SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378448426|ref|YP_005235785.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378448426|ref|YP_005235785.1|
Domain Number 1 Region: 95-297
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, catalytic domain 2.09e-56
Family MurCDEF 0.00000000981
Further Details:      
 
Domain Number 2 Region: 299-437
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, peptide-binding domain 1.42e-52
Family MurCDEF C-terminal domain 0.000000316
Further Details:      
 
Domain Number 3 Region: 3-94
Classification Level Classification E-value
Superfamily MurCD N-terminal domain 1.7e-23
Family MurCD N-terminal domain 0.00000421
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|378448426|ref|YP_005235785.1|
Sequence length 438
Comment UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S]
Sequence
MADYQDKNVVIIGLGLTGLSCVDFFLARGVTPRVMDTRVTPPGLDKLPQEVERHVGGLND
EWLLAADLIVASPGIALAHPSLSAAASAGVEIVGDIELFCREAQAPIVAITGSNGKSTVT
TLVGEMAKAAGVNVGVGGNIGLPALMLLDADRELYVLELSSFQLETTSSLQAAAATVLNV
TEDHMDRYPFGLQQYRAAKLRVYEKAKVCVVNADDALTMPVRGADERCVSFGVNMGDYHL
NRQQGETWLRVKGEKVLNVKEMKLSGQHNYTNALAALALADAVGLPRASSLKALTTFTGL
AHRFQLALEHNGVRWINDSKATNVGSTEAALNGLHVDGTLHLLLGGDGKSADFSPLTRYL
TGDRIRLYCFGRDGAQLAALRPEIAQQTETMEEAMRLLAPRVQPGDMVLLSPACASLDQF
KNFEQRGDVFTRLAKELG
Download sequence
Identical sequences A0A0D6HJ12 A0A0F6AWR8 A0A0F7J527 A0A0G2NIZ2 A0A0H3NCR0 A0A0M0PMJ1 A0A0U1J0Q7 A0A1R2TVX1 A0A249V2G1 A0A265B3R9 A0A2G1NII2 A0A2H9YG69 B5RH62 E8XH37 M7RLY3 Q8ZRU4 S4IDS2
gi|207855640|ref|YP_002242291.1| gi|386590005|ref|YP_006086405.1| gi|16763516|ref|NP_459131.1| gi|526221950|ref|YP_008264385.1| gi|378953930|ref|YP_005211417.1| gi|550899551|ref|YP_008668643.1| gi|205351465|ref|YP_002225266.1| gi|549722851|ref|YP_008643041.1| gi|378987532|ref|YP_005250696.1| gi|198243206|ref|YP_002214078.1| gi|379699347|ref|YP_005241075.1| gi|378448426|ref|YP_005235785.1| 439851.SeD_A0135 454169.SeHA_C0138 550537.SEN0127 550538.SG0127 99287.STM0126 gi|378698106|ref|YP_005180063.1| gi|482902675|ref|YP_007901235.1| gi|378443580|ref|YP_005231212.1| gi|525815983|ref|YP_008246001.1| IDP00905 ABAM02000001|CDS_648694-650010 ABAO01000001|CDS_193690-195006 ABEL01000008|CDS_92891-91575 AE006468|CDS_147400-148716 AM933172|CDS_147086-148402 AM933173|CDS_147237-148553 CP001120|CDS_142599-143915 CP001144|CDS_143016-144332 CP001363|CDS_148112-149428 FN424405|CDS_147401-148717 gi|525830400|ref|YP_008250546.1| NP_459131.1.58477 WP_000796445.1.100010 WP_000796445.1.100017 WP_000796445.1.100077 WP_000796445.1.100149 WP_000796445.1.100191 WP_000796445.1.100234 WP_000796445.1.100258 WP_000796445.1.100376 WP_000796445.1.100392 WP_000796445.1.100412 WP_000796445.1.100424 WP_000796445.1.100436 WP_000796445.1.100457 WP_000796445.1.100484 WP_000796445.1.100488 WP_000796445.1.100519 WP_000796445.1.100541 WP_000796445.1.100557 WP_000796445.1.100584 WP_000796445.1.100597 WP_000796445.1.100605 WP_000796445.1.100750 WP_000796445.1.10076 WP_000796445.1.100776 WP_000796445.1.100781 WP_000796445.1.100793 WP_000796445.1.10081 WP_000796445.1.100857 WP_000796445.1.100869 WP_000796445.1.100871 WP_000796445.1.100882 WP_000796445.1.100895 WP_000796445.1.100948 WP_000796445.1.101007 WP_000796445.1.101020 WP_000796445.1.101074 WP_000796445.1.101078 WP_000796445.1.101112 WP_000796445.1.101180 