SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378448424|ref|YP_005235783.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378448424|ref|YP_005235783.1|
Domain Number 1 Region: 100-310
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, catalytic domain 5.76e-58
Family MurCDEF 0.00000000792
Further Details:      
 
Domain Number 2 Region: 313-446
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, peptide-binding domain 1.01e-37
Family MurCDEF C-terminal domain 0.00000131
Further Details:      
 
Domain Number 3 Region: 1-95
Classification Level Classification E-value
Superfamily MurE/MurF N-terminal domain 7.32e-28
Family MurE/MurF N-terminal domain 0.00000645
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|378448424|ref|YP_005235783.1|
Sequence length 452
Comment UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D- alanine ligase [Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S]
Sequence
MISVTLSKIADVLGAEHRGADLTLDTVITDTRKVTPGCLFVALKGERFDAHDFADKAKAN
GAGALLVSRPLDIDLPQVIVKDTRQAFGQLAAWVRMQVPARVVALTGSSGKTSVKEMTAA
ILSQCGNTLYTAGNFNNDIGVPITLLRLNHDYDYAVIELGANHQGEIAWTVSLTRPEAAL
VNNLAAAHLEGFGSLAGVAKAKGEIYTGLPENGIAIMNADNNDWLNWQSIIGDRLVWRFS
PNAANSDFTAANIHVTSHGTEFTLQTPMGSIDVLLPLPGRHNIANALAAAALSMAVGATL
TAIKAGLAALKAVPGRLFPIQLSENQLVLDDAYNANVGSMTAAVQVLSEMPGYRVLVVGD
MAELGAESEACHLQVGEAAKAAGIDRVLSTGKLSQAISHASGVGEHFADKAALIARLHAL
LQEQPMMTILVKGSRSAAMEDVVHALQEKGSC
Download sequence
Identical sequences A0A0D6HHY7 A0A0F6AWR6 A0A0F7J319 A0A0H3N926 A0A0U1F735 A0A0W4UHM7 A0A1R3AVC0 A0A249V2M0 A0A2G1NIN2 A0A2H9YG68 E8XH35 G5RA91 M7SCS1 Q8ZRU6 S4JTB6
gi|526219077|ref|YP_008264383.1| 439851.SeD_A0133 550537.SEN0125 99287.STM0124 gi|549722849|ref|YP_008643039.1| NP_459129.1.58477 WP_000626630.1.100010 WP_000626630.1.100017 WP_000626630.1.100077 WP_000626630.1.100149 WP_000626630.1.100191 WP_000626630.1.100234 WP_000626630.1.100258 WP_000626630.1.100376 WP_000626630.1.100392 WP_000626630.1.100412 WP_000626630.1.100424 WP_000626630.1.100436 WP_000626630.1.100457 WP_000626630.1.100484 WP_000626630.1.100488 WP_000626630.1.100519 WP_000626630.1.100557 WP_000626630.1.100597 WP_000626630.1.100605 WP_000626630.1.10076 WP_000626630.1.100776 WP_000626630.1.100781 WP_000626630.1.100793 WP_000626630.1.10081 WP_000626630.1.100857 WP_000626630.1.100869 WP_000626630.1.100871 WP_000626630.1.100882 WP_000626630.1.100895 WP_000626630.1.101007 WP_000626630.1.101020 WP_000626630.1.101074 WP_000626630.1.101078 WP_000626630.1.101091 WP_000626630.1.101112 WP_000626630.1.101123 WP_000626630.1.101180 WP_000626630.1.101259 WP_000626630.1.101284 WP_000626630.1.101291 WP_000626630.1.101320 WP_000626630.1.101353 WP_000626630.1.101386 WP_000626630.1.101404 WP_000626630.1.101420 WP_000626630.1.101541 WP_000626630.1.101589 WP_000626630.1.101634 WP_000626630.1.101674 WP_000626630.1.101707 WP_000626630.1.101734 WP_000626630.1.101832 WP_000626630.1.101878 WP_000626630.1.101917 WP_000626630.1.101927 WP_000626630.1.101953 WP_000626630.1.102111 WP_000626630.1.10220 WP_000626630.1.10237 WP_000626630.1.10266 WP_000626630.1.10300 WP_000626630.1.10429 WP_000626630.1.10439 WP_000626630.1.10498 WP_000626630.1.10631 WP_000626630.1.10678 WP_000626630.1.10753 WP_000626630.1.10755 WP_000626630.1.10868 WP_000626630.1.10898 WP_000626630.1.10992 WP_000626630.1.11000 WP_000626630.1.11024 WP_000626630.1.11031 WP_000626630.1.11098 WP_000626630.1.11119 WP_000626630.1.11168 WP_000626630.1.11190 WP_000626630.1.11216 WP_000626630.1.11295 WP_000626630.1.11455 WP_000626630.1.11458 WP_000626630.1.1150 WP_000626630.1.11518 WP_000626630.1.11526 WP_000626630.1.11528 WP_000626630.1.11532 WP_000626630.1.11543 WP_000626630.1.1156 WP_000626630.1.1169 WP_000626630.1.1174 WP_000626630.1.11763 WP_000626630.1.11772 WP_000626630.1.11824 WP_000626630.1.11841 WP_000626630.1.11897 WP_000626630.1.11900 WP_000626630.1.11978 WP_000626630.1.12025 WP_000626630.1.12027 WP_000626630.1.12106 WP_000626630.1.12114 WP_000626630.1.1215 WP_000626630.1.12168 WP_000626630.1.12340 WP_000626630.1.12351 WP_000626630.1.12370 WP_000626630.1.12374 WP_000626630.1.1239 WP_000626630.1.12485 WP_000626630.1.12546 WP_000626630.1.12568 WP_000626630.1.12569 WP_000626630.1.1264 WP_000626630.1.12696 WP_000626630.1.12728 WP_000626630.1.12879 WP_000626630.1.12936 WP_000626630.1.12995 WP_000626630.1.1300 WP_000626630.1.13027 WP_000626630.1.13076 WP_000626630.1.13102 WP_000626630.1.13106 WP_000626630.1.13130 WP_000626630.1.13247 WP_000626630.1.13274 WP_000626630.1.13334 WP_000626630.1.13367 WP_000626630.1.13391 WP_000626630.1.13414 WP_000626630.1.1346 WP_000626630.1.13488 WP_000626630.1.13509 WP_000626630.1.13573 WP_000626630.1.13625 WP_000626630.1.13669 WP_000626630.1.13741 WP_000626630.1.1387 WP_000626630.1.13908 WP_000626630.1.13932 WP_000626630.1.13968 WP_000626630.1.14001 WP_000626630.1.1412 WP_000626630.1.14151 WP_000626630.1.14239 WP_000626630.1.14320 WP_000626630.1.14379 WP_000626630.1.14406 WP_000626630.1.14410 WP_000626630.1.14466 WP_000626630.1.14524 WP_000626630.1.14554 WP_000626630.1.146 WP_000626630.1.14708 WP_000626630.1.14725 WP_000626630.1.14793 WP_000626630.1.14819 WP_000626630.1.14852 WP_000626630.1.1489 WP_000626630.1.14913 WP_000626630.1.14932 WP_000626630.1.15046 WP_000626630.1.15055 WP_000626630.1.15067 WP_000626630.1.15079 WP_000626630.1.15124 WP_000626630.1.15214 WP_000626630.1.15223 WP_000626630.1.15226 WP_000626630.1.15276 WP_000626630.1.15316 WP_000626630.1.15318 WP_000626630.1.15369 WP_000626630.1.1540 WP_000626630.1.15508 WP_000626630.1.15585 WP_000626630.1.1568 WP_000626630.1.15775 WP_000626630.1.15777 WP_000626630.1.15784 WP_000626630.1.158 WP_000626630.1.15830 WP_000626630.1.15909 WP_000626630.1.16062 WP_000626630.1.16063 WP_000626630.1.16103 WP_000626630.1.16226 WP_000626630.1.16233 WP_000626630.1.16284 WP_000626630.1.16328 WP_000626630.1.1635 WP_000626630.1.16363 WP_000626630.1.16365 WP_000626630.1.16366 WP_000626630.1.16394 WP_000626630.1.16453 