SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378448391|ref|YP_005235750.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378448391|ref|YP_005235750.1|
Domain Number 1 Region: 394-783
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 8.9e-113
Family DNA polymerase I 0.000000000000965
Further Details:      
 
Domain Number 2 Region: 3-389
Classification Level Classification E-value
Superfamily Ribonuclease H-like 3.5e-96
Family DnaQ-like 3'-5' exonuclease 0.00000000000176
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|378448391|ref|YP_005235750.1|
Sequence length 783
Comment DNA polymerase II [Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S]
Sequence
MAQAGFILTRHWRDTPQGTEVSFWLATDNGPVQATLAPQESVAFIPTSQTSRAASLLQAE
KDYRLTPLQLRDFHRQPVSGLYCRTHRQLMRMEKLLRENGVTVYEADVRPPERYLMERFI
TSPVWVDGEMRNGVIRNARLKPHSDYRPPLKWVSLDIETTRHGELYCIGLEGCGQRTVYM
LGPANGDDHQLDFELVYVASRPQLLEKLNAWFAEHDPDVIIGWNVVQFDLRMLQKHAERY
RIPLRLGRDNSELEWREHGFKNGVFFAQARGRVIIDGIDALKSAFWNFSSFSLEAVSQEL
LGEGKSIDNPWDRMDEIDRRFAQDKPALATYNLKDCELVTRIFHKTEIMPFLLERATING
LPVDRHGGSVAAFGHLYFPRMHRAGYVAPNLGEVPPLASPGGYVMDSQPGLYDSVLVLDY
KSLYPSIIRTFLIDPVGLVEGMAQPDPEHSTEGFLDAWFSREKHCLPEIVSQIWHGRDEA
KRQGNKPLSQALKIIMNAFYGVLGTTACRFFDPRLASSITMRGHAIMRQTKALIEAQGYD
VIYGDTDSTFVWLRRAHSEADAAEIGHRLVRHVNEWWAQTLQQQNLTSALELEFETHFCR
FLMPTIRGADTGSKKRYAGLIQEGDSQRMVFKGLETVRTDWTPLAQRFQQELYLRVFRNE
PYQDYVRETIDKLMAGELDAQLVYRKRLRRPLHEYQRNVPPHVRAARLADEQNLKQGRPA
QYQNRGAIKYVWTVNGPEPVDYQQSPLDYEHYLTRQLQPVAEGILPFVEDNFATLLTGQL
GLF
Download sequence
Identical sequences A0A0D6HKN2 A0A0F6AWN3 A0A0F7J3B2 A0A0H3NH57 A0A0M0PMW2 A0A0U1FKU9 A0A249V2I8 A0A265B2D7 A0A2D3AKQ2 A0A2H9YGA7 E8XH06 Q8ZRV7
gi|526219053|ref|YP_008264356.1| gi|386589976|ref|YP_006086376.1| gi|378698078|ref|YP_005180035.1| gi|383494921|ref|YP_005395610.1| gi|482902646|ref|YP_007901206.1| gi|194449638|ref|YP_002044066.1| gi|549722823|ref|YP_008643013.1| gi|16763487|ref|NP_459102.1| NP_459102.1.58477 WP_000035723.1.100010 WP_000035723.1.100234 WP_000035723.1.100258 WP_000035723.1.100376 WP_000035723.1.100424 WP_000035723.1.100436 WP_000035723.1.100484 WP_000035723.1.100488 WP_000035723.1.100597 WP_000035723.1.100730 WP_000035723.1.100781 WP_000035723.1.100793 WP_000035723.1.100869 WP_000035723.1.100871 WP_000035723.1.100882 WP_000035723.1.101007 WP_000035723.1.101020 WP_000035723.1.101074 WP_000035723.1.101180 WP_000035723.1.101259 WP_000035723.1.101284 WP_000035723.1.101291 WP_000035723.1.1013 WP_000035723.1.101320 WP_000035723.1.101353 WP_000035723.1.101386 WP_000035723.1.101404 WP_000035723.1.101420 WP_000035723.1.101589 WP_000035723.1.101707 WP_000035723.1.101734 WP_000035723.1.101878 WP_000035723.1.101953 WP_000035723.1.10220 WP_000035723.1.10231 WP_000035723.1.10266 WP_000035723.1.10429 WP_000035723.1.10439 WP_000035723.1.10566 WP_000035723.1.10678 WP_000035723.1.10753 WP_000035723.1.10992 WP_000035723.1.11000 WP_000035723.1.11024 WP_000035723.1.11031 WP_000035723.1.11098 WP_000035723.1.1110 WP_000035723.1.11156 WP_000035723.1.11190 WP_000035723.1.11295 WP_000035723.1.11455 WP_000035723.1.11458 WP_000035723.1.11518 WP_000035723.1.11532 WP_000035723.1.11588 WP_000035723.1.11677 WP_000035723.1.11687 WP_000035723.1.11735 WP_000035723.1.11763 WP_000035723.1.11772 WP_000035723.1.11834 WP_000035723.1.12017 WP_000035723.1.12025 WP_000035723.1.12114 WP_000035723.1.12351 WP_000035723.1.12370 WP_000035723.1.12546 WP_000035723.1.1264 WP_000035723.1.12728 WP_000035723.1.12879 WP_000035723.1.12936 WP_000035723.1.12995 WP_000035723.1.13027 WP_000035723.1.13106 WP_000035723.1.13130 WP_000035723.1.13207 WP_000035723.1.13334 WP_000035723.1.13488 WP_000035723.1.13509 WP_000035723.1.13661 WP_000035723.1.13669 WP_000035723.1.13741 WP_000035723.1.1387 WP_000035723.1.13908 WP_000035723.1.13932 WP_000035723.1.13968 