WP_000796445.1.101259 WP_000796445.1.101284 WP_000796445.1.101291 WP_000796445.1.1013 WP_000796445.1.101320 WP_000796445.1.101353 WP_000796445.1.101386 WP_000796445.1.101404 WP_000796445.1.101420 WP_000796445.1.101541 WP_000796445.1.101589 WP_000796445.1.101634 WP_000796445.1.101674 WP_000796445.1.101707 WP_000796445.1.101734 WP_000796445.1.101832 WP_000796445.1.101878 WP_000796445.1.101917 WP_000796445.1.101927 WP_000796445.1.101953 WP_000796445.1.102009 WP_000796445.1.102111 WP_000796445.1.10220 WP_000796445.1.10231 WP_000796445.1.10266 WP_000796445.1.10300 WP_000796445.1.10429 WP_000796445.1.10439 WP_000796445.1.10498 WP_000796445.1.10566 WP_000796445.1.10568 WP_000796445.1.10631 WP_000796445.1.10678 WP_000796445.1.10753 WP_000796445.1.10755 WP_000796445.1.10868 WP_000796445.1.10898 WP_000796445.1.10992 WP_000796445.1.11000 WP_000796445.1.11024 WP_000796445.1.11031 WP_000796445.1.11098 WP_000796445.1.1110 WP_000796445.1.11119 WP_000796445.1.11156 WP_000796445.1.11168 WP_000796445.1.11190 WP_000796445.1.11216 WP_000796445.1.11295 WP_000796445.1.11304 WP_000796445.1.11455 WP_000796445.1.11458 WP_000796445.1.1150 WP_000796445.1.11518 WP_000796445.1.11526 WP_000796445.1.11528 WP_000796445.1.11532 WP_000796445.1.11543 WP_000796445.1.1156 WP_000796445.1.11588 WP_000796445.1.11677 WP_000796445.1.11687 WP_000796445.1.1169 WP_000796445.1.11735 WP_000796445.1.1174 WP_000796445.1.11763 WP_000796445.1.11772 WP_000796445.1.11824 WP_000796445.1.11834 WP_000796445.1.11841 WP_000796445.1.11865 WP_000796445.1.11897 WP_000796445.1.11900 WP_000796445.1.11938 WP_000796445.1.11978 WP_000796445.1.12017 WP_000796445.1.12025 WP_000796445.1.12027 WP_000796445.1.12106 WP_000796445.1.12114 WP_000796445.1.1215 WP_000796445.1.12168 WP_000796445.1.12340 WP_000796445.1.12351 WP_000796445.1.12370 WP_000796445.1.12374 WP_000796445.1.1239 WP_000796445.1.12485 WP_000796445.1.12546 WP_000796445.1.12568 WP_000796445.1.12569 WP_000796445.1.12585 WP_000796445.1.1264 WP_000796445.1.12696 WP_000796445.1.12728 WP_000796445.1.12879 WP_000796445.1.12936 WP_000796445.1.12995 WP_000796445.1.1300 WP_000796445.1.13027 WP_000796445.1.13076 WP_000796445.1.13101 WP_000796445.1.13102 WP_000796445.1.13106 WP_000796445.1.13130 WP_000796445.1.13207 WP_000796445.1.13247 WP_000796445.1.13274 WP_000796445.1.13311 WP_000796445.1.13334 WP_000796445.1.13367 WP_000796445.1.13391 WP_000796445.1.13414 WP_000796445.1.1346 WP_000796445.1.13488 WP_000796445.1.13509 WP_000796445.1.13573 WP_000796445.1.13625 WP_000796445.1.13661 WP_000796445.1.13669 WP_000796445.1.13741 WP_000796445.1.1387 WP_000796445.1.13908 WP_000796445.1.13932 WP_000796445.1.13968 WP_000796445.1.14001 WP_000796445.1.14111 WP_000796445.1.1412 WP_000796445.1.14151 WP_000796445.1.14239 WP_000796445.1.14320 WP_000796445.1.14379 WP_000796445.1.14406 WP_000796445.1.14410 WP_000796445.1.14436 WP_000796445.1.14446 WP_000796445.1.14458 WP_000796445.1.14466 WP_000796445.1.14505 WP_000796445.1.14524 WP_000796445.1.14554 WP_000796445.1.146 WP_000796445.1.14618 WP_000796445.1.14708 WP_000796445.1.14725 WP_000796445.1.14737 WP_000796445.1.14793 WP_000796445.1.14819 WP_000796445.1.14852 WP_000796445.1.1489 WP_000796445.1.14913 WP_000796445.1.14932 WP_000796445.1.15046 WP_000796445.1.15055 WP_000796445.1.15067 WP_000796445.1.15079 WP_000796445.1.15124 