WP_000626630.1.16468 WP_000626630.1.16474 WP_000626630.1.16614 WP_000626630.1.16650 WP_000626630.1.16686 WP_000626630.1.16691 WP_000626630.1.167 WP_000626630.1.16729 WP_000626630.1.16732 WP_000626630.1.16735 WP_000626630.1.16786 WP_000626630.1.16858 WP_000626630.1.16896 WP_000626630.1.16949 WP_000626630.1.16965 WP_000626630.1.16972 WP_000626630.1.1700 WP_000626630.1.17060 WP_000626630.1.17096 WP_000626630.1.17098 WP_000626630.1.17105 WP_000626630.1.17307 WP_000626630.1.1733 WP_000626630.1.174 WP_000626630.1.17480 WP_000626630.1.17482 WP_000626630.1.17525 WP_000626630.1.17546 WP_000626630.1.17583 WP_000626630.1.17702 WP_000626630.1.17705 WP_000626630.1.17732 WP_000626630.1.17747 WP_000626630.1.17886 WP_000626630.1.17914 WP_000626630.1.17936 WP_000626630.1.18019 WP_000626630.1.18056 WP_000626630.1.18061 WP_000626630.1.18092 WP_000626630.1.18109 WP_000626630.1.18111 WP_000626630.1.18149 WP_000626630.1.18163 WP_000626630.1.18265 WP_000626630.1.18267 WP_000626630.1.18281 WP_000626630.1.18282 WP_000626630.1.18384 WP_000626630.1.18468 WP_000626630.1.18607 WP_000626630.1.18641 WP_000626630.1.18686 WP_000626630.1.18692 WP_000626630.1.18705 WP_000626630.1.18715 WP_000626630.1.18737 WP_000626630.1.18776 WP_000626630.1.18822 WP_000626630.1.18847 WP_000626630.1.18881 WP_000626630.1.18886 WP_000626630.1.18940 WP_000626630.1.18949 WP_000626630.1.1895 WP_000626630.1.19053 WP_000626630.1.19093 WP_000626630.1.19320 WP_000626630.1.19373 WP_000626630.1.19433 WP_000626630.1.19458 WP_000626630.1.19460 WP_000626630.1.19461 WP_000626630.1.1955 WP_000626630.1.19614 WP_000626630.1.19642 WP_000626630.1.19656 WP_000626630.1.19702 WP_000626630.1.19706 WP_000626630.1.19724 WP_000626630.1.19749 WP_000626630.1.19784 WP_000626630.1.19802 WP_000626630.1.19809 WP_000626630.1.19834 WP_000626630.1.19867 WP_000626630.1.1998 WP_000626630.1.20 WP_000626630.1.20086 WP_000626630.1.2010 WP_000626630.1.20212 WP_000626630.1.20261 WP_000626630.1.20266 WP_000626630.1.20271 WP_000626630.1.20330 WP_000626630.1.20362 WP_000626630.1.2041 WP_000626630.1.20418 WP_000626630.1.20437 WP_000626630.1.20443 WP_000626630.1.20525 WP_000626630.1.2054 WP_000626630.1.20553 WP_000626630.1.20626 WP_000626630.1.20646 WP_000626630.1.20767 WP_000626630.1.20886 WP_000626630.1.20908 WP_000626630.1.21049 WP_000626630.1.21079 WP_000626630.1.21103 WP_000626630.1.21146 WP_000626630.1.2116 WP_000626630.1.21194 WP_000626630.1.21202 WP_000626630.1.21241 WP_000626630.1.21245 WP_000626630.1.21246 WP_000626630.1.21269 WP_000626630.1.21332 WP_000626630.1.21400 WP_000626630.1.21497 WP_000626630.1.21499 WP_000626630.1.21548 WP_000626630.1.21603 WP_000626630.1.21616 WP_000626630.1.21681 WP_000626630.1.21715 WP_000626630.1.21751 WP_000626630.1.21757 WP_000626630.1.21909 WP_000626630.1.21950 WP_000626630.1.22024 WP_000626630.1.2205 WP_000626630.1.22051 WP_000626630.1.22062 WP_000626630.1.22067 WP_000626630.1.22096 WP_000626630.1.22136 WP_000626630.1.22158 WP_000626630.1.22162 WP_000626630.1.2221 WP_000626630.1.22296 WP_000626630.1.22346 WP_000626630.1.2235 WP_000626630.1.22379 WP_000626630.1.22427 WP_000626630.1.22449 WP_000626630.1.22454 WP_000626630.1.2246 WP_000626630.1.22460 WP_000626630.1.22485 WP_000626630.1.22537 WP_000626630.1.22590 WP_000626630.1.22595 WP_000626630.1.22605 WP_000626630.1.22620 WP_000626630.1.22760 WP_000626630.1.22857 WP_000626630.1.22870 WP_000626630.1.22880 WP_000626630.1.22902 WP_000626630.1.22947 WP_000626630.1.22979 WP_000626630.1.23102 WP_000626630.1.23114 WP_000626630.1.2314 WP_000626630.1.23155 WP_000626630.1.23192 WP_000626630.1.2324 WP_000626630.1.23259 WP_000626630.1.23329 WP_000626630.1.23442 WP_000626630.1.23460 WP_000626630.1.23472 WP_000626630.1.23482 WP_000626630.1.2358 WP_000626630.1.23631 WP_000626630.1.23634 WP_000626630.1.2364 WP_000626630.1.23746 WP_000626630.1.23932 WP_000626630.1.24017 WP_000626630.1.24145 WP_000626630.1.24206 WP_000626630.1.24214 WP_000626630.1.24250 WP_000626630.1.24297 WP_000626630.1.24308 WP_000626630.1.24361 WP_000626630.1.24408 WP_000626630.1.24409 WP_000626630.1.24476 WP_000626630.1.24494 WP_000626630.1.24578 WP_000626630.1.24673 WP_000626630.1.24737 WP_000626630.1.24779 WP_000626630.1.24803 WP_000626630.1.24901 WP_000626630.1.24944 WP_000626630.1.25008 WP_000626630.1.25015 WP_000626630.1.25159 WP_000626630.1.25175 WP_000626630.1.25206 WP_000626630.1.25354 WP_000626630.1.25405 WP_000626630.1.25421 WP_000626630.1.25426 WP_000626630.1.25454 WP_000626630.1.25493 WP_000626630.1.25618 WP_000626630.1.25668 WP_000626630.1.2568 WP_000626630.1.25690 WP_000626630.1.2570 WP_000626630.1.25709 WP_000626630.1.25740 WP_000626630.1.25780 WP_000626630.1.25793 WP_000626630.1.25814 WP_000626630.1.25951 WP_000626630.1.25988 WP_000626630.1.26083 WP_000626630.1.26194 WP_000626630.1.26282 WP_000626630.1.26311 WP_000626630.1.26319 WP_000626630.1.26429 WP_000626630.1.26440 WP_000626630.1.26441 WP_000626630.1.26493 WP_000626630.1.26532 WP_000626630.1.26551 WP_000626630.1.26567 WP_000626630.1.26582 WP_000626630.1.26587 WP_000626630.1.26687 WP_000626630.1.2672 WP_000626630.1.26794 WP_000626630.1.26936 WP_000626630.1.27010 WP_000626630.1.27173 WP_000626630.1.27206 WP_000626630.1.27272 WP_000626630.1.27314 WP_000626630.1.27383 WP_000626630.1.27423 WP_000626630.1.27522 WP_000626630.1.27547 WP_000626630.1.27561 WP_000626630.1.2763 WP_000626630.1.27632 WP_000626630.1.27638 WP_000626630.1.27658 WP_000626630.1.27665 WP_000626630.1.27707 WP_000626630.1.27761 WP_000626630.1.2777 WP_000626630.1.27800 WP_000626630.1.27833 WP_000626630.1.27857 WP_000626630.1.27883 WP_000626630.1.27977 WP_000626630.1.27995 WP_000626630.1.28037 WP_000626630.1.28056 WP_000626630.1.28094 WP_000626630.1.28126 WP_000626630.1.28139 WP_000626630.1.28170 WP_000626630.1.28200 WP_000626630.1.28232 WP_000626630.1.28233 WP_000626630.1.28302 WP_000626630.1.28303 WP_000626630.1.2835 WP_000626630.1.28370 WP_000626630.1.28462 WP_000626630.1.2853 