355806.1.73794 WP_000355806.1.73847 WP_000355806.1.7387 WP_000355806.1.73924 WP_000355806.1.74029 WP_000355806.1.74181 WP_000355806.1.74191 WP_000355806.1.7433 WP_000355806.1.74379 WP_000355806.1.74410 WP_000355806.1.74466 WP_000355806.1.745 WP_000355806.1.74529 WP_000355806.1.74745 WP_000355806.1.7491 WP_000355806.1.75129 WP_000355806.1.75187 WP_000355806.1.75288 WP_000355806.1.75334 WP_000355806.1.75362 WP_000355806.1.75385 WP_000355806.1.75392 WP_000355806.1.75760 WP_000355806.1.75764 WP_000355806.1.75837 WP_000355806.1.75874 WP_000355806.1.75945 WP_000355806.1.76020 WP_000355806.1.76252 WP_000355806.1.76327 WP_000355806.1.76445 WP_000355806.1.7660 WP_000355806.1.76673 WP_000355806.1.76706 WP_000355806.1.76721 WP_000355806.1.76756 WP_000355806.1.76760 WP_000355806.1.76875 WP_000355806.1.76880 WP_000355806.1.76899 WP_000355806.1.77038 WP_000355806.1.77047 WP_000355806.1.77080 WP_000355806.1.7712 WP_000355806.1.77177 WP_000355806.1.77180 WP_000355806.1.77244 WP_000355806.1.77267 WP_000355806.1.77292 WP_000355806.1.77349 WP_000355806.1.77514 WP_000355806.1.77529 WP_000355806.1.77549 WP_000355806.1.77692 WP_000355806.1.77710 WP_000355806.1.7782 WP_000355806.1.77851 WP_000355806.1.77898 WP_000355806.1.77918 WP_000355806.1.77960 WP_000355806.1.78033 WP_000355806.1.78076 WP_000355806.1.78096 WP_000355806.1.78100 WP_000355806.1.78110 WP_000355806.1.78120 WP_000355806.1.78372 WP_000355806.1.78383 WP_000355806.1.78407 WP_000355806.1.7861 WP_000355806.1.78618 WP_000355806.1.78673 WP_000355806.1.78735 WP_000355806.1.78802 WP_000355806.1.78830 WP_000355806.1.78835 WP_000355806.1.78838 WP_000355806.1.78871 WP_000355806.1.78874 WP_000355806.1.78918 WP_000355806.1.78930 WP_000355806.1.79151 WP_000355806.1.79167 WP_000355806.1.79335 WP_000355806.1.79462 WP_000355806.1.79472 WP_000355806.1.79490 WP_000355806.1.79495 WP_000355806.1.79529 WP_000355806.1.79570 WP_000355806.1.7964 WP_000355806.1.79659 WP_000355806.1.79668 WP_000355806.1.79708 WP_000355806.1.79734 WP_000355806.1.79845 WP_000355806.1.80077 WP_000355806.1.80137 WP_000355806.1.80182 WP_000355806.1.80296 WP_000355806.1.80366 WP_000355806.1.80741 WP_000355806.1.80780 WP_000355806.1.80831 WP_000355806.1.80850 WP_000355806.1.80881 WP_000355806.1.80939 WP_000355806.1.80959 WP_000355806.1.8096 WP_000355806.1.81037 WP_000355806.1.81069 WP_000355806.1.81149 WP_000355806.1.81175 WP_000355806.1.8119 WP_000355806.1.81305 WP_000355806.1.81328 WP_000355806.1.81354 WP_000355806.1.81425 WP_000355806.1.81528 WP_000355806.1.81735 WP_000355806.1.81750 WP_000355806.1.81760 WP_000355806.1.81785 WP_000355806.1.81902 WP_000355806.1.81974 WP_000355806.1.82192 WP_000355806.1.82232 WP_000355806.1.82337 WP_000355806.1.82464 WP_000355806.1.82479 WP_000355806.1.82503 WP_000355806.1.82515 WP_000355806.1.82676 WP_000355806.1.82761 WP_000355806.1.8282 WP_000355806.1.82944 