WP_000796445.1.15214 WP_000796445.1.15223 WP_000796445.1.15226 WP_000796445.1.15276 WP_000796445.1.15316 WP_000796445.1.15318 WP_000796445.1.15369 WP_000796445.1.1540 WP_000796445.1.15508 WP_000796445.1.15585 WP_000796445.1.15612 WP_000796445.1.1568 WP_000796445.1.15775 WP_000796445.1.15777 WP_000796445.1.15784 WP_000796445.1.15862 WP_000796445.1.15909 WP_000796445.1.15910 WP_000796445.1.15986 WP_000796445.1.16004 WP_000796445.1.16047 WP_000796445.1.16062 WP_000796445.1.16063 WP_000796445.1.16103 WP_000796445.1.16125 WP_000796445.1.16226 WP_000796445.1.16233 WP_000796445.1.16284 WP_000796445.1.1635 WP_000796445.1.16361 WP_000796445.1.16363 WP_000796445.1.16365 WP_000796445.1.16366 WP_000796445.1.16394 WP_000796445.1.16453 WP_000796445.1.16468 WP_000796445.1.16474 WP_000796445.1.16525 WP_000796445.1.16614 WP_000796445.1.16650 WP_000796445.1.16686 WP_000796445.1.16691 WP_000796445.1.167 WP_000796445.1.16729 WP_000796445.1.16732 WP_000796445.1.16735 WP_000796445.1.16786 WP_000796445.1.16858 WP_000796445.1.16873 WP_000796445.1.16896 WP_000796445.1.16903 WP_000796445.1.16916 WP_000796445.1.16949 WP_000796445.1.16965 WP_000796445.1.16972 WP_000796445.1.1700 WP_000796445.1.17060 WP_000796445.1.17093 WP_000796445.1.17096 WP_000796445.1.17105 WP_000796445.1.17307 WP_000796445.1.1733 WP_000796445.1.174 WP_000796445.1.17480 WP_000796445.1.17482 WP_000796445.1.17525 WP_000796445.1.17546 WP_000796445.1.17583 WP_000796445.1.17702 WP_000796445.1.17705 WP_000796445.1.17732 WP_000796445.1.17743 WP_000796445.1.17747 WP_000796445.1.17886 WP_000796445.1.17891 WP_000796445.1.17914 WP_000796445.1.17936 WP_000796445.1.1798 WP_000796445.1.18019 WP_000796445.1.18056 WP_000796445.1.18061 WP_000796445.1.18092 WP_000796445.1.18109 WP_000796445.1.18122 WP_000796445.1.1814 WP_000796445.1.18149 WP_000796445.1.18163 WP_000796445.1.1818 WP_000796445.1.18249 WP_000796445.1.18254 WP_000796445.1.18265 WP_000796445.1.18267 WP_000796445.1.18282 WP_000796445.1.18384 WP_000796445.1.18468 WP_000796445.1.18607 WP_000796445.1.18641 WP_000796445.1.18686 WP_000796445.1.18705 WP_000796445.1.18715 WP_000796445.1.18737 WP_000796445.1.18776 WP_000796445.1.18822 WP_000796445.1.18847 WP_000796445.1.18881 WP_000796445.1.18886 WP_000796445.1.18940 WP_000796445.1.18949 WP_000796445.1.1895 WP_000796445.1.19053 WP_000796445.1.19093 WP_000796445.1.19240 WP_000796445.1.19273 WP_000796445.1.19320 WP_000796445.1.19373 WP_000796445.1.19433 WP_000796445.1.19458 WP_000796445.1.19460 WP_000796445.1.19461 WP_000796445.1.1955 WP_000796445.1.19588 WP_000796445.1.19614 WP_000796445.1.19616 WP_000796445.1.19642 WP_000796445.1.19656 WP_000796445.1.19702 WP_000796445.1.19706 WP_000796445.1.19724 WP_000796445.1.19749 WP_000796445.1.19784 WP_000796445.1.19793 WP_000796445.1.19802 WP_000796445.1.19809 WP_000796445.1.19834 WP_000796445.1.19867 WP_000796445.1.19938 WP_000796445.1.19967 WP_000796445.1.19975 WP_000796445.1.1998 WP_000796445.1.20 WP_000796445.1.20086 WP_000796445.1.2010 WP_000796445.1.20212 WP_000796445.1.20261 WP_000796445.1.20266 WP_000796445.1.20271 WP_000796445.1.20330 WP_000796445.1.2036 WP_000796445.1.20362 WP_000796445.1.2041 WP_000796445.1.20418 WP_000796445.1.20437 WP_000796445.1.20443 WP_000796445.1.20446 WP_000796445.1.2047 WP_000796445.1.20525 WP_000796445.1.2054 WP_000796445.1.20553 WP_000796445.1.20614 