WP_000626630.1.28538 WP_000626630.1.28570 WP_000626630.1.28575 WP_000626630.1.28620 WP_000626630.1.28625 WP_000626630.1.28655 WP_000626630.1.28694 WP_000626630.1.28773 WP_000626630.1.2879 WP_000626630.1.2890 WP_000626630.1.28938 WP_000626630.1.28946 WP_000626630.1.29006 WP_000626630.1.29010 WP_000626630.1.2910 WP_000626630.1.29168 WP_000626630.1.29218 WP_000626630.1.2924 WP_000626630.1.29274 WP_000626630.1.2932 WP_000626630.1.29379 WP_000626630.1.29422 WP_000626630.1.29436 WP_000626630.1.29576 WP_000626630.1.29588 WP_000626630.1.29601 WP_000626630.1.29606 WP_000626630.1.29615 WP_000626630.1.29619 WP_000626630.1.29969 WP_000626630.1.30006 WP_000626630.1.30027 WP_000626630.1.3005 WP_000626630.1.30059 WP_000626630.1.30165 WP_000626630.1.30180 WP_000626630.1.30210 WP_000626630.1.30278 WP_000626630.1.30356 WP_000626630.1.30469 WP_000626630.1.30492 WP_000626630.1.30505 WP_000626630.1.30507 WP_000626630.1.30535 WP_000626630.1.30547 WP_000626630.1.30548 WP_000626630.1.30589 WP_000626630.1.30627 WP_000626630.1.3067 WP_000626630.1.30752 WP_000626630.1.30794 WP_000626630.1.30833 WP_000626630.1.30835 WP_000626630.1.30968 WP_000626630.1.30972 WP_000626630.1.31 WP_000626630.1.3113 WP_000626630.1.31167 WP_000626630.1.31171 WP_000626630.1.31185 WP_000626630.1.3119 WP_000626630.1.31190 WP_000626630.1.31195 WP_000626630.1.31196 WP_000626630.1.31219 WP_000626630.1.31272 WP_000626630.1.31281 WP_000626630.1.31335 WP_000626630.1.31362 WP_000626630.1.31435 WP_000626630.1.31504 WP_000626630.1.31515 WP_000626630.1.31578 WP_000626630.1.31585 WP_000626630.1.31658 WP_000626630.1.3167 WP_000626630.1.31895 WP_000626630.1.31901 WP_000626630.1.31940 WP_000626630.1.31967 WP_000626630.1.31972 WP_000626630.1.31983 WP_000626630.1.32109 WP_000626630.1.32116 WP_000626630.1.32192 WP_000626630.1.32206 WP_000626630.1.32252 WP_000626630.1.32274 WP_000626630.1.32309 WP_000626630.1.32438 WP_000626630.1.32515 WP_000626630.1.32519 WP_000626630.1.32527 WP_000626630.1.32660 WP_000626630.1.32668 WP_000626630.1.32702 WP_000626630.1.32714 WP_000626630.1.32740 WP_000626630.1.32786 WP_000626630.1.32804 WP_000626630.1.32832 WP_000626630.1.32860 WP_000626630.1.32881 WP_000626630.1.32899 WP_000626630.1.32907 WP_000626630.1.32977 WP_000626630.1.33030 WP_000626630.1.33127 WP_000626630.1.33143 WP_000626630.1.33248 WP_000626630.1.33253 WP_000626630.1.33261 WP_000626630.1.33270 WP_000626630.1.333 WP_000626630.1.33409 WP_000626630.1.33492 WP_000626630.1.33499 WP_000626630.1.335 WP_000626630.1.33553 WP_000626630.1.3356 WP_000626630.1.33586 WP_000626630.1.33592 WP_000626630.1.3364 WP_000626630.1.33865 WP_000626630.1.33894 WP_000626630.1.3396 WP_000626630.1.34 WP_000626630.1.34043 WP_000626630.1.34075 WP_000626630.1.34091 WP_000626630.1.34185 WP_000626630.1.34257 WP_000626630.1.34259 WP_000626630.1.34279 WP_000626630.1.34292 WP_000626630.1.34319 WP_000626630.1.3438 WP_000626630.1.34431 WP_000626630.1.34453 WP_000626630.1.34454 WP_000626630.1.34610 WP_000626630.1.34614 WP_000626630.1.34684 WP_000626630.1.34711 WP_000626630.1.34820 WP_000626630.1.34856 WP_000626630.1.34975 WP_000626630.1.34977 WP_000626630.1.35045 WP_000626630.1.35129 WP_000626630.1.35184 WP_000626630.1.35298 WP_000626630.1.35321 WP_000626630.1.35332 WP_000626630.1.35404 WP_000626630.1.35408 WP_000626630.1.35425 WP_000626630.1.35429 WP_000626630.1.35446 WP_000626630.1.35463 WP_000626630.1.35503 WP_000626630.1.35509 WP_000626630.1.35563 WP_000626630.1.35570 WP_000626630.1.35590 WP_000626630.1.35594 WP_000626630.1.35619 WP_000626630.1.35624 WP_000626630.1.3572 WP_000626630.1.35887 WP_000626630.1.35936 WP_000626630.1.35940 WP_000626630.1.35961 WP_000626630.1.36003 WP_000626630.1.3601 WP_000626630.1.36037 WP_000626630.1.36063 WP_000626630.1.36409 WP_000626630.1.36445 WP_000626630.1.36584 WP_000626630.1.36609 WP_000626630.1.36685 WP_000626630.1.36690 WP_000626630.1.3670 WP_000626630.1.36705 WP_000626630.1.36721 WP_000626630.1.36764 WP_000626630.1.36889 WP_000626630.1.36918 WP_000626630.1.36931 WP_000626630.1.37029 WP_000626630.1.37063 WP_000626630.1.37073 WP_000626630.1.37111 WP_000626630.1.37112 WP_000626630.1.37114 WP_000626630.1.37191 WP_000626630.1.37256 WP_000626630.1.3726 WP_000626630.1.37293 WP_000626630.1.37297 WP_000626630.1.37370 WP_000626630.1.37376 WP_000626630.1.37405 WP_000626630.1.3744 WP_000626630.1.3748 WP_000626630.1.37498 WP_000626630.1.37504 WP_000626630.1.37618 WP_000626630.1.3771 WP_000626630.1.3778 WP_000626630.1.37864 WP_000626630.1.3790 WP_000626630.1.37968 WP_000626630.1.37978 WP_000626630.1.38026 WP_000626630.1.38037 WP_000626630.1.38047 WP_000626630.1.38125 WP_000626630.1.38145 WP_000626630.1.383 WP_000626630.1.38344 WP_000626630.1.3848 WP_000626630.1.38613 WP_000626630.1.38673 WP_000626630.1.3869 WP_000626630.1.38693 WP_000626630.1.38773 WP_000626630.1.38882 WP_000626630.1.38913 WP_000626630.1.39003 WP_000626630.1.39048 WP_000626630.1.39055 WP_000626630.1.39065 WP_000626630.1.39136 WP_000626630.1.39197 WP_000626630.1.39229 WP_000626630.1.39312 WP_000626630.1.39395 WP_000626630.1.39405 WP_000626630.1.39414 WP_000626630.1.39420 WP_000626630.1.39449 WP_000626630.1.39512 WP_000626630.1.39556 WP_000626630.1.39576 WP_000626630.1.39614 WP_000626630.1.39629 WP_000626630.1.39763 WP_000626630.1.39862 WP_000626630.1.39921 WP_000626630.1.39923 WP_000626630.1.40017 WP_000626630.1.40072 WP_000626630.1.40073 WP_000626630.1.40081 WP_000626630.1.4011 WP_000626630.1.40158 WP_000626630.1.40208 WP_000626630.1.40224 WP_000626630.1.40240 WP_000626630.1.40257 WP_000626630.1.40284 WP_000626630.1.40292 WP_000626630.1.40305 WP_000626630.1.40307 WP_000626630.1.40311 WP_000626630.1.40380 WP_000626630.1.40395 WP_000626630.1.40465 WP_000626630.1.40493 WP_000626630.1.40508 WP_000626630.1.40533 WP_000626630.1.40577 WP_000626630.1.40622 WP_000626630.1.40648 WP_000626630.1.40695 WP_000626630.1.40710 WP_000626630.1.40745 WP_000626630.1.4075 WP_000626630.1.40849 