WP_000355806.1.82956 WP_000355806.1.83092 WP_000355806.1.83163 WP_000355806.1.83305 WP_000355806.1.83413 WP_000355806.1.83491 WP_000355806.1.83523 WP_000355806.1.8354 WP_000355806.1.83721 WP_000355806.1.83760 WP_000355806.1.83995 WP_000355806.1.84103 WP_000355806.1.84283 WP_000355806.1.84291 WP_000355806.1.84392 WP_000355806.1.84397 WP_000355806.1.8441 WP_000355806.1.84532 WP_000355806.1.84554 WP_000355806.1.84659 WP_000355806.1.84899 WP_000355806.1.8497 WP_000355806.1.85040 WP_000355806.1.85134 WP_000355806.1.85178 WP_000355806.1.85180 WP_000355806.1.85190 WP_000355806.1.85192 WP_000355806.1.8533 WP_000355806.1.8545 WP_000355806.1.85481 WP_000355806.1.85483 WP_000355806.1.85541 WP_000355806.1.8556 WP_000355806.1.85568 WP_000355806.1.85615 WP_000355806.1.85663 WP_000355806.1.85671 WP_000355806.1.85672 WP_000355806.1.85777 WP_000355806.1.85886 WP_000355806.1.85900 WP_000355806.1.85904 WP_000355806.1.85976 WP_000355806.1.86043 WP_000355806.1.86173 WP_000355806.1.86306 WP_000355806.1.86356 WP_000355806.1.86450 WP_000355806.1.86469 WP_000355806.1.86580 WP_000355806.1.86588 WP_000355806.1.86661 WP_000355806.1.8671 WP_000355806.1.8672 WP_000355806.1.8678 WP_000355806.1.86810 WP_000355806.1.8684 WP_000355806.1.86895 WP_000355806.1.86906 WP_000355806.1.87095 WP_000355806.1.87323 WP_000355806.1.8736 WP_000355806.1.87460 WP_000355806.1.87552 WP_000355806.1.87695 WP_000355806.1.87779 WP_000355806.1.87899 WP_000355806.1.8792 WP_000355806.1.87945 WP_000355806.1.88019 WP_000355806.1.88073 WP_000355806.1.8809 WP_000355806.1.88092 WP_000355806.1.88291 WP_000355806.1.88293 WP_000355806.1.8837 WP_000355806.1.88393 WP_000355806.1.88703 WP_000355806.1.88792 WP_000355806.1.88902 WP_000355806.1.8891 WP_000355806.1.88957 WP_000355806.1.88980 WP_000355806.1.88981 WP_000355806.1.89008 WP_000355806.1.89114 WP_000355806.1.89116 WP_000355806.1.89119 WP_000355806.1.89138 WP_000355806.1.89304 WP_000355806.1.89512 WP_000355806.1.89527 WP_000355806.1.89570 WP_000355806.1.89604 WP_000355806.1.89622 WP_000355806.1.89657 WP_000355806.1.89659 WP_000355806.1.89765 WP_000355806.1.89817 WP_000355806.1.89902 WP_000355806.1.8996 WP_000355806.1.90097 WP_000355806.1.90252 WP_000355806.1.90417 WP_000355806.1.90453 WP_000355806.1.90458 WP_000355806.1.90557 WP_000355806.1.90585 WP_000355806.1.90641 WP_000355806.1.90734 WP_000355806.1.91003 WP_000355806.1.91056 WP_000355806.1.91069 WP_000355806.1.91179 WP_000355806.1.91278 WP_000355806.1.91512 WP_000355806.1.91564 WP_000355806.1.91621 WP_000355806.1.91628 WP_000355806.1.91655 WP_000355806.1.91724 WP_000355806.1.91732 WP_000355806.1.91788 WP_000355806.1.92013 WP_000355806.1.92093 WP_000355806.1.92108 WP_000355806.1.92165 WP_000355806.1.92183 WP_000355806.1.92208 WP_000355806.1.92268 WP_000355806.1.92310 WP_000355806.1.92443 WP_000355806.1.92482 WP_000355806.1.92531 