WP_000035723.1.14001 WP_000035723.1.14111 WP_000035723.1.14151 WP_000035723.1.14320 WP_000035723.1.14379 WP_000035723.1.14406 WP_000035723.1.14410 WP_000035723.1.14436 WP_000035723.1.14458 WP_000035723.1.14466 WP_000035723.1.14554 WP_000035723.1.14618 WP_000035723.1.14725 WP_000035723.1.14852 WP_000035723.1.1489 WP_000035723.1.14932 WP_000035723.1.15055 WP_000035723.1.15124 WP_000035723.1.15223 WP_000035723.1.15226 WP_000035723.1.15316 WP_000035723.1.15369 WP_000035723.1.1540 WP_000035723.1.15508 WP_000035723.1.15784 WP_000035723.1.15830 WP_000035723.1.15862 WP_000035723.1.15910 WP_000035723.1.15986 WP_000035723.1.16004 WP_000035723.1.16047 WP_000035723.1.16063 WP_000035723.1.16103 WP_000035723.1.16226 WP_000035723.1.16233 WP_000035723.1.16284 WP_000035723.1.1635 WP_000035723.1.16361 WP_000035723.1.16468 WP_000035723.1.16525 WP_000035723.1.16614 WP_000035723.1.16650 WP_000035723.1.16686 WP_000035723.1.16691 WP_000035723.1.167 WP_000035723.1.16732 WP_000035723.1.16735 WP_000035723.1.16786 WP_000035723.1.16873 WP_000035723.1.16896 WP_000035723.1.16903 WP_000035723.1.16916 WP_000035723.1.1700 WP_000035723.1.17093 WP_000035723.1.17307 WP_000035723.1.174 WP_000035723.1.17480 WP_000035723.1.17546 WP_000035723.1.17702 WP_000035723.1.17705 WP_000035723.1.17743 WP_000035723.1.1798 WP_000035723.1.18019 WP_000035723.1.18111 WP_000035723.1.18122 WP_000035723.1.18163 WP_000035723.1.1818 WP_000035723.1.18254 WP_000035723.1.18265 WP_000035723.1.18282 WP_000035723.1.18468 WP_000035723.1.18607 WP_000035723.1.18705 WP_000035723.1.18715 WP_000035723.1.18776 WP_000035723.1.18822 WP_000035723.1.18881 WP_000035723.1.18940 WP_000035723.1.18949 WP_000035723.1.19053 WP_000035723.1.19273 WP_000035723.1.19320 WP_000035723.1.19458 WP_000035723.1.19460 WP_000035723.1.19461 WP_000035723.1.19588 WP_000035723.1.19614 WP_000035723.1.19616 WP_000035723.1.19702 WP_000035723.1.19706 WP_000035723.1.19724 WP_000035723.1.19784 WP_000035723.1.19793 WP_000035723.1.19802 WP_000035723.1.19809 WP_000035723.1.19867 WP_000035723.1.19975 WP_000035723.1.1998 WP_000035723.1.20 WP_000035723.1.2010 WP_000035723.1.20212 WP_000035723.1.20266 WP_000035723.1.20271 WP_000035723.1.20330 WP_000035723.1.20362 WP_000035723.1.20418 WP_000035723.1.20443 WP_000035723.1.20446 WP_000035723.1.20525 WP_000035723.1.2054 WP_000035723.1.20553 WP_000035723.1.20614 WP_000035723.1.20646 WP_000035723.1.20886 WP_000035723.1.20908 WP_000035723.1.21049 WP_000035723.1.21136 WP_000035723.1.21146 WP_000035723.1.21245 WP_000035723.1.21246 WP_000035723.1.21269 WP_000035723.1.21351 WP_000035723.1.21400 WP_000035723.1.21497 WP_000035723.1.21499 WP_000035723.1.21548 WP_000035723.1.21603 WP_000035723.1.21751 WP_000035723.1.21757 WP_000035723.1.21991 WP_000035723.1.22024 WP_000035723.1.2205 WP_000035723.1.22062 WP_000035723.1.22067 WP_000035723.1.2221 WP_000035723.1.22235 WP_000035723.1.2235 WP_000035723.1.22379 WP_000035723.1.22427 WP_000035723.1.2246 WP_000035723.1.22485 WP_000035723.1.22537 WP_000035723.1.22692 WP_000035723.1.22758 WP_000035723.1.22864 WP_000035723.1.22870 WP_000035723.1.22979 WP_000035723.1.23114 WP_000035723.1.2314 WP_000035723.1.23192 WP_000035723.1.23259 WP_000035723.1.23379 WP_000035723.1.23460 WP_000035723.1.23482 WP_000035723.1.23509 WP_000035723.1.23634 WP_000035723.1.2364 WP_000035723.1.23932 WP_000035723.1.23959 WP_000035723.1.24082 WP_000035723.1.24308 WP_000035723.1.24578 WP_000035723.1.24737 WP_000035723.1.24779 WP_000035723.1.25008 WP_000035723.1.25015 WP_000035723.1.25119 WP_000035723.1.25206 WP_000035723.1.25405 WP_000035723.1.25454 WP_000035723.1.25493 WP_000035723.1.25668 WP_000035723.1.25690 WP_000035723.1.25740 WP_000035723.1.25814 WP_000035723.1.25988 WP_000035723.1.26282 WP_000035723.1.26311 WP_000035723.1.26319 WP_000035723.1.26429 