WP_000626630.1.4087 WP_000626630.1.40877 WP_000626630.1.40930 WP_000626630.1.40973 WP_000626630.1.41017 WP_000626630.1.41086 WP_000626630.1.41091 WP_000626630.1.41116 WP_000626630.1.41128 WP_000626630.1.41192 WP_000626630.1.41226 WP_000626630.1.41277 WP_000626630.1.41279 WP_000626630.1.4141 WP_000626630.1.41427 WP_000626630.1.41434 WP_000626630.1.41516 WP_000626630.1.41528 WP_000626630.1.41554 WP_000626630.1.41572 WP_000626630.1.41591 WP_000626630.1.41610 WP_000626630.1.41662 WP_000626630.1.41688 WP_000626630.1.41690 WP_000626630.1.41708 WP_000626630.1.41761 WP_000626630.1.41799 WP_000626630.1.41859 WP_000626630.1.41882 WP_000626630.1.41911 WP_000626630.1.41949 WP_000626630.1.41978 WP_000626630.1.41979 WP_000626630.1.41985 WP_000626630.1.42104 WP_000626630.1.42136 WP_000626630.1.422 WP_000626630.1.42248 WP_000626630.1.42263 WP_000626630.1.42320 WP_000626630.1.42322 WP_000626630.1.42342 WP_000626630.1.42392 WP_000626630.1.42422 WP_000626630.1.42605 WP_000626630.1.42666 WP_000626630.1.42675 WP_000626630.1.42683 WP_000626630.1.42734 WP_000626630.1.4276 WP_000626630.1.42864 WP_000626630.1.4288 WP_000626630.1.42892 WP_000626630.1.42923 WP_000626630.1.42932 WP_000626630.1.43018 WP_000626630.1.43041 WP_000626630.1.43201 WP_000626630.1.43244 WP_000626630.1.43312 WP_000626630.1.43334 WP_000626630.1.43351 WP_000626630.1.43437 WP_000626630.1.4344 WP_000626630.1.43522 WP_000626630.1.43613 WP_000626630.1.43668 WP_000626630.1.43685 WP_000626630.1.43711 WP_000626630.1.43785 WP_000626630.1.43886 WP_000626630.1.44005 WP_000626630.1.44010 WP_000626630.1.44043 WP_000626630.1.44099 WP_000626630.1.44121 WP_000626630.1.44291 WP_000626630.1.44310 WP_000626630.1.44337 WP_000626630.1.44386 WP_000626630.1.44397 WP_000626630.1.44443 WP_000626630.1.44474 WP_000626630.1.44479 WP_000626630.1.44633 WP_000626630.1.44640 WP_000626630.1.4467 WP_000626630.1.44678 WP_000626630.1.44705 WP_000626630.1.44747 WP_000626630.1.44781 WP_000626630.1.44831 WP_000626630.1.44833 WP_000626630.1.4485 WP_000626630.1.44877 WP_000626630.1.44927 WP_000626630.1.44950 WP_000626630.1.44966 WP_000626630.1.44971 WP_000626630.1.44978 WP_000626630.1.44997 WP_000626630.1.4500 WP_000626630.1.45067 WP_000626630.1.45074 WP_000626630.1.45079 WP_000626630.1.45098 WP_000626630.1.45173 WP_000626630.1.45177 WP_000626630.1.45184 WP_000626630.1.45259 WP_000626630.1.45302 WP_000626630.1.4531 WP_000626630.1.45344 WP_000626630.1.45349 WP_000626630.1.45365 WP_000626630.1.45432 WP_000626630.1.45549 WP_000626630.1.45550 WP_000626630.1.45569 WP_000626630.1.45571 WP_000626630.1.45583 WP_000626630.1.45585 WP_000626630.1.45660 WP_000626630.1.45690 WP_000626630.1.45797 WP_000626630.1.458 WP_000626630.1.45844 WP_000626630.1.45906 WP_000626630.1.45918 WP_000626630.1.4592 WP_000626630.1.46011 WP_000626630.1.46069 WP_000626630.1.46112 WP_000626630.1.46173 WP_000626630.1.46174 WP_000626630.1.46187 WP_000626630.1.46215 WP_000626630.1.46303 WP_000626630.1.46406 WP_000626630.1.46444 WP_000626630.1.46578 WP_000626630.1.46595 WP_000626630.1.46675 WP_000626630.1.4671 WP_000626630.1.46726 WP_000626630.1.4674 WP_000626630.1.4686 WP_000626630.1.46930 WP_000626630.1.46967 WP_000626630.1.46976 WP_000626630.1.47057 WP_000626630.1.47214 WP_000626630.1.47429 WP_000626630.1.47448 WP_000626630.1.4747 WP_000626630.1.47472 WP_000626630.1.47478 WP_000626630.1.47507 WP_000626630.1.47567 WP_000626630.1.47576 WP_000626630.1.4758 WP_000626630.1.47799 WP_000626630.1.47829 WP_000626630.1.47850 WP_000626630.1.47875 WP_000626630.1.47911 WP_000626630.1.47928 WP_000626630.1.4795 WP_000626630.1.47988 WP_000626630.1.48242 WP_000626630.1.48253 WP_000626630.1.48268 WP_000626630.1.483 WP_000626630.1.48367 WP_000626630.1.48377 WP_000626630.1.4839 WP_000626630.1.48493 WP_000626630.1.4853 WP_000626630.1.48788 WP_000626630.1.48797 WP_000626630.1.4885 WP_000626630.1.48894 WP_000626630.1.48919 WP_000626630.1.49084 WP_000626630.1.49155 WP_000626630.1.49204 WP_000626630.1.49239 WP_000626630.1.49256 WP_000626630.1.49290 WP_000626630.1.49309 WP_000626630.1.49311 WP_000626630.1.49334 WP_000626630.1.49340 WP_000626630.1.49366 WP_000626630.1.49490 WP_000626630.1.49515 WP_000626630.1.49572 WP_000626630.1.49770 WP_000626630.1.4979 WP_000626630.1.49803 WP_000626630.1.49805 WP_000626630.1.49929 WP_000626630.1.50003 WP_000626630.1.50080 WP_000626630.1.50128 WP_000626630.1.50161 WP_000626630.1.50211 WP_000626630.1.50332 WP_000626630.1.50376 WP_000626630.1.50389 WP_000626630.1.50449 WP_000626630.1.50652 WP_000626630.1.50676 WP_000626630.1.50684 WP_000626630.1.50774 WP_000626630.1.50804 WP_000626630.1.50808 WP_000626630.1.5088 WP_000626630.1.50882 WP_000626630.1.50905 WP_000626630.1.50908 WP_000626630.1.50941 WP_000626630.1.50960 WP_000626630.1.51014 WP_000626630.1.51022 WP_000626630.1.51179 WP_000626630.1.51182 WP_000626630.1.51186 WP_000626630.1.51308 WP_000626630.1.51356 WP_000626630.1.51412 WP_000626630.1.51451 WP_000626630.1.51487 WP_000626630.1.51488 WP_000626630.1.51502 WP_000626630.1.51514 WP_000626630.1.51555 WP_000626630.1.51634 WP_000626630.1.51642 WP_000626630.1.51649 WP_000626630.1.51686 WP_000626630.1.51756 WP_000626630.1.51764 WP_000626630.1.51810 WP_000626630.1.51868 WP_000626630.1.51911 WP_000626630.1.51930 WP_000626630.1.51932 WP_000626630.1.51989 WP_000626630.1.51994 WP_000626630.1.520 WP_000626630.1.5211 WP_000626630.1.52121 WP_000626630.1.52148 WP_000626630.1.52301 WP_000626630.1.52321 WP_000626630.1.52346 WP_000626630.1.52353 WP_000626630.1.52361 WP_000626630.1.52528 WP_000626630.1.52582 WP_000626630.1.52586 WP_000626630.1.52653 WP_000626630.1.52656 WP_000626630.1.52743 WP_000626630.1.52833 WP_000626630.1.52857 WP_000626630.1.52898 WP_000626630.1.52915 WP_000626630.1.53107 WP_000626630.1.53119 WP_000626630.1.5313 WP_000626630.1.53190 WP_000626630.1.53198 WP_000626630.1.53234 WP_000626630.1.53362 WP_000626630.1.53385 WP_000626630.1.53406 WP_000626630.1.53436 WP_000626630.1.53466 WP_000626630.1.53529 