WP_000796445.1.20626 WP_000796445.1.20646 WP_000796445.1.20767 WP_000796445.1.20789 WP_000796445.1.20886 WP_000796445.1.20894 WP_000796445.1.20908 WP_000796445.1.2091 WP_000796445.1.21049 WP_000796445.1.2107 WP_000796445.1.21079 WP_000796445.1.21103 WP_000796445.1.21136 WP_000796445.1.21146 WP_000796445.1.2116 WP_000796445.1.21194 WP_000796445.1.21202 WP_000796445.1.21241 WP_000796445.1.21245 WP_000796445.1.21246 WP_000796445.1.21269 WP_000796445.1.21332 WP_000796445.1.21351 WP_000796445.1.21400 WP_000796445.1.21497 WP_000796445.1.21499 WP_000796445.1.21548 WP_000796445.1.21603 WP_000796445.1.21616 WP_000796445.1.21681 WP_000796445.1.21715 WP_000796445.1.21751 WP_000796445.1.21757 WP_000796445.1.21909 WP_000796445.1.21950 WP_000796445.1.21991 WP_000796445.1.22024 WP_000796445.1.2205 WP_000796445.1.22051 WP_000796445.1.22062 WP_000796445.1.22067 WP_000796445.1.22096 WP_000796445.1.22136 WP_000796445.1.22158 WP_000796445.1.22162 WP_000796445.1.2221 WP_000796445.1.22235 WP_000796445.1.22296 WP_000796445.1.22346 WP_000796445.1.2235 WP_000796445.1.22379 WP_000796445.1.22427 WP_000796445.1.22449 WP_000796445.1.22454 WP_000796445.1.2246 WP_000796445.1.22460 WP_000796445.1.22485 WP_000796445.1.22537 WP_000796445.1.22590 WP_000796445.1.22595 WP_000796445.1.22605 WP_000796445.1.22620 WP_000796445.1.22692 WP_000796445.1.22758 WP_000796445.1.22760 WP_000796445.1.22857 WP_000796445.1.22870 WP_000796445.1.22880 WP_000796445.1.22902 WP_000796445.1.22947 WP_000796445.1.22979 WP_000796445.1.23102 WP_000796445.1.23114 WP_000796445.1.2314 WP_000796445.1.23172 WP_000796445.1.23192 WP_000796445.1.2324 WP_000796445.1.23259 WP_000796445.1.23309 WP_000796445.1.23329 WP_000796445.1.23442 WP_000796445.1.23460 WP_000796445.1.23472 WP_000796445.1.23482 WP_000796445.1.23509 WP_000796445.1.2358 WP_000796445.1.23621 WP_000796445.1.23631 WP_000796445.1.23634 WP_000796445.1.2364 WP_000796445.1.23670 WP_000796445.1.23746 WP_000796445.1.23755 WP_000796445.1.23932 WP_000796445.1.23959 WP_000796445.1.24017 WP_000796445.1.24082 WP_000796445.1.24145 WP_000796445.1.24163 WP_000796445.1.24206 WP_000796445.1.24214 WP_000796445.1.24250 WP_000796445.1.24297 WP_000796445.1.24308 WP_000796445.1.24361 WP_000796445.1.24408 WP_000796445.1.24409 WP_000796445.1.24433 WP_000796445.1.24444 WP_000796445.1.24476 WP_000796445.1.24494 WP_000796445.1.24578 WP_000796445.1.24673 WP_000796445.1.24737 WP_000796445.1.24779 WP_000796445.1.24803 WP_000796445.1.24901 WP_000796445.1.24944 WP_000796445.1.25008 WP_000796445.1.25015 WP_000796445.1.25072 WP_000796445.1.25119 WP_000796445.1.25159 WP_000796445.1.25175 WP_000796445.1.25206 WP_000796445.1.25354 WP_000796445.1.25405 WP_000796445.1.25421 WP_000796445.1.25426 WP_000796445.1.25454 WP_000796445.1.25493 WP_000796445.1.25618 WP_000796445.1.25668 WP_000796445.1.2568 WP_000796445.1.25690 WP_000796445.1.2570 WP_000796445.1.25709 WP_000796445.1.25722 WP_000796445.1.25740 WP_000796445.1.25780 WP_000796445.1.25814 WP_000796445.1.25951 WP_000796445.1.25988 WP_000796445.1.26083 WP_000796445.1.26194 WP_000796445.1.26311 WP_000796445.1.26319 WP_000796445.1.26429 WP_000796445.1.26440 WP_000796445.1.26441 WP_000796445.1.26493 WP_000796445.1.26532 WP_000796445.1.26551 WP_000796445.1.26567 WP_000796445.1.26587 WP_000796445.1.26687 WP_000796445.1.2672 WP_000796445.1.26741 