WP_000035723.1.26440 WP_000035723.1.26493 WP_000035723.1.26551 WP_000035723.1.26567 WP_000035723.1.26741 WP_000035723.1.26919 WP_000035723.1.27010 WP_000035723.1.27084 WP_000035723.1.27173 WP_000035723.1.27206 WP_000035723.1.27223 WP_000035723.1.27423 WP_000035723.1.27544 WP_000035723.1.27561 WP_000035723.1.2763 WP_000035723.1.27665 WP_000035723.1.27707 WP_000035723.1.27761 WP_000035723.1.2777 WP_000035723.1.27857 WP_000035723.1.27977 WP_000035723.1.28094 WP_000035723.1.28126 WP_000035723.1.28170 WP_000035723.1.28302 WP_000035723.1.2835 WP_000035723.1.28370 WP_000035723.1.28538 WP_000035723.1.28575 WP_000035723.1.28625 WP_000035723.1.28655 WP_000035723.1.28694 WP_000035723.1.2879 WP_000035723.1.2890 WP_000035723.1.28938 WP_000035723.1.28946 WP_000035723.1.29010 WP_000035723.1.2910 WP_000035723.1.29113 WP_000035723.1.29509 WP_000035723.1.29588 WP_000035723.1.29601 WP_000035723.1.29606 WP_000035723.1.29615 WP_000035723.1.29619 WP_000035723.1.29704 WP_000035723.1.29827 WP_000035723.1.29969 WP_000035723.1.29990 WP_000035723.1.30006 WP_000035723.1.30022 WP_000035723.1.30027 WP_000035723.1.30180 WP_000035723.1.30202 WP_000035723.1.30469 WP_000035723.1.30505 WP_000035723.1.30507 WP_000035723.1.30535 WP_000035723.1.30547 WP_000035723.1.30794 WP_000035723.1.30833 WP_000035723.1.30835 WP_000035723.1.30972 WP_000035723.1.31 WP_000035723.1.31092 WP_000035723.1.31122 WP_000035723.1.3113 WP_000035723.1.31185 WP_000035723.1.3119 WP_000035723.1.31190 WP_000035723.1.31195 WP_000035723.1.31196 WP_000035723.1.31219 WP_000035723.1.31281 WP_000035723.1.31451 WP_000035723.1.31504 WP_000035723.1.31515 WP_000035723.1.31578 WP_000035723.1.31658 WP_000035723.1.31940 WP_000035723.1.31967 WP_000035723.1.31972 WP_000035723.1.32192 WP_000035723.1.32260 WP_000035723.1.32438 WP_000035723.1.32515 WP_000035723.1.32527 WP_000035723.1.32660 WP_000035723.1.32702 WP_000035723.1.32714 WP_000035723.1.32786 WP_000035723.1.32804 WP_000035723.1.32860 WP_000035723.1.33127 WP_000035723.1.33143 WP_000035723.1.33248 WP_000035723.1.33261 WP_000035723.1.333 WP_000035723.1.33492 WP_000035723.1.33553 WP_000035723.1.33580 WP_000035723.1.33592 WP_000035723.1.33894 WP_000035723.1.3394 WP_000035723.1.34043 WP_000035723.1.34075 WP_000035723.1.34257 WP_000035723.1.34279 WP_000035723.1.34319 WP_000035723.1.34417 WP_000035723.1.34453 WP_000035723.1.34610 WP_000035723.1.34856 WP_000035723.1.34975 WP_000035723.1.34977 WP_000035723.1.35045 WP_000035723.1.35129 WP_000035723.1.35184 WP_000035723.1.35193 WP_000035723.1.35404 WP_000035723.1.35408 WP_000035723.1.35425 WP_000035723.1.35446 WP_000035723.1.35463 WP_000035723.1.35503 WP_000035723.1.35509 WP_000035723.1.35590 WP_000035723.1.35892 WP_000035723.1.35940 WP_000035723.1.36003 WP_000035723.1.3601 WP_000035723.1.36017 WP_000035723.1.36547 WP_000035723.1.36609 WP_000035723.1.36690 WP_000035723.1.3670 WP_000035723.1.36918 WP_000035723.1.36931 WP_000035723.1.37063 WP_000035723.1.37073 WP_000035723.1.37111 WP_000035723.1.37112 WP_000035723.1.37256 WP_000035723.1.37293 WP_000035723.1.37376 WP_000035723.1.3744 WP_000035723.1.37498 WP_000035723.1.37504 WP_000035723.1.37618 WP_000035723.1.37687 WP_000035723.1.37968 WP_000035723.1.37978 WP_000035723.1.38125 WP_000035723.1.38145 WP_000035723.1.383 WP_000035723.1.38393 WP_000035723.1.3848 WP_000035723.1.38569 WP_000035723.1.38613 WP_000035723.1.38673 WP_000035723.1.3869 WP_000035723.1.38693 WP_000035723.1.38773 WP_000035723.1.38781 WP_000035723.1.38882 WP_000035723.1.38913 WP_000035723.1.39003 WP_000035723.1.39136 WP_000035723.1.39229 WP_000035723.1.39265 WP_000035723.1.39405 WP_000035723.1.39420 WP_000035723.1.39449 WP_000035723.1.39512 WP_000035723.1.39556 WP_000035723.1.39584 WP_000035723.1.39629 WP_000035723.1.39724 WP_000035723.1.39763 WP_000035723.1.39862 