WP_000355806.1.92562 WP_000355806.1.92669 WP_000355806.1.92671 WP_000355806.1.92738 WP_000355806.1.92875 WP_000355806.1.92893 WP_000355806.1.93059 WP_000355806.1.93086 WP_000355806.1.93101 WP_000355806.1.93136 WP_000355806.1.93155 WP_000355806.1.93339 WP_000355806.1.93365 WP_000355806.1.93543 WP_000355806.1.93650 WP_000355806.1.93656 WP_000355806.1.93662 WP_000355806.1.937 WP_000355806.1.93705 WP_000355806.1.93804 WP_000355806.1.9389 WP_000355806.1.93937 WP_000355806.1.93994 WP_000355806.1.94072 WP_000355806.1.94162 WP_000355806.1.94168 WP_000355806.1.94198 WP_000355806.1.9432 WP_000355806.1.94354 WP_000355806.1.94380 WP_000355806.1.94458 WP_000355806.1.94584 WP_000355806.1.94655 WP_000355806.1.94674 WP_000355806.1.94796 WP_000355806.1.94959 WP_000355806.1.9503 WP_000355806.1.95051 WP_000355806.1.95085 WP_000355806.1.95121 WP_000355806.1.95248 WP_000355806.1.95277 WP_000355806.1.95282 WP_000355806.1.95388 WP_000355806.1.95546 WP_000355806.1.95630 WP_000355806.1.95670 WP_000355806.1.95691 WP_000355806.1.95911 WP_000355806.1.95939 WP_000355806.1.96004 WP_000355806.1.96139 WP_000355806.1.96162 WP_000355806.1.96317 WP_000355806.1.96343 WP_000355806.1.9644 WP_000355806.1.96469 WP_000355806.1.96500 WP_000355806.1.96555 WP_000355806.1.96563 WP_000355806.1.96732 WP_000355806.1.9674 WP_000355806.1.96771 WP_000355806.1.97015 WP_000355806.1.97047 WP_000355806.1.97143 WP_000355806.1.97145 WP_000355806.1.97190 WP_000355806.1.97297 WP_000355806.1.97318 WP_000355806.1.97369 WP_000355806.1.97477 WP_000355806.1.97487 WP_000355806.1.97594 WP_000355806.1.97597 WP_000355806.1.97613 WP_000355806.1.97620 WP_000355806.1.97631 WP_000355806.1.97727 WP_000355806.1.97732 WP_000355806.1.97736 WP_000355806.1.9775 WP_000355806.1.97846 WP_000355806.1.9799 WP_000355806.1.98006 WP_000355806.1.98019 WP_000355806.1.98022 WP_000355806.1.98110 WP_000355806.1.98146 WP_000355806.1.98170 WP_000355806.1.98219 WP_000355806.1.9826 WP_000355806.1.9841 WP_000355806.1.98495 WP_000355806.1.98531 WP_000355806.1.98577 WP_000355806.1.98676 WP_000355806.1.98677 WP_000355806.1.98760 WP_000355806.1.98843 WP_000355806.1.9898 WP_000355806.1.99098 WP_000355806.1.99184 WP_000355806.1.99267 WP_000355806.1.99276 WP_000355806.1.99626 WP_000355806.1.99646 WP_000355806.1.99657 WP_000355806.1.99660 WP_000355806.1.99712 WP_000355806.1.99813 WP_000355806.1.99858 WP_000355806.1.99889 WP_000355806.1.99958 gi|378698054|ref|YP_005180011.1| ABAO01000001|CDS_130407-128854 ABEL01000008|CDS_156105-157658 AE006468|CDS_84117-82564 CP001120|CDS_79385-77832 CP001363|CDS_84829-83276 FN424405|CDS_84118-82565 gi|378443525|ref|YP_005231157.1| 454169.SeHA_C0075 99287.STM0071 gi|550899498|ref|YP_008668590.1| gi|525839457|ref|YP_008256752.1| gi|378448358|ref|YP_005235717.1| gi|482902620|ref|YP_007901180.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]