WP_000626630.1.53534 WP_000626630.1.53543 WP_000626630.1.53567 WP_000626630.1.53664 WP_000626630.1.53757 WP_000626630.1.53778 WP_000626630.1.53781 WP_000626630.1.53812 WP_000626630.1.53896 WP_000626630.1.54033 WP_000626630.1.54075 WP_000626630.1.54196 WP_000626630.1.542 WP_000626630.1.54209 WP_000626630.1.54271 WP_000626630.1.54273 WP_000626630.1.54274 WP_000626630.1.54283 WP_000626630.1.54319 WP_000626630.1.54364 WP_000626630.1.54366 WP_000626630.1.54400 WP_000626630.1.54469 WP_000626630.1.54615 WP_000626630.1.54644 WP_000626630.1.54662 WP_000626630.1.54722 WP_000626630.1.54749 WP_000626630.1.54764 WP_000626630.1.54833 WP_000626630.1.54877 WP_000626630.1.54936 WP_000626630.1.55008 WP_000626630.1.55152 WP_000626630.1.55156 WP_000626630.1.55285 WP_000626630.1.55475 WP_000626630.1.55545 WP_000626630.1.55559 WP_000626630.1.55640 WP_000626630.1.55647 WP_000626630.1.5572 WP_000626630.1.55743 WP_000626630.1.55768 WP_000626630.1.5577 WP_000626630.1.55782 WP_000626630.1.55796 WP_000626630.1.55853 WP_000626630.1.55923 WP_000626630.1.55948 WP_000626630.1.55993 WP_000626630.1.56002 WP_000626630.1.56012 WP_000626630.1.56105 WP_000626630.1.56235 WP_000626630.1.56238 WP_000626630.1.56263 WP_000626630.1.56286 WP_000626630.1.56304 WP_000626630.1.56414 WP_000626630.1.56438 WP_000626630.1.56560 WP_000626630.1.56597 WP_000626630.1.56601 WP_000626630.1.56614 WP_000626630.1.56671 WP_000626630.1.5668 WP_000626630.1.56682 WP_000626630.1.56851 WP_000626630.1.56861 WP_000626630.1.56875 WP_000626630.1.56877 WP_000626630.1.56898 WP_000626630.1.56905 WP_000626630.1.56950 WP_000626630.1.57026 WP_000626630.1.57039 WP_000626630.1.57056 WP_000626630.1.5711 WP_000626630.1.57143 WP_000626630.1.57168 WP_000626630.1.57187 WP_000626630.1.57232 WP_000626630.1.57246 WP_000626630.1.57296 WP_000626630.1.57362 WP_000626630.1.57377 WP_000626630.1.57418 WP_000626630.1.57433 WP_000626630.1.57515 WP_000626630.1.57529 WP_000626630.1.57559 WP_000626630.1.57576 WP_000626630.1.57601 WP_000626630.1.57607 WP_000626630.1.57631 WP_000626630.1.57763 WP_000626630.1.57835 WP_000626630.1.57862 WP_000626630.1.57890 WP_000626630.1.57891 WP_000626630.1.57893 WP_000626630.1.57978 WP_000626630.1.5801 WP_000626630.1.58041 WP_000626630.1.58090 WP_000626630.1.5828 WP_000626630.1.58290 WP_000626630.1.58418 WP_000626630.1.58443 WP_000626630.1.58486 WP_000626630.1.58489 WP_000626630.1.5854 WP_000626630.1.58548 WP_000626630.1.5858 WP_000626630.1.58662 WP_000626630.1.58669 WP_000626630.1.58675 WP_000626630.1.587 WP_000626630.1.58745 WP_000626630.1.58749 WP_000626630.1.58803 WP_000626630.1.5886 WP_000626630.1.58884 WP_000626630.1.58926 WP_000626630.1.59094 WP_000626630.1.59142 WP_000626630.1.59163 WP_000626630.1.59224 WP_000626630.1.59294 WP_000626630.1.59335 WP_000626630.1.59375 WP_000626630.1.59427 WP_000626630.1.59458 WP_000626630.1.59490 WP_000626630.1.59508 WP_000626630.1.5953 WP_000626630.1.59538 WP_000626630.1.59548 WP_000626630.1.59646 WP_000626630.1.59684 WP_000626630.1.59694 WP_000626630.1.59771 WP_000626630.1.5979 WP_000626630.1.59848 WP_000626630.1.59953 WP_000626630.1.60008 WP_000626630.1.60015 WP_000626630.1.60021 WP_000626630.1.60052 WP_000626630.1.60069 WP_000626630.1.60126 WP_000626630.1.60137 WP_000626630.1.60140 WP_000626630.1.60155 WP_000626630.1.60285 WP_000626630.1.60320 WP_000626630.1.6033 WP_000626630.1.60379 WP_000626630.1.60425 WP_000626630.1.60464 WP_000626630.1.60560 WP_000626630.1.60713 WP_000626630.1.608 WP_000626630.1.60866 WP_000626630.1.60874 WP_000626630.1.60897 WP_000626630.1.60941 WP_000626630.1.61078 WP_000626630.1.6114 WP_000626630.1.61232 WP_000626630.1.6129 WP_000626630.1.61296 WP_000626630.1.61345 WP_000626630.1.61356 WP_000626630.1.61381 WP_000626630.1.61417 WP_000626630.1.61501 WP_000626630.1.61574 WP_000626630.1.61594 WP_000626630.1.61595 WP_000626630.1.61609 WP_000626630.1.61671 WP_000626630.1.61712 WP_000626630.1.61714 WP_000626630.1.61730 WP_000626630.1.61857 WP_000626630.1.61908 WP_000626630.1.61918 WP_000626630.1.61952 WP_000626630.1.62007 WP_000626630.1.62025 WP_000626630.1.62158 WP_000626630.1.62201 WP_000626630.1.62204 WP_000626630.1.62210 WP_000626630.1.62245 WP_000626630.1.62304 WP_000626630.1.62364 WP_000626630.1.62374 WP_000626630.1.62403 WP_000626630.1.62412 WP_000626630.1.6253 WP_000626630.1.62570 WP_000626630.1.627 WP_000626630.1.62745 WP_000626630.1.62757 WP_000626630.1.62853 WP_000626630.1.62903 WP_000626630.1.62910 WP_000626630.1.6292 WP_000626630.1.62955 WP_000626630.1.62983 WP_000626630.1.62988 WP_000626630.1.63045 WP_000626630.1.63063 WP_000626630.1.63102 WP_000626630.1.63181 WP_000626630.1.63203 WP_000626630.1.63229 WP_000626630.1.63256 WP_000626630.1.63290 WP_000626630.1.63358 WP_000626630.1.63382 WP_000626630.1.63432 WP_000626630.1.63461 WP_000626630.1.63479 WP_000626630.1.63497 WP_000626630.1.63509 WP_000626630.1.63529 WP_000626630.1.63577 WP_000626630.1.63585 WP_000626630.1.63603 WP_000626630.1.63664 WP_000626630.1.6370 WP_000626630.1.63718 WP_000626630.1.63748 WP_000626630.1.6375 WP_000626630.1.63757 WP_000626630.1.63831 WP_000626630.1.63834 WP_000626630.1.63851 WP_000626630.1.63863 WP_000626630.1.64010 WP_000626630.1.64046 WP_000626630.1.64085 WP_000626630.1.64121 WP_000626630.1.64157 WP_000626630.1.64229 WP_000626630.1.6423 WP_000626630.1.64244 WP_000626630.1.64266 WP_000626630.1.64350 WP_000626630.1.6437 WP_000626630.1.64385 WP_000626630.1.64403 WP_000626630.1.64462 WP_000626630.1.64500 WP_000626630.1.64569 WP_000626630.1.64597 WP_000626630.1.64649 WP_000626630.1.64702 WP_000626630.1.64711 WP_000626630.1.64757 WP_000626630.1.64781 WP_000626630.1.64831 WP_000626630.1.6489 WP_000626630.1.65011 WP_000626630.1.65018 WP_000626630.1.65028 WP_000626630.1.65171 WP_000626630.1.65248 WP_000626630.1.6535 WP_000626630.1.65357 WP_000626630.1.65474 WP_000626630.1.65572 WP_000626630.1.65601 WP_000626630.1.65633 WP_000626630.1.6565 WP_000626630.1.65696 WP_000626630.1.65698 