WP_000035723.1.39921 WP_000035723.1.39923 WP_000035723.1.40017 WP_000035723.1.40072 WP_000035723.1.40073 WP_000035723.1.4011 WP_000035723.1.40208 WP_000035723.1.40240 WP_000035723.1.40257 WP_000035723.1.40292 WP_000035723.1.40305 WP_000035723.1.40311 WP_000035723.1.40341 WP_000035723.1.40380 WP_000035723.1.40395 WP_000035723.1.40465 WP_000035723.1.40508 WP_000035723.1.40710 WP_000035723.1.4075 WP_000035723.1.4087 WP_000035723.1.40877 WP_000035723.1.40996 WP_000035723.1.41017 WP_000035723.1.41018 WP_000035723.1.41086 WP_000035723.1.41091 WP_000035723.1.41226 WP_000035723.1.41279 WP_000035723.1.41516 WP_000035723.1.41554 WP_000035723.1.41572 WP_000035723.1.41591 WP_000035723.1.41708 WP_000035723.1.41761 WP_000035723.1.41859 WP_000035723.1.41882 WP_000035723.1.41979 WP_000035723.1.41985 WP_000035723.1.42104 WP_000035723.1.42156 WP_000035723.1.4222 WP_000035723.1.42243 WP_000035723.1.42320 WP_000035723.1.42422 WP_000035723.1.42444 WP_000035723.1.42676 WP_000035723.1.4276 WP_000035723.1.42864 WP_000035723.1.43018 WP_000035723.1.43041 WP_000035723.1.43244 WP_000035723.1.43312 WP_000035723.1.43334 WP_000035723.1.43339 WP_000035723.1.43351 WP_000035723.1.43371 WP_000035723.1.43437 WP_000035723.1.43522 WP_000035723.1.43613 WP_000035723.1.43668 WP_000035723.1.43778 WP_000035723.1.43886 WP_000035723.1.43951 WP_000035723.1.44043 WP_000035723.1.44099 WP_000035723.1.44121 WP_000035723.1.44291 WP_000035723.1.44300 WP_000035723.1.44310 WP_000035723.1.44433 WP_000035723.1.44479 WP_000035723.1.44640 WP_000035723.1.4467 WP_000035723.1.44747 WP_000035723.1.44877 WP_000035723.1.44927 WP_000035723.1.44933 WP_000035723.1.44971 WP_000035723.1.45067 WP_000035723.1.45074 WP_000035723.1.45079 WP_000035723.1.45098 WP_000035723.1.45145 WP_000035723.1.45177 WP_000035723.1.45184 WP_000035723.1.45259 WP_000035723.1.45344 WP_000035723.1.45349 WP_000035723.1.45365 WP_000035723.1.45434 WP_000035723.1.45550 WP_000035723.1.45585 WP_000035723.1.45622 WP_000035723.1.45660 WP_000035723.1.45690 WP_000035723.1.45797 WP_000035723.1.458 WP_000035723.1.45848 WP_000035723.1.46011 WP_000035723.1.46069 WP_000035723.1.46112 WP_000035723.1.46173 WP_000035723.1.46174 WP_000035723.1.46187 WP_000035723.1.46278 WP_000035723.1.46303 WP_000035723.1.46434 WP_000035723.1.46595 WP_000035723.1.46675 WP_000035723.1.47008 WP_000035723.1.47057 WP_000035723.1.47214 WP_000035723.1.47429 WP_000035723.1.47448 WP_000035723.1.4747 WP_000035723.1.47472 WP_000035723.1.47478 WP_000035723.1.47579 WP_000035723.1.47621 WP_000035723.1.47799 WP_000035723.1.48242 WP_000035723.1.48253 WP_000035723.1.483 WP_000035723.1.48367 WP_000035723.1.4853 WP_000035723.1.48788 WP_000035723.1.4885 WP_000035723.1.48894 WP_000035723.1.48919 WP_000035723.1.49084 WP_000035723.1.49113 WP_000035723.1.49155 WP_000035723.1.49204 WP_000035723.1.49239 WP_000035723.1.49290 WP_000035723.1.49340 WP_000035723.1.49366 WP_000035723.1.49490 WP_000035723.1.49515 WP_000035723.1.49572 WP_000035723.1.49686 WP_000035723.1.49803 WP_000035723.1.49805 WP_000035723.1.49929 WP_000035723.1.50080 WP_000035723.1.50161 WP_000035723.1.50211 WP_000035723.1.50376 WP_000035723.1.50389 WP_000035723.1.50404 WP_000035723.1.50676 WP_000035723.1.50774 WP_000035723.1.50804 WP_000035723.1.50808 WP_000035723.1.5088 WP_000035723.1.50908 WP_000035723.1.50941 WP_000035723.1.50999 WP_000035723.1.51014 WP_000035723.1.51022 WP_000035723.1.51066 WP_000035723.1.51182 WP_000035723.1.51186 WP_000035723.1.51224 WP_000035723.1.51487 WP_000035723.1.51488 WP_000035723.1.51634 WP_000035723.1.51649 WP_000035723.1.51686 WP_000035723.1.51831 WP_000035723.1.51911 WP_000035723.1.51932 WP_000035723.1.51989 WP_000035723.1.52121 WP_000035723.1.52148 WP_000035723.1.52170 WP_000035723.1.52336 WP_000035723.1.52346 WP_000035723.1.52353 