WP_000796445.1.26794 WP_000796445.1.26919 WP_000796445.1.26936 WP_000796445.1.27010 WP_000796445.1.27084 WP_000796445.1.27173 WP_000796445.1.27206 WP_000796445.1.27223 WP_000796445.1.27272 WP_000796445.1.27314 WP_000796445.1.27383 WP_000796445.1.27423 WP_000796445.1.27544 WP_000796445.1.27547 WP_000796445.1.27561 WP_000796445.1.2763 WP_000796445.1.27632 WP_000796445.1.27638 WP_000796445.1.27658 WP_000796445.1.27665 WP_000796445.1.27707 WP_000796445.1.27713 WP_000796445.1.27761 WP_000796445.1.2777 WP_000796445.1.27800 WP_000796445.1.27833 WP_000796445.1.27857 WP_000796445.1.27883 WP_000796445.1.27969 WP_000796445.1.27977 WP_000796445.1.27995 WP_000796445.1.28032 WP_000796445.1.28056 WP_000796445.1.28094 WP_000796445.1.28126 WP_000796445.1.28139 WP_000796445.1.28170 WP_000796445.1.28200 WP_000796445.1.28232 WP_000796445.1.28233 WP_000796445.1.28303 WP_000796445.1.2835 WP_000796445.1.28370 WP_000796445.1.28462 WP_000796445.1.2853 WP_000796445.1.28538 WP_000796445.1.28570 WP_000796445.1.28575 WP_000796445.1.28620 WP_000796445.1.28625 WP_000796445.1.28655 WP_000796445.1.28694 WP_000796445.1.28733 WP_000796445.1.28773 WP_000796445.1.2879 WP_000796445.1.2890 WP_000796445.1.28946 WP_000796445.1.29006 WP_000796445.1.29010 WP_000796445.1.29099 WP_000796445.1.2910 WP_000796445.1.29113 WP_000796445.1.29168 WP_000796445.1.29218 WP_000796445.1.2924 WP_000796445.1.29255 WP_000796445.1.29274 WP_000796445.1.2932 WP_000796445.1.29379 WP_000796445.1.29422 WP_000796445.1.29436 WP_000796445.1.29509 WP_000796445.1.29576 WP_000796445.1.29588 WP_000796445.1.29601 WP_000796445.1.29606 WP_000796445.1.29615 WP_000796445.1.29619 WP_000796445.1.29711 WP_000796445.1.29827 WP_000796445.1.29969 WP_000796445.1.29990 WP_000796445.1.30006 WP_000796445.1.30022 WP_000796445.1.30027 WP_000796445.1.3005 WP_000796445.1.30059 WP_000796445.1.30165 WP_000796445.1.30180 WP_000796445.1.30202 WP_000796445.1.30210 WP_000796445.1.30278 WP_000796445.1.30437 WP_000796445.1.30469 WP_000796445.1.30492 WP_000796445.1.30505 WP_000796445.1.30507 WP_000796445.1.30535 WP_000796445.1.30547 WP_000796445.1.30548 WP_000796445.1.30589 WP_000796445.1.30627 WP_000796445.1.3067 WP_000796445.1.30752 WP_000796445.1.30794 WP_000796445.1.30833 WP_000796445.1.30835 WP_000796445.1.30968 WP_000796445.1.30972 WP_000796445.1.31 WP_000796445.1.31092 WP_000796445.1.31111 WP_000796445.1.31122 WP_000796445.1.3113 WP_000796445.1.31156 WP_000796445.1.31167 WP_000796445.1.31171 WP_000796445.1.31185 WP_000796445.1.3119 WP_000796445.1.31190 WP_000796445.1.31195 WP_000796445.1.31196 WP_000796445.1.31219 WP_000796445.1.3127 WP_000796445.1.31272 WP_000796445.1.31281 WP_000796445.1.31335 WP_000796445.1.31362 WP_000796445.1.31435 WP_000796445.1.31451 WP_000796445.1.31504 WP_000796445.1.31515 WP_000796445.1.31578 WP_000796445.1.31585 WP_000796445.1.31658 WP_000796445.1.3167 WP_000796445.1.31854 WP_000796445.1.31895 WP_000796445.1.31901 WP_000796445.1.31940 WP_000796445.1.31952 WP_000796445.1.31967 WP_000796445.1.31972 WP_000796445.1.31983 WP_000796445.1.32109 WP_000796445.1.32116 WP_000796445.1.32192 WP_000796445.1.32206 WP_000796445.1.32255 WP_000796445.1.32260 WP_000796445.1.32274 WP_000796445.1.32309 WP_000796445.1.32408 WP_000796445.1.32438 WP_000796445.1.32515 WP_000796445.1.32519 WP_000796445.1.32527 WP_000796445.1.32660 