WP_000626630.1.6572 WP_000626630.1.6575 WP_000626630.1.65771 WP_000626630.1.65782 WP_000626630.1.65795 WP_000626630.1.65881 WP_000626630.1.65883 WP_000626630.1.65901 WP_000626630.1.6595 WP_000626630.1.66122 WP_000626630.1.66171 WP_000626630.1.66289 WP_000626630.1.6630 WP_000626630.1.66314 WP_000626630.1.66315 WP_000626630.1.66358 WP_000626630.1.66362 WP_000626630.1.6638 WP_000626630.1.66385 WP_000626630.1.6640 WP_000626630.1.66400 WP_000626630.1.66428 WP_000626630.1.66446 WP_000626630.1.66539 WP_000626630.1.66600 WP_000626630.1.66698 WP_000626630.1.66733 WP_000626630.1.6680 WP_000626630.1.66834 WP_000626630.1.66901 WP_000626630.1.66937 WP_000626630.1.66959 WP_000626630.1.66962 WP_000626630.1.67037 WP_000626630.1.67045 WP_000626630.1.67075 WP_000626630.1.6710 WP_000626630.1.67173 WP_000626630.1.67181 WP_000626630.1.67268 WP_000626630.1.67279 WP_000626630.1.67347 WP_000626630.1.67465 WP_000626630.1.67552 WP_000626630.1.6760 WP_000626630.1.67682 WP_000626630.1.6782 WP_000626630.1.67829 WP_000626630.1.67887 WP_000626630.1.67924 WP_000626630.1.67932 WP_000626630.1.68073 WP_000626630.1.68140 WP_000626630.1.68159 WP_000626630.1.68201 WP_000626630.1.68206 WP_000626630.1.6827 WP_000626630.1.68275 WP_000626630.1.6849 WP_000626630.1.68547 WP_000626630.1.68589 WP_000626630.1.68652 WP_000626630.1.68655 WP_000626630.1.68656 WP_000626630.1.68677 WP_000626630.1.6869 WP_000626630.1.68778 WP_000626630.1.68787 WP_000626630.1.6882 WP_000626630.1.68893 WP_000626630.1.68894 WP_000626630.1.68895 WP_000626630.1.68928 WP_000626630.1.68975 WP_000626630.1.69006 WP_000626630.1.69080 WP_000626630.1.69086 WP_000626630.1.6913 WP_000626630.1.69131 WP_000626630.1.69146 WP_000626630.1.69236 WP_000626630.1.69255 WP_000626630.1.69273 WP_000626630.1.69357 WP_000626630.1.69397 WP_000626630.1.69485 WP_000626630.1.69564 WP_000626630.1.69575 WP_000626630.1.69616 WP_000626630.1.69644 WP_000626630.1.69704 WP_000626630.1.69754 WP_000626630.1.69767 WP_000626630.1.69965 WP_000626630.1.70088 WP_000626630.1.7021 WP_000626630.1.70241 WP_000626630.1.70269 WP_000626630.1.70272 WP_000626630.1.70289 WP_000626630.1.70303 WP_000626630.1.70440 WP_000626630.1.70447 WP_000626630.1.70485 WP_000626630.1.70531 WP_000626630.1.70596 WP_000626630.1.70643 WP_000626630.1.70678 WP_000626630.1.70683 WP_000626630.1.70785 WP_000626630.1.70837 WP_000626630.1.70883 WP_000626630.1.70922 WP_000626630.1.70929 WP_000626630.1.70948 WP_000626630.1.70977 WP_000626630.1.70985 WP_000626630.1.71116 WP_000626630.1.71146 WP_000626630.1.71165 WP_000626630.1.71172 WP_000626630.1.71184 WP_000626630.1.71188 WP_000626630.1.71201 WP_000626630.1.71202 WP_000626630.1.71243 WP_000626630.1.71305 WP_000626630.1.71306 WP_000626630.1.71337 WP_000626630.1.71378 WP_000626630.1.71401 WP_000626630.1.71481 WP_000626630.1.71600 WP_000626630.1.71626 WP_000626630.1.71649 WP_000626630.1.71691 WP_000626630.1.71702 WP_000626630.1.71750 WP_000626630.1.71845 WP_000626630.1.71881 WP_000626630.1.71908 WP_000626630.1.71952 WP_000626630.1.71973 WP_000626630.1.71979 WP_000626630.1.71984 WP_000626630.1.720 WP_000626630.1.72065 WP_000626630.1.72100 WP_000626630.1.72105 WP_000626630.1.72182 WP_000626630.1.72190 WP_000626630.1.72203 WP_000626630.1.72221 WP_000626630.1.72300 WP_000626630.1.72325 WP_000626630.1.72339 WP_000626630.1.72372 WP_000626630.1.72376 WP_000626630.1.72382 WP_000626630.1.72470 WP_000626630.1.72532 WP_000626630.1.72594 WP_000626630.1.72602 WP_000626630.1.72625 WP_000626630.1.72716 WP_000626630.1.72718 WP_000626630.1.72827 WP_000626630.1.72865 WP_000626630.1.72871 WP_000626630.1.72872 WP_000626630.1.7295 WP_000626630.1.72975 WP_000626630.1.73068 WP_000626630.1.7315 WP_000626630.1.73200 WP_000626630.1.7334 WP_000626630.1.73377 WP_000626630.1.73481 WP_000626630.1.7356 WP_000626630.1.73561 WP_000626630.1.73581 WP_000626630.1.73617 WP_000626630.1.73667 WP_000626630.1.73708 WP_000626630.1.73753 WP_000626630.1.73758 WP_000626630.1.73764 WP_000626630.1.73794 WP_000626630.1.7387 WP_000626630.1.73924 WP_000626630.1.73926 WP_000626630.1.73945 WP_000626630.1.74029 WP_000626630.1.74117 WP_000626630.1.74174 WP_000626630.1.74181 WP_000626630.1.74191 WP_000626630.1.74207 WP_000626630.1.74248 WP_000626630.1.743 WP_000626630.1.74300 WP_000626630.1.7433 WP_000626630.1.74379 WP_000626630.1.74410 WP_000626630.1.74466 WP_000626630.1.74529 WP_000626630.1.74545 WP_000626630.1.74578 WP_000626630.1.74745 WP_000626630.1.74972 WP_000626630.1.74992 WP_000626630.1.75051 WP_000626630.1.75056 WP_000626630.1.75129 WP_000626630.1.75148 WP_000626630.1.75159 WP_000626630.1.75187 WP_000626630.1.75288 WP_000626630.1.75334 WP_000626630.1.75362 WP_000626630.1.75385 WP_000626630.1.75392 WP_000626630.1.75400 WP_000626630.1.75450 WP_000626630.1.7558 WP_000626630.1.75607 WP_000626630.1.75716 WP_000626630.1.75751 WP_000626630.1.75760 WP_000626630.1.75764 WP_000626630.1.75794 WP_000626630.1.75810 WP_000626630.1.75828 WP_000626630.1.75837 WP_000626630.1.75863 WP_000626630.1.75874 WP_000626630.1.75902 WP_000626630.1.75945 WP_000626630.1.76020 WP_000626630.1.76108 WP_000626630.1.76137 WP_000626630.1.76252 WP_000626630.1.76301 WP_000626630.1.76345 WP_000626630.1.76445 WP_000626630.1.76451 WP_000626630.1.76495 WP_000626630.1.7660 WP_000626630.1.76673 WP_000626630.1.76706 WP_000626630.1.76721 WP_000626630.1.76756 WP_000626630.1.76760 WP_000626630.1.76776 WP_000626630.1.76875 WP_000626630.1.76880 WP_000626630.1.76899 WP_000626630.1.76913 WP_000626630.1.76968 WP_000626630.1.77038 WP_000626630.1.77047 WP_000626630.1.77067 WP_000626630.1.77080 WP_000626630.1.7712 WP_000626630.1.77180 WP_000626630.1.77244 WP_000626630.1.77271 WP_000626630.1.77292 WP_000626630.1.77306 WP_000626630.1.77349 WP_000626630.1.77356 WP_000626630.1.77475 WP_000626630.1.77496 WP_000626630.1.77514 WP_000626630.1.77529 WP_000626630.1.77549 WP_000626630.1.77692 WP_000626630.1.7782 WP_000626630.1.77851 WP_000626630.1.77898 WP_000626630.1.77918 