SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378448423|ref|YP_005235782.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378448423|ref|YP_005235782.1|
Domain Number 1 Region: 105-338
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, catalytic domain 1.44e-77
Family MurCDEF 0.00000000302
Further Details:      
 
Domain Number 2 Region: 339-491
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, peptide-binding domain 1.98e-52
Family MurCDEF C-terminal domain 0.000000218
Further Details:      
 
Domain Number 3 Region: 5-103
Classification Level Classification E-value
Superfamily MurE/MurF N-terminal domain 2.88e-22
Family MurE/MurF N-terminal domain 0.00000259
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|378448423|ref|YP_005235782.1|
Sequence length 495
Comment UDP-N-acetylmuramoylalanyl-D-glutamate--2, 6-diaminopimelate ligase [Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S]
Sequence
MADRNLRDLLAPWVAGLPARELREMTLDSRVAAAGDLFVAVVGHQADGRRYIPQAIAQGV
AAIIAEAKDEASDGEIREMHGVPVVYLSQLNERLSALAGRFYHEPSENMRLVAVTGTNGK
TTTTQLLAQWSQLLGETSAVMGTVGNGLLGKVIPTENTTGSAVDVQHVLASLVAQGVTFG
AMEVSSHGLVQHRVAALKFAASVFTNLSRDHLDYHGDMAHYEAAKWMLYSTHHHGQAIVN
ADDEVGRRWLASLPDAVAVSMEGHINPNCHGRWLKAEAVEYHDRGATIRFASSWGEGEIE
SRLMGAFNVSNLLLALATLLALGYPLTDLLKTAARLQPVCGRMEVFTAPGKPTVVVDYAH
TPDALEKALQAARLHCAGKLWCVFGCGGDRDKGKRPLMGAIAEEFADIVVVTDDNPRTEE
PRAIINDILAGMLDAGQVRVMEGRAEAVTNAIMQAKDNDVVLIAGKGHEDYQIVGTQRLD
YSDRVTAARLLGVIA
Download sequence
Identical sequences A0A0F6AWR5 A0A0W4HUU1
gi|378448423|ref|YP_005235782.1| WP_000775077.1.100484 WP_000775077.1.100488 WP_000775077.1.14852 WP_000775077.1.17307 WP_000775077.1.17480 WP_000775077.1.17705 WP_000775077.1.21603 WP_000775077.1.25988 WP_000775077.1.2763 WP_000775077.1.28170 WP_000775077.1.3119 WP_000775077.1.31578 WP_000775077.1.37073 WP_000775077.1.37978 WP_000775077.1.40240 WP_000775077.1.42864 WP_000775077.1.44099 WP_000775077.1.4467 WP_000775077.1.47472 WP_000775077.1.54033 WP_000775077.1.55768 WP_000775077.1.5886 WP_000775077.1.59490 WP_000775077.1.71378 WP_000775077.1.71702 WP_000775077.1.7315 WP_000775077.1.80137 WP_000775077.1.8354 WP_000775077.1.87095 WP_000775077.1.87552 WP_000775077.1.89570 WP_000775077.1.90453 WP_000775077.1.92443 WP_000775077.1.92531 WP_000775077.1.93994 WP_000775077.1.94584 WP_000775077.1.95051 WP_000775077.1.97145 WP_000775077.1.99712 CP001363|CDS_144191-145678

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]