WP_000796445.1.32668 WP_000796445.1.32702 WP_000796445.1.32714 WP_000796445.1.32740 WP_000796445.1.32786 WP_000796445.1.32804 WP_000796445.1.32832 WP_000796445.1.32860 WP_000796445.1.32881 WP_000796445.1.32899 WP_000796445.1.32907 WP_000796445.1.32977 WP_000796445.1.33010 WP_000796445.1.33030 WP_000796445.1.33127 WP_000796445.1.33143 WP_000796445.1.33160 WP_000796445.1.33248 WP_000796445.1.33253 WP_000796445.1.33261 WP_000796445.1.33270 WP_000796445.1.333 WP_000796445.1.33409 WP_000796445.1.33492 WP_000796445.1.335 WP_000796445.1.33553 WP_000796445.1.3356 WP_000796445.1.33580 WP_000796445.1.33586 WP_000796445.1.33592 WP_000796445.1.3364 WP_000796445.1.33817 WP_000796445.1.33825 WP_000796445.1.33865 WP_000796445.1.33894 WP_000796445.1.3394 WP_000796445.1.3396 WP_000796445.1.34 WP_000796445.1.34043 WP_000796445.1.34075 WP_000796445.1.34091 WP_000796445.1.34185 WP_000796445.1.34257 WP_000796445.1.34279 WP_000796445.1.34292 WP_000796445.1.34319 WP_000796445.1.3438 WP_000796445.1.34417 WP_000796445.1.34431 WP_000796445.1.34453 WP_000796445.1.34454 WP_000796445.1.34610 WP_000796445.1.34614 WP_000796445.1.34684 WP_000796445.1.34711 WP_000796445.1.34820 WP_000796445.1.34856 WP_000796445.1.34975 WP_000796445.1.34977 WP_000796445.1.35045 WP_000796445.1.35129 WP_000796445.1.35184 WP_000796445.1.35193 WP_000796445.1.35298 WP_000796445.1.35321 WP_000796445.1.35332 WP_000796445.1.35404 WP_000796445.1.35408 WP_000796445.1.35425 WP_000796445.1.35429 WP_000796445.1.35446 WP_000796445.1.35463 WP_000796445.1.35509 WP_000796445.1.35563 WP_000796445.1.35570 WP_000796445.1.35590 WP_000796445.1.35594 WP_000796445.1.35619 WP_000796445.1.35624 WP_000796445.1.3572 WP_000796445.1.35887 WP_000796445.1.35892 WP_000796445.1.35936 WP_000796445.1.35940 WP_000796445.1.35961 WP_000796445.1.36003 WP_000796445.1.3601 WP_000796445.1.36017 WP_000796445.1.36037 WP_000796445.1.36063 WP_000796445.1.36409 WP_000796445.1.36445 WP_000796445.1.36547 WP_000796445.1.36584 WP_000796445.1.36609 WP_000796445.1.36685 WP_000796445.1.36690 WP_000796445.1.3670 WP_000796445.1.36705 WP_000796445.1.36721 WP_000796445.1.36751 WP_000796445.1.36764 WP_000796445.1.36889 WP_000796445.1.36918 WP_000796445.1.36931 WP_000796445.1.37029 WP_000796445.1.37063 WP_000796445.1.37073 WP_000796445.1.37111 WP_000796445.1.37112 WP_000796445.1.37114 WP_000796445.1.37190 WP_000796445.1.37191 WP_000796445.1.37256 WP_000796445.1.3726 WP_000796445.1.37293 WP_000796445.1.37297 WP_000796445.1.37370 WP_000796445.1.37376 WP_000796445.1.37405 WP_000796445.1.3744 WP_000796445.1.3748 WP_000796445.1.37498 WP_000796445.1.37504 WP_000796445.1.37618 WP_000796445.1.37687 WP_000796445.1.3771 WP_000796445.1.3778 WP_000796445.1.37864 WP_000796445.1.3790 WP_000796445.1.37968 WP_000796445.1.37978 WP_000796445.1.38026 WP_000796445.1.38037 WP_000796445.1.38047 WP_000796445.1.38125 WP_000796445.1.38145 WP_000796445.1.383 WP_000796445.1.38344 WP_000796445.1.3848 WP_000796445.1.38569 WP_000796445.1.38613 WP_000796445.1.38673 WP_000796445.1.3869 WP_000796445.1.38693 WP_000796445.1.38773 WP_000796445.1.38781 WP_000796445.1.38882 WP_000796445.1.38913 WP_000796445.1.39003 WP_000796445.1.39048 WP_000796445.1.39055 WP_000796445.1.39065 WP_000796445.1.39136 WP_000796445.1.39197 WP_000796445.1.39229 WP_000796445.1.39265 WP_000796445.1.39312 WP_000796445.1.39385 