WP_000626630.1.7792 WP_000626630.1.7793 WP_000626630.1.77951 WP_000626630.1.77960 WP_000626630.1.77983 WP_000626630.1.77989 WP_000626630.1.7802 WP_000626630.1.78033 WP_000626630.1.78051 WP_000626630.1.78076 WP_000626630.1.78096 WP_000626630.1.78100 WP_000626630.1.78110 WP_000626630.1.78120 WP_000626630.1.78245 WP_000626630.1.78383 WP_000626630.1.78407 WP_000626630.1.78443 WP_000626630.1.78501 WP_000626630.1.78603 WP_000626630.1.7861 WP_000626630.1.78618 WP_000626630.1.78632 WP_000626630.1.78658 WP_000626630.1.78673 WP_000626630.1.78697 WP_000626630.1.78734 WP_000626630.1.78735 WP_000626630.1.7877 WP_000626630.1.78802 WP_000626630.1.78815 WP_000626630.1.78830 WP_000626630.1.78835 WP_000626630.1.78871 WP_000626630.1.78874 WP_000626630.1.78877 WP_000626630.1.78896 WP_000626630.1.78918 WP_000626630.1.78930 WP_000626630.1.79032 WP_000626630.1.79099 WP_000626630.1.79151 WP_000626630.1.79167 WP_000626630.1.79289 WP_000626630.1.79302 WP_000626630.1.79335 WP_000626630.1.79462 WP_000626630.1.79468 WP_000626630.1.79472 WP_000626630.1.79490 WP_000626630.1.79495 WP_000626630.1.79529 WP_000626630.1.79570 WP_000626630.1.79580 WP_000626630.1.79586 WP_000626630.1.7964 WP_000626630.1.79659 WP_000626630.1.79668 WP_000626630.1.79757 WP_000626630.1.7982 WP_000626630.1.79845 WP_000626630.1.7991 WP_000626630.1.79966 WP_000626630.1.80077 WP_000626630.1.80137 WP_000626630.1.80182 WP_000626630.1.80249 WP_000626630.1.80254 WP_000626630.1.80296 WP_000626630.1.80366 WP_000626630.1.80380 WP_000626630.1.80609 WP_000626630.1.80667 WP_000626630.1.80674 WP_000626630.1.80750 WP_000626630.1.80760 WP_000626630.1.80780 WP_000626630.1.80831 WP_000626630.1.80850 WP_000626630.1.80874 WP_000626630.1.80876 WP_000626630.1.80881 WP_000626630.1.80939 WP_000626630.1.8096 WP_000626630.1.81037 WP_000626630.1.8106 WP_000626630.1.81069 WP_000626630.1.81109 WP_000626630.1.81110 WP_000626630.1.81149 WP_000626630.1.81175 WP_000626630.1.8119 WP_000626630.1.81193 WP_000626630.1.81197 WP_000626630.1.81225 WP_000626630.1.8130 WP_000626630.1.81321 WP_000626630.1.8134 WP_000626630.1.81354 WP_000626630.1.81388 WP_000626630.1.81410 WP_000626630.1.81425 WP_000626630.1.81455 WP_000626630.1.81668 WP_000626630.1.81750 WP_000626630.1.81768 WP_000626630.1.81785 WP_000626630.1.81902 WP_000626630.1.81974 WP_000626630.1.82149 WP_000626630.1.82337 WP_000626630.1.82401 WP_000626630.1.82420 WP_000626630.1.82434 WP_000626630.1.8247 WP_000626630.1.82474 WP_000626630.1.82479 WP_000626630.1.82503 WP_000626630.1.82515 WP_000626630.1.82569 WP_000626630.1.82584 WP_000626630.1.82676 WP_000626630.1.82761 WP_000626630.1.8282 WP_000626630.1.82944 WP_000626630.1.82956 WP_000626630.1.82992 WP_000626630.1.83005 WP_000626630.1.83006 WP_000626630.1.83092 WP_000626630.1.83119 WP_000626630.1.83163 WP_000626630.1.83204 WP_000626630.1.83305 WP_000626630.1.83331 WP_000626630.1.83354 WP_000626630.1.83356 WP_000626630.1.83413 WP_000626630.1.83491 WP_000626630.1.83523 WP_000626630.1.8354 WP_000626630.1.83558 WP_000626630.1.83651 WP_000626630.1.83721 WP_000626630.1.83760 WP_000626630.1.83897 WP_000626630.1.83960 WP_000626630.1.8399 WP_000626630.1.83995 WP_000626630.1.84000 WP_000626630.1.84011 WP_000626630.1.84075 WP_000626630.1.84083 WP_000626630.1.84086 WP_000626630.1.84103 WP_000626630.1.84154 WP_000626630.1.8425 WP_000626630.1.84283 WP_000626630.1.84300 WP_000626630.1.84392 WP_000626630.1.8441 WP_000626630.1.84497 WP_000626630.1.84515 WP_000626630.1.84532 WP_000626630.1.84572 WP_000626630.1.84598 WP_000626630.1.84659 WP_000626630.1.84683 WP_000626630.1.84693 WP_000626630.1.84876 WP_000626630.1.84899 WP_000626630.1.8497 WP_000626630.1.84983 WP_000626630.1.85040 WP_000626630.1.85079 WP_000626630.1.85134 WP_000626630.1.85178 WP_000626630.1.85180 WP_000626630.1.85190 WP_000626630.1.8526 WP_000626630.1.85271 WP_000626630.1.85301 WP_000626630.1.8533 WP_000626630.1.8545 WP_000626630.1.85481 WP_000626630.1.85483 WP_000626630.1.85541 WP_000626630.1.8556 WP_000626630.1.85615 WP_000626630.1.85617 WP_000626630.1.85663 WP_000626630.1.85671 WP_000626630.1.85672 WP_000626630.1.85759 WP_000626630.1.85777 WP_000626630.1.85855 WP_000626630.1.85886 WP_000626630.1.85900 WP_000626630.1.85904 WP_000626630.1.85976 WP_000626630.1.85982 WP_000626630.1.86138 WP_000626630.1.86157 WP_000626630.1.86159 WP_000626630.1.8616 WP_000626630.1.86240 WP_000626630.1.86306 WP_000626630.1.86335 WP_000626630.1.86347 WP_000626630.1.86356 WP_000626630.1.86380 WP_000626630.1.86450 WP_000626630.1.86469 WP_000626630.1.8647 WP_000626630.1.86514 WP_000626630.1.86580 WP_000626630.1.86588 WP_000626630.1.86601 WP_000626630.1.86610 WP_000626630.1.86661 WP_000626630.1.8672 WP_000626630.1.8678 WP_000626630.1.86810 WP_000626630.1.8684 WP_000626630.1.86895 WP_000626630.1.86906 WP_000626630.1.86915 WP_000626630.1.87038 WP_000626630.1.87095 WP_000626630.1.87187 WP_000626630.1.87265 WP_000626630.1.87323 WP_000626630.1.8736 WP_000626630.1.87460 WP_000626630.1.87484 WP_000626630.1.87500 WP_000626630.1.87552 WP_000626630.1.87583 WP_000626630.1.87712 WP_000626630.1.87760 WP_000626630.1.87779 WP_000626630.1.87905 WP_000626630.1.87936 WP_000626630.1.87945 WP_000626630.1.88019 WP_000626630.1.88052 WP_000626630.1.88073 WP_000626630.1.8809 WP_000626630.1.88185 WP_000626630.1.88275 WP_000626630.1.88291 WP_000626630.1.88293 WP_000626630.1.88356 WP_000626630.1.8837 WP_000626630.1.88393 WP_000626630.1.88474 WP_000626630.1.88508 WP_000626630.1.88703 WP_000626630.1.88731 WP_000626630.1.88792 WP_000626630.1.88854 WP_000626630.1.88902 WP_000626630.1.8891 WP_000626630.1.88966 WP_000626630.1.88968 WP_000626630.1.88981 WP_000626630.1.88998 WP_000626630.1.89008 WP_000626630.1.89116 WP_000626630.1.89120 WP_000626630.1.89138 WP_000626630.1.89177 WP_000626630.1.89221 WP_000626630.1.89304 WP_000626630.1.89362 WP_000626630.1.89408 WP_000626630.1.89425 WP_000626630.1.89452 WP_000626630.1.89512 WP_000626630.1.89527 WP_000626630.1.89570 