WP_000035723.1.52361 WP_000035723.1.52656 WP_000035723.1.52743 WP_000035723.1.52857 WP_000035723.1.52866 WP_000035723.1.52915 WP_000035723.1.52949 WP_000035723.1.52985 WP_000035723.1.53190 WP_000035723.1.53272 WP_000035723.1.53406 WP_000035723.1.53436 WP_000035723.1.53466 WP_000035723.1.53529 WP_000035723.1.53543 WP_000035723.1.53757 WP_000035723.1.53812 WP_000035723.1.53905 WP_000035723.1.54033 WP_000035723.1.54075 WP_000035723.1.54196 WP_000035723.1.542 WP_000035723.1.54209 WP_000035723.1.54271 WP_000035723.1.54273 WP_000035723.1.54274 WP_000035723.1.54319 WP_000035723.1.54364 WP_000035723.1.54400 WP_000035723.1.54526 WP_000035723.1.54662 WP_000035723.1.54722 WP_000035723.1.54749 WP_000035723.1.54764 WP_000035723.1.55008 WP_000035723.1.55152 WP_000035723.1.55156 WP_000035723.1.55285 WP_000035723.1.55325 WP_000035723.1.55430 WP_000035723.1.55475 WP_000035723.1.5560 WP_000035723.1.55743 WP_000035723.1.55768 WP_000035723.1.55782 WP_000035723.1.55796 WP_000035723.1.55993 WP_000035723.1.56002 WP_000035723.1.56012 WP_000035723.1.56105 WP_000035723.1.56238 WP_000035723.1.56244 WP_000035723.1.56286 WP_000035723.1.56304 WP_000035723.1.56414 WP_000035723.1.56438 WP_000035723.1.56559 WP_000035723.1.56560 WP_000035723.1.56597 WP_000035723.1.56601 WP_000035723.1.56614 WP_000035723.1.56660 WP_000035723.1.56671 WP_000035723.1.56682 WP_000035723.1.56875 WP_000035723.1.56877 WP_000035723.1.57168 WP_000035723.1.57187 WP_000035723.1.57232 WP_000035723.1.57356 WP_000035723.1.57377 WP_000035723.1.57418 WP_000035723.1.57433 WP_000035723.1.57515 WP_000035723.1.57529 WP_000035723.1.57576 WP_000035723.1.57601 WP_000035723.1.57607 WP_000035723.1.5774 WP_000035723.1.57763 WP_000035723.1.57862 WP_000035723.1.57890 WP_000035723.1.57891 WP_000035723.1.57978 WP_000035723.1.5801 WP_000035723.1.58041 WP_000035723.1.58358 WP_000035723.1.58407 WP_000035723.1.58418 WP_000035723.1.5854 WP_000035723.1.58548 WP_000035723.1.5858 WP_000035723.1.58662 WP_000035723.1.58669 WP_000035723.1.58745 WP_000035723.1.58803 WP_000035723.1.5886 WP_000035723.1.59094 WP_000035723.1.59224 WP_000035723.1.59375 WP_000035723.1.59420 WP_000035723.1.59458 WP_000035723.1.59490 WP_000035723.1.59508 WP_000035723.1.5953 WP_000035723.1.59684 WP_000035723.1.59694 WP_000035723.1.59771 WP_000035723.1.5979 WP_000035723.1.59953 WP_000035723.1.60008 WP_000035723.1.60021 WP_000035723.1.60069 WP_000035723.1.60140 WP_000035723.1.60155 WP_000035723.1.60285 WP_000035723.1.60379 WP_000035723.1.60464 WP_000035723.1.60545 WP_000035723.1.60561 WP_000035723.1.60772 WP_000035723.1.60874 WP_000035723.1.60941 WP_000035723.1.61078 WP_000035723.1.6114 WP_000035723.1.61232 WP_000035723.1.6129 WP_000035723.1.61296 WP_000035723.1.61345 WP_000035723.1.61417 WP_000035723.1.61574 WP_000035723.1.61712 WP_000035723.1.61714 WP_000035723.1.61730 WP_000035723.1.61857 WP_000035723.1.61918 WP_000035723.1.61952 WP_000035723.1.62007 WP_000035723.1.62020 WP_000035723.1.62025 WP_000035723.1.6209 WP_000035723.1.62204 WP_000035723.1.62257 WP_000035723.1.62304 WP_000035723.1.62364 WP_000035723.1.62374 WP_000035723.1.62403 WP_000035723.1.6253 WP_000035723.1.62570 WP_000035723.1.62853 WP_000035723.1.62903 WP_000035723.1.62910 WP_000035723.1.62955 WP_000035723.1.63063 WP_000035723.1.63181 WP_000035723.1.63203 WP_000035723.1.63256 WP_000035723.1.63290 WP_000035723.1.63382 WP_000035723.1.63432 WP_000035723.1.63461 WP_000035723.1.63479 WP_000035723.1.63577 WP_000035723.1.63718 WP_000035723.1.6375 WP_000035723.1.63757 WP_000035723.1.63797 WP_000035723.1.63834 WP_000035723.1.64018 WP_000035723.1.64046 WP_000035723.1.6423 WP_000035723.1.64244 WP_000035723.1.64387 WP_000035723.1.64403 WP_000035723.1.64649 WP_000035723.1.64702 WP_000035723.1.64757 WP_000035723.1.64781 WP_000035723.1.64831 WP_000035723.1.6489 