WP_000796445.1.39395 WP_000796445.1.39405 WP_000796445.1.39414 WP_000796445.1.39420 WP_000796445.1.39449 WP_000796445.1.39512 WP_000796445.1.39556 WP_000796445.1.39584 WP_000796445.1.39614 WP_000796445.1.39629 WP_000796445.1.39724 WP_000796445.1.39763 WP_000796445.1.39862 WP_000796445.1.39921 WP_000796445.1.39923 WP_000796445.1.40017 WP_000796445.1.40072 WP_000796445.1.40073 WP_000796445.1.40081 WP_000796445.1.4011 WP_000796445.1.40158 WP_000796445.1.40208 WP_000796445.1.40224 WP_000796445.1.40240 WP_000796445.1.40257 WP_000796445.1.40284 WP_000796445.1.40292 WP_000796445.1.40305 WP_000796445.1.40307 WP_000796445.1.40311 WP_000796445.1.40341 WP_000796445.1.40380 WP_000796445.1.40395 WP_000796445.1.40465 WP_000796445.1.40493 WP_000796445.1.40508 WP_000796445.1.40533 WP_000796445.1.40577 WP_000796445.1.40622 WP_000796445.1.40695 WP_000796445.1.40710 WP_000796445.1.40745 WP_000796445.1.4075 WP_000796445.1.40849 WP_000796445.1.4087 WP_000796445.1.40877 WP_000796445.1.40930 WP_000796445.1.40935 WP_000796445.1.40973 WP_000796445.1.40996 WP_000796445.1.41017 WP_000796445.1.41018 WP_000796445.1.41086 WP_000796445.1.41091 WP_000796445.1.41116 WP_000796445.1.41128 WP_000796445.1.41192 WP_000796445.1.41226 WP_000796445.1.41277 WP_000796445.1.41279 WP_000796445.1.4141 WP_000796445.1.41427 WP_000796445.1.41434 WP_000796445.1.41516 WP_000796445.1.41528 WP_000796445.1.41554 WP_000796445.1.41572 WP_000796445.1.41591 WP_000796445.1.41610 WP_000796445.1.41662 WP_000796445.1.41688 WP_000796445.1.41690 WP_000796445.1.41708 WP_000796445.1.41724 WP_000796445.1.41761 WP_000796445.1.41799 WP_000796445.1.41802 WP_000796445.1.41859 WP_000796445.1.41882 WP_000796445.1.41911 WP_000796445.1.41949 WP_000796445.1.41978 WP_000796445.1.42104 WP_000796445.1.42136 WP_000796445.1.42156 WP_000796445.1.422 WP_000796445.1.4222 WP_000796445.1.42243 WP_000796445.1.42263 WP_000796445.1.42320 WP_000796445.1.42322 WP_000796445.1.42342 WP_000796445.1.42392 WP_000796445.1.42422 WP_000796445.1.42444 WP_000796445.1.42595 WP_000796445.1.42666 WP_000796445.1.42675 WP_000796445.1.42676 WP_000796445.1.42683 WP_000796445.1.42734 WP_000796445.1.4276 WP_000796445.1.42864 WP_000796445.1.4288 WP_000796445.1.42892 WP_000796445.1.42932 WP_000796445.1.43018 WP_000796445.1.43041 WP_000796445.1.43070 WP_000796445.1.43077 WP_000796445.1.43201 WP_000796445.1.43244 WP_000796445.1.43312 WP_000796445.1.43334 WP_000796445.1.43339 WP_000796445.1.43351 WP_000796445.1.43371 WP_000796445.1.43437 WP_000796445.1.4344 WP_000796445.1.43522 WP_000796445.1.43613 WP_000796445.1.43685 WP_000796445.1.43711 WP_000796445.1.43778 WP_000796445.1.43785 WP_000796445.1.43886 WP_000796445.1.43951 WP_000796445.1.44010 WP_000796445.1.44043 WP_000796445.1.44099 WP_000796445.1.44121 WP_000796445.1.44132 WP_000796445.1.44187 WP_000796445.1.44291 WP_000796445.1.44300 WP_000796445.1.44310 WP_000796445.1.44337 WP_000796445.1.44386 WP_000796445.1.44397 WP_000796445.1.44433 WP_000796445.1.44474 WP_000796445.1.44479 WP_000796445.1.44640 WP_000796445.1.4467 WP_000796445.1.44705 WP_000796445.1.44747 WP_000796445.1.44831 WP_000796445.1.4485 WP_000796445.1.44877 WP_000796445.1.44927 WP_000796445.1.44933 WP_000796445.1.44966 WP_000796445.1.44971 WP_000796445.1.44978 WP_000796445.1.44997 WP_000796445.1.4500 WP_000796445.1.45067 WP_000796445.1.45074 