WP_000626630.1.89604 WP_000626630.1.89606 WP_000626630.1.8961 WP_000626630.1.89622 WP_000626630.1.89634 WP_000626630.1.89659 WP_000626630.1.89680 WP_000626630.1.89832 WP_000626630.1.89902 WP_000626630.1.8996 WP_000626630.1.89965 WP_000626630.1.9003 WP_000626630.1.90097 WP_000626630.1.90252 WP_000626630.1.90417 WP_000626630.1.90421 WP_000626630.1.90453 WP_000626630.1.90458 WP_000626630.1.90522 WP_000626630.1.90540 WP_000626630.1.90557 WP_000626630.1.90563 WP_000626630.1.90585 WP_000626630.1.90641 WP_000626630.1.90734 WP_000626630.1.90748 WP_000626630.1.90759 WP_000626630.1.90859 WP_000626630.1.90959 WP_000626630.1.90973 WP_000626630.1.91003 WP_000626630.1.91069 WP_000626630.1.91215 WP_000626630.1.91278 WP_000626630.1.9131 WP_000626630.1.9137 WP_000626630.1.91372 WP_000626630.1.91424 WP_000626630.1.91474 WP_000626630.1.91505 WP_000626630.1.91512 WP_000626630.1.91524 WP_000626630.1.91564 WP_000626630.1.91628 WP_000626630.1.91655 WP_000626630.1.91724 WP_000626630.1.91732 WP_000626630.1.91742 WP_000626630.1.91772 WP_000626630.1.91776 WP_000626630.1.91788 WP_000626630.1.91795 WP_000626630.1.91898 WP_000626630.1.91904 WP_000626630.1.91974 WP_000626630.1.92013 WP_000626630.1.92060 WP_000626630.1.92082 WP_000626630.1.92093 WP_000626630.1.92108 WP_000626630.1.92129 WP_000626630.1.92171 WP_000626630.1.92183 WP_000626630.1.92208 WP_000626630.1.9222 WP_000626630.1.92268 WP_000626630.1.92310 WP_000626630.1.92318 WP_000626630.1.92443 WP_000626630.1.92452 WP_000626630.1.92482 WP_000626630.1.92531 WP_000626630.1.92557 WP_000626630.1.92628 WP_000626630.1.92669 WP_000626630.1.92671 WP_000626630.1.92738 WP_000626630.1.92754 WP_000626630.1.92806 WP_000626630.1.92890 WP_000626630.1.92929 WP_000626630.1.93076 WP_000626630.1.93086 WP_000626630.1.93101 WP_000626630.1.93136 WP_000626630.1.93155 WP_000626630.1.93215 WP_000626630.1.93350 WP_000626630.1.93365 WP_000626630.1.93376 WP_000626630.1.93410 WP_000626630.1.93524 WP_000626630.1.93543 WP_000626630.1.93577 WP_000626630.1.93650 WP_000626630.1.93656 WP_000626630.1.93662 WP_000626630.1.937 WP_000626630.1.93705 WP_000626630.1.9380 WP_000626630.1.93804 WP_000626630.1.93809 WP_000626630.1.9389 WP_000626630.1.93994 WP_000626630.1.94072 WP_000626630.1.94162 WP_000626630.1.94168 WP_000626630.1.94198 WP_000626630.1.9432 WP_000626630.1.94354 WP_000626630.1.94380 WP_000626630.1.9440 WP_000626630.1.94458 WP_000626630.1.94473 WP_000626630.1.94565 WP_000626630.1.94584 WP_000626630.1.94598 WP_000626630.1.94649 WP_000626630.1.94670 WP_000626630.1.94674 WP_000626630.1.94796 WP_000626630.1.94835 WP_000626630.1.94959 WP_000626630.1.94983 WP_000626630.1.95051 WP_000626630.1.95085 WP_000626630.1.95121 WP_000626630.1.95136 WP_000626630.1.9527 WP_000626630.1.95282 WP_000626630.1.95434 WP_000626630.1.95447 WP_000626630.1.95456 WP_000626630.1.95546 WP_000626630.1.95558 WP_000626630.1.95607 WP_000626630.1.95630 WP_000626630.1.95656 WP_000626630.1.95757 WP_000626630.1.9586 WP_000626630.1.95866 WP_000626630.1.95911 WP_000626630.1.95963 WP_000626630.1.96107 WP_000626630.1.96139 WP_000626630.1.9624 WP_000626630.1.96317 WP_000626630.1.96340 WP_000626630.1.96343 WP_000626630.1.96348 WP_000626630.1.96349 WP_000626630.1.96380 WP_000626630.1.9644 WP_000626630.1.96469 WP_000626630.1.96490 WP_000626630.1.96497 WP_000626630.1.96500 WP_000626630.1.96521 WP_000626630.1.96537 WP_000626630.1.96555 WP_000626630.1.96563 WP_000626630.1.96584 WP_000626630.1.96588 WP_000626630.1.96732 WP_000626630.1.96735 WP_000626630.1.96771 WP_000626630.1.96876 WP_000626630.1.96993 WP_000626630.1.97015 WP_000626630.1.97043 WP_000626630.1.97103 WP_000626630.1.97109 WP_000626630.1.97145 WP_000626630.1.97190 WP_000626630.1.97318 WP_000626630.1.97322 WP_000626630.1.97328 WP_000626630.1.97369 WP_000626630.1.97547 WP_000626630.1.97594 WP_000626630.1.97597 WP_000626630.1.97613 WP_000626630.1.97620 WP_000626630.1.97648 WP_000626630.1.97656 WP_000626630.1.97704 WP_000626630.1.97727 WP_000626630.1.97732 WP_000626630.1.97736 WP_000626630.1.9774 WP_000626630.1.9775 WP_000626630.1.97846 WP_000626630.1.9793 WP_000626630.1.97981 WP_000626630.1.97991 WP_000626630.1.98006 WP_000626630.1.98019 WP_000626630.1.98022 WP_000626630.1.98110 WP_000626630.1.98119 WP_000626630.1.98146 WP_000626630.1.98219 WP_000626630.1.98236 WP_000626630.1.98338 WP_000626630.1.9841 WP_000626630.1.98440 WP_000626630.1.98472 WP_000626630.1.98495 WP_000626630.1.98531 WP_000626630.1.98551 WP_000626630.1.98570 WP_000626630.1.98577 WP_000626630.1.98634 WP_000626630.1.98676 WP_000626630.1.98677 WP_000626630.1.98726 WP_000626630.1.98760 WP_000626630.1.98843 WP_000626630.1.98947 WP_000626630.1.9898 WP_000626630.1.9899 WP_000626630.1.99040 WP_000626630.1.99057 WP_000626630.1.99072 WP_000626630.1.99097 WP_000626630.1.99098 WP_000626630.1.99164 WP_000626630.1.99184 WP_000626630.1.99215 WP_000626630.1.99267 WP_000626630.1.99276 WP_000626630.1.99456 WP_000626630.1.99490 WP_000626630.1.99493 WP_000626630.1.99577 WP_000626630.1.99613 WP_000626630.1.99630 WP_000626630.1.99646 WP_000626630.1.99657 WP_000626630.1.99660 WP_000626630.1.99712 WP_000626630.1.99813 WP_000626630.1.99858 WP_000626630.1.99889 WP_000626630.1.99924 WP_000626630.1.99958 WP_000626630.1.99961 IDP00904 ABAM02000001|CDS_646257-647615 ABAO01000001|CDS_191253-192611 ABEW01000003|CDS_144369-143011 AE006468|CDS_144963-146321 AM933172|CDS_144649-146007 CP001144|CDS_140579-141937 CP001363|CDS_145675-147033 FN424405|CDS_144964-146322 gi|16763514|ref|NP_459129.1| gi|378987530|ref|YP_005250694.1| gi|198246066|ref|YP_002214076.1| gi|482902673|ref|YP_007901233.1| gi|378982665|ref|YP_005245820.1| gi|550899549|ref|YP_008668641.1| gi|379699345|ref|YP_005241073.1| gi|525839409|ref|YP_008256699.1| gi|378443578|ref|YP_005231210.1| gi|378448424|ref|YP_005235783.1| gi|378698104|ref|YP_005180061.1| gi|207855638|ref|YP_002242289.1| gi|383494946|ref|YP_005395635.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]