WP_000035723.1.64894 WP_000035723.1.65018 WP_000035723.1.65028 WP_000035723.1.65171 WP_000035723.1.65248 WP_000035723.1.65269 WP_000035723.1.6535 WP_000035723.1.65474 WP_000035723.1.65572 WP_000035723.1.65633 WP_000035723.1.6565 WP_000035723.1.65696 WP_000035723.1.6575 WP_000035723.1.65782 WP_000035723.1.65940 WP_000035723.1.65956 WP_000035723.1.66049 WP_000035723.1.6630 WP_000035723.1.66314 WP_000035723.1.66330 WP_000035723.1.66358 WP_000035723.1.66362 WP_000035723.1.6638 WP_000035723.1.6640 WP_000035723.1.66600 WP_000035723.1.66678 WP_000035723.1.66698 WP_000035723.1.6680 WP_000035723.1.66834 WP_000035723.1.66901 WP_000035723.1.66962 WP_000035723.1.67037 WP_000035723.1.67045 WP_000035723.1.67100 WP_000035723.1.67181 WP_000035723.1.67235 WP_000035723.1.67268 WP_000035723.1.67347 WP_000035723.1.6739 WP_000035723.1.67465 WP_000035723.1.67552 WP_000035723.1.67682 WP_000035723.1.67887 WP_000035723.1.68073 WP_000035723.1.68201 WP_000035723.1.68206 WP_000035723.1.6827 WP_000035723.1.68275 WP_000035723.1.68401 WP_000035723.1.68477 WP_000035723.1.6849 WP_000035723.1.68547 WP_000035723.1.68589 WP_000035723.1.68655 WP_000035723.1.68656 WP_000035723.1.68778 WP_000035723.1.68787 WP_000035723.1.68894 WP_000035723.1.68928 WP_000035723.1.68975 WP_000035723.1.69001 WP_000035723.1.69006 WP_000035723.1.6904 WP_000035723.1.6913 WP_000035723.1.69146 WP_000035723.1.69151 WP_000035723.1.69255 WP_000035723.1.69359 WP_000035723.1.69397 WP_000035723.1.6954 WP_000035723.1.69564 WP_000035723.1.69644 WP_000035723.1.69704 WP_000035723.1.69758 WP_000035723.1.7021 WP_000035723.1.70241 WP_000035723.1.70269 WP_000035723.1.70289 WP_000035723.1.70447 WP_000035723.1.70485 WP_000035723.1.70643 WP_000035723.1.70683 WP_000035723.1.70883 WP_000035723.1.70922 WP_000035723.1.70948 WP_000035723.1.70959 WP_000035723.1.71023 WP_000035723.1.71116 WP_000035723.1.71146 WP_000035723.1.71165 WP_000035723.1.71188 WP_000035723.1.71202 WP_000035723.1.71243 WP_000035723.1.71306 WP_000035723.1.71337 WP_000035723.1.71363 WP_000035723.1.71378 WP_000035723.1.71401 WP_000035723.1.71481 WP_000035723.1.71636 WP_000035723.1.71691 WP_000035723.1.71702 WP_000035723.1.71750 WP_000035723.1.71798 WP_000035723.1.71845 WP_000035723.1.71881 WP_000035723.1.71908 WP_000035723.1.71952 WP_000035723.1.71973 WP_000035723.1.72105 WP_000035723.1.72203 WP_000035723.1.72372 WP_000035723.1.72376 WP_000035723.1.72403 WP_000035723.1.72594 WP_000035723.1.72728 WP_000035723.1.72975 WP_000035723.1.73062 WP_000035723.1.73125 WP_000035723.1.7315 WP_000035723.1.7334 WP_000035723.1.73377 WP_000035723.1.73461 WP_000035723.1.73481 WP_000035723.1.7356 WP_000035723.1.73561 WP_000035723.1.73581 WP_000035723.1.73617 WP_000035723.1.73667 WP_000035723.1.73753 WP_000035723.1.73758 WP_000035723.1.73794 WP_000035723.1.73847 WP_000035723.1.7387 WP_000035723.1.73924 WP_000035723.1.73926 WP_000035723.1.74029 WP_000035723.1.74181 WP_000035723.1.74191 WP_000035723.1.7433 WP_000035723.1.74379 WP_000035723.1.74410 WP_000035723.1.74466 WP_000035723.1.745 WP_000035723.1.74529 WP_000035723.1.74545 WP_000035723.1.74745 WP_000035723.1.7491 WP_000035723.1.75129 WP_000035723.1.75187 WP_000035723.1.75334 WP_000035723.1.75362 WP_000035723.1.75385 WP_000035723.1.75392 WP_000035723.1.75760 WP_000035723.1.75764 WP_000035723.1.75828 WP_000035723.1.75837 WP_000035723.1.75874 WP_000035723.1.75945 WP_000035723.1.76020 WP_000035723.1.76252 WP_000035723.1.76327 WP_000035723.1.76445 WP_000035723.1.7660 WP_000035723.1.76673 WP_000035723.1.76706 WP_000035723.1.76721 WP_000035723.1.76756 WP_000035723.1.76760 WP_000035723.1.76875 WP_000035723.1.76880 WP_000035723.1.76899 WP_000035723.1.77038 WP_000035723.1.77047 WP_000035723.1.7712 WP_000035723.1.77177 WP_000035723.1.77180 WP_000035723.1.77244 WP_000035723.1.77267 WP_000035723.1.77292 WP_000035723.1.77349 WP_000035723.1.77514 WP_000035723.1.77529 WP_000035723.1.77549 WP_000035723.1.77692 WP_000035723.1.77710 WP_000035723.1.77851 WP_000035723.1.77898 WP_000035723.1.77918 WP_000035723.1.77960 WP_000035723.1.78076 WP_000035723.1.78096 WP_000035723.1.78100 WP_000035723.1.78110 WP_000035723.1.78120 WP_000035723.1.78372 WP_000035723.1.78383 WP_000035723.1.78407 WP_000035723.1.78618 WP_000035723.1.78735 WP_000035723.1.78802 WP_000035723.1.78830 WP_000035723.1.78835 WP_000035723.1.78838 WP_000035723.1.78871 WP_000035723.1.78874 WP_000035723.1.78918 WP_000035723.1.78930 WP_000035723.1.79151 WP_000035723.1.79167 WP_000035723.1.79335 WP_000035723.1.79462 WP_000035723.1.79472 WP_000035723.1.79490 WP_000035723.1.79495 WP_000035723.1.79529 WP_000035723.1.79570 WP_000035723.1.7964 WP_000035723.1.79659 WP_000035723.1.79668 WP_000035723.1.79708 WP_000035723.1.79734 WP_000035723.1.80077 WP_000035723.1.80137 WP_000035723.1.80182 WP_000035723.1.80296 WP_000035723.1.80366 WP_000035723.1.80741 WP_000035723.1.80780 WP_000035723.1.80831 WP_000035723.1.80850 WP_000035723.1.80881 WP_000035723.1.8096 WP_000035723.1.81037 WP_000035723.1.81069 WP_000035723.1.81149 WP_000035723.1.81175 WP_000035723.1.8119 WP_000035723.1.81193 WP_000035723.1.81305 WP_000035723.1.81320 WP_000035723.1.81328 WP_000035723.1.81354 WP_000035723.1.81410 WP_000035723.1.81425 WP_000035723.1.81528 WP_000035723.1.81735 WP_000035723.1.81750 WP_000035723.1.81760 WP_000035723.1.81785 WP_000035723.1.81902 WP_000035723.1.82192 WP_000035723.1.82232 WP_000035723.1.82337 WP_000035723.1.82464 WP_000035723.1.82479 WP_000035723.1.82503 WP_000035723.1.82515 WP_000035723.1.82676 WP_000035723.1.82761 WP_000035723.1.8282 WP_000035723.1.82944 WP_000035723.1.82956 WP_000035723.1.83092 WP_000035723.1.83163 WP_000035723.1.83305 WP_000035723.1.83365 WP_000035723.1.83413 WP_000035723.1.83491 WP_000035723.1.83523 WP_000035723.1.8354 WP_000035723.1.83651 WP_000035723.1.83721 WP_000035723.1.83760 WP_000035723.1.83995 WP_000035723.1.84103 WP_000035723.1.84283 WP_000035723.1.84291 WP_000035723.1.84392 WP_000035723.1.84397 WP_000035723.1.8441 WP_000035723.1.84532 WP_000035723.1.84554 WP_000035723.1.84659 WP_000035723.1.84693 WP_000035723.1.84899 WP_000035723.1.8497 WP_000035723.1.85040 WP_000035723.1.85134 WP_000035723.1.85178 WP_000035723.1.85190 WP_000035723.1.8533 WP_000035723.1.8545 WP_000035723.1.85481 WP_000035723.1.85483 WP_000035723.1.85541 WP_000035723.1.8556 WP_000035723.1.85568 WP_000035723.1.85615 WP_000035723.1.85617 WP_000035723.1.85663 WP_000035723.1.85671 WP_000035723.1.85672 WP_000035723.1.85777 WP_000035723.1.85855 WP_000035723.1.85886 WP_000035723.1.85900 WP_000035723.1.85904 WP_000035723.1.85976 WP_000035723.1.86043 WP_000035723.1.86173 WP_000035723.1.86306 WP_000035723.1.86356 WP_000035723.1.86450 WP_000035723.1.86469 WP_000035723.1.86580 WP_000035723.1.86588 WP_000035723.1.86661 WP_000035723.1.8671 WP_000035723.1.8672 WP_000035723.1.8678 WP_000035723.1.86810 WP_000035723.1.86895 WP_000035723.1.86906 WP_000035723.1.87095 WP_000035723.1.87323 WP_000035723.1.8736 WP_000035723.1.87552 WP_000035723.1.87695 WP_000035723.1.87779 WP_000035723.1.87899 WP_000035723.1.8792 WP_000035723.1.87945 WP_000035723.1.88019 WP_000035723.1.8809 WP_000035723.1.88092 WP_000035723.1.88291 WP_000035723.1.88293 WP_000035723.1.8837 WP_000035723.1.88393 WP_000035723.1.88703 WP_000035723.1.88792 WP_000035723.1.88902 WP_000035723.1.8891 WP_000035723.1.88957 WP_000035723.1.88980 WP_000035723.1.88981 WP_000035723.1.89008 WP_000035723.1.89114 WP_000035723.1.89116 WP_000035723.1.89119 WP_000035723.1.89138 WP_000035723.1.89304 WP_000035723.1.89527 WP_000035723.1.89570 WP_000035723.1.89604 WP_000035723.1.89622 WP_000035723.1.89657 WP_000035723.1.89659 WP_000035723.1.89765 WP_000035723.1.89817 WP_000035723.1.89902 WP_000035723.1.8996 WP_000035723.1.90097 WP_000035723.1.90252 WP_000035723.1.90417 WP_000035723.1.90453 WP_000035723.1.90557 WP_000035723.1.90585 WP_000035723.1.90641 WP_000035723.1.91003 WP_000035723.1.91056 WP_000035723.1.91069 WP_000035723.1.91179 WP_000035723.1.91278 WP_000035723.1.9131 WP_000035723.1.91512 WP_000035723.1.91524 WP_000035723.1.91564 WP_000035723.1.91621 WP_000035723.1.91628 WP_000035723.1.91655 WP_000035723.1.91724 WP_000035723.1.91732 WP_000035723.1.91788 WP_000035723.1.92013 WP_000035723.1.92060 WP_000035723.1.92093 WP_000035723.1.92108 WP_000035723.1.92165 WP_000035723.1.92171 WP_000035723.1.92183 WP_000035723.1.92208 WP_000035723.1.92310 WP_000035723.1.92443 WP_000035723.1.92482 WP_000035723.1.92531 WP_000035723.1.92669 WP_000035723.1.92671 WP_000035723.1.92738 WP_000035723.1.92893 WP_000035723.1.93059 WP_000035723.1.93086 WP_000035723.1.93136 WP_000035723.1.93155 WP_000035723.1.93275 WP_000035723.1.93339 WP_000035723.1.93365 WP_000035723.1.93376 WP_000035723.1.93543 WP_000035723.1.93656 WP_000035723.1.93662 WP_000035723.1.937 WP_000035723.1.93705 WP_000035723.1.93804 WP_000035723.1.9389 WP_000035723.1.93937 WP_000035723.1.93994 WP_000035723.1.94072 WP_000035723.1.94162 WP_000035723.1.94168 WP_000035723.1.94198 WP_000035723.1.9432 WP_000035723.1.94354 WP_000035723.1.94380 WP_000035723.1.94458 WP_000035723.1.94565 WP_000035723.1.94584 WP_000035723.1.94655 WP_000035723.1.94674 WP_000035723.1.94796 WP_000035723.1.94959 WP_000035723.1.95051 WP_000035723.1.95085 WP_000035723.1.95121 WP_000035723.1.95248 WP_000035723.1.95277 WP_000035723.1.95282 WP_000035723.1.95388 WP_000035723.1.95546 WP_000035723.1.95630 WP_000035723.1.95670 WP_000035723.1.95691 WP_000035723.1.95911 WP_000035723.1.95939 WP_000035723.1.96004 WP_000035723.1.96139 WP_000035723.1.96162 WP_000035723.1.96317 WP_000035723.1.96343 WP_000035723.1.9644 WP_000035723.1.96469 WP_000035723.1.96500 WP_000035723.1.96555 WP_000035723.1.96563 WP_000035723.1.96732 WP_000035723.1.9674 WP_000035723.1.96771 WP_000035723.1.97015 WP_000035723.1.97047 WP_000035723.1.97143 WP_000035723.1.97145 WP_000035723.1.97190 WP_000035723.1.97297 WP_000035723.1.97318 WP_000035723.1.97369 WP_000035723.1.97477 WP_000035723.1.97487 WP_000035723.1.97594 WP_000035723.1.97597 WP_000035723.1.97613 WP_000035723.1.97620 WP_000035723.1.97631 WP_000035723.1.97727 WP_000035723.1.97732 WP_000035723.1.97736 WP_000035723.1.9775 WP_000035723.1.97846 WP_000035723.1.9799 WP_000035723.1.98006 WP_000035723.1.98019 WP_000035723.1.98022 WP_000035723.1.98110 WP_000035723.1.98146 WP_000035723.1.98170 WP_000035723.1.98219 WP_000035723.1.9826 WP_000035723.1.9841 WP_000035723.1.98495 WP_000035723.1.98531 WP_000035723.1.98577 WP_000035723.1.98676 WP_000035723.1.98677 WP_000035723.1.98760 WP_000035723.1.98843 WP_000035723.1.9898 WP_000035723.1.99072 WP_000035723.1.99098 WP_000035723.1.99184 WP_000035723.1.99267 WP_000035723.1.99276 WP_000035723.1.99626 WP_000035723.1.99646 WP_000035723.1.99657 WP_000035723.1.99660 WP_000035723.1.99712 WP_000035723.1.99813 WP_000035723.1.99858 WP_000035723.1.99889 WP_000035723.1.99958 gi|379699316|ref|YP_005241044.1| gi|378982639|ref|YP_005245794.1| gi|525827852|ref|YP_008250575.1| gi|525815954|ref|YP_008245972.1| gi|378448391|ref|YP_005235750.1| gi|378987502|ref|YP_005250666.1| gi|525839433|ref|YP_008256726.1| gi|550899523|ref|YP_008668615.1| gi|378443551|ref|YP_005231183.1| ABAM02000001|CDS_616727-614376 ABAO01000001|CDS_161723-159372 ABEL01000008|CDS_124657-127008 AE006468|CDS_115433-113082 CP001120|CDS_110833-108482 CP001363|CDS_116145-113794 FN424405|CDS_115434-113083 454169.SeHA_C0104 99287.STM0097

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]