WP_000796445.1.45079 WP_000796445.1.45098 WP_000796445.1.45145 WP_000796445.1.45173 WP_000796445.1.45177 WP_000796445.1.45184 WP_000796445.1.45259 WP_000796445.1.45302 WP_000796445.1.4531 WP_000796445.1.45344 WP_000796445.1.45349 WP_000796445.1.45365 WP_000796445.1.45432 WP_000796445.1.45434 WP_000796445.1.45522 WP_000796445.1.45535 WP_000796445.1.45544 WP_000796445.1.45549 WP_000796445.1.45550 WP_000796445.1.45569 WP_000796445.1.45571 WP_000796445.1.45582 WP_000796445.1.45583 WP_000796445.1.45585 WP_000796445.1.45622 WP_000796445.1.45690 WP_000796445.1.45706 WP_000796445.1.45797 WP_000796445.1.458 WP_000796445.1.45844 WP_000796445.1.45848 WP_000796445.1.45906 WP_000796445.1.45918 WP_000796445.1.4592 WP_000796445.1.46011 WP_000796445.1.46069 WP_000796445.1.46112 WP_000796445.1.46173 WP_000796445.1.46174 WP_000796445.1.46187 WP_000796445.1.46203 WP_000796445.1.46215 WP_000796445.1.46278 WP_000796445.1.46303 WP_000796445.1.46434 WP_000796445.1.46578 WP_000796445.1.46595 WP_000796445.1.46675 WP_000796445.1.46726 WP_000796445.1.4674 WP_000796445.1.4686 WP_000796445.1.46930 WP_000796445.1.46967 WP_000796445.1.46976 WP_000796445.1.47008 WP_000796445.1.47214 WP_000796445.1.47389 WP_000796445.1.47429 WP_000796445.1.47448 WP_000796445.1.4747 WP_000796445.1.47472 WP_000796445.1.47478 WP_000796445.1.47507 WP_000796445.1.47567 WP_000796445.1.47576 WP_000796445.1.47579 WP_000796445.1.4758 WP_000796445.1.47621 WP_000796445.1.47799 WP_000796445.1.47829 WP_000796445.1.47850 WP_000796445.1.47875 WP_000796445.1.47911 WP_000796445.1.47928 WP_000796445.1.4795 WP_000796445.1.47988 WP_000796445.1.48242 WP_000796445.1.48253 WP_000796445.1.48268 WP_000796445.1.483 WP_000796445.1.48367 WP_000796445.1.48377 WP_000796445.1.4839 WP_000796445.1.48524 WP_000796445.1.48788 WP_000796445.1.48797 WP_000796445.1.4885 WP_000796445.1.48876 WP_000796445.1.48894 WP_000796445.1.48919 WP_000796445.1.49084 WP_000796445.1.49113 WP_000796445.1.49155 WP_000796445.1.49204 WP_000796445.1.49233 WP_000796445.1.49239 WP_000796445.1.49256 WP_000796445.1.49290 WP_000796445.1.49309 WP_000796445.1.49311 WP_000796445.1.49334 WP_000796445.1.49340 WP_000796445.1.49366 WP_000796445.1.49490 WP_000796445.1.49515 WP_000796445.1.49572 WP_000796445.1.49686 WP_000796445.1.49770 WP_000796445.1.4979 WP_000796445.1.49803 WP_000796445.1.49805 WP_000796445.1.49827 WP_000796445.1.49929 WP_000796445.1.50080 WP_000796445.1.50128 WP_000796445.1.50161 WP_000796445.1.50211 WP_000796445.1.50285 WP_000796445.1.50332 WP_000796445.1.50376 WP_000796445.1.50389 WP_000796445.1.50404 WP_000796445.1.50449 WP_000796445.1.50565 WP_000796445.1.50652 WP_000796445.1.50676 WP_000796445.1.50684 WP_000796445.1.50774 WP_000796445.1.50804 WP_000796445.1.50808 WP_000796445.1.5088 WP_000796445.1.50882 WP_000796445.1.50905 WP_000796445.1.50908 WP_000796445.1.50941 WP_000796445.1.50960 WP_000796445.1.50999 WP_000796445.1.51014 WP_000796445.1.51022 WP_000796445.1.51066 WP_000796445.1.51179 WP_000796445.1.51182 WP_000796445.1.51186 WP_000796445.1.51224 WP_000796445.1.51356 WP_000796445.1.51412 WP_000796445.1.51414 WP_000796445.1.51451 WP_000796445.1.51464 WP_000796445.1.51487 WP_000796445.1.51488 WP_000796445.1.51502 WP_000796445.1.51518 WP_000796445.1.51594 WP_000796445.1.51634 WP_000796445.1.51642 WP_000796445.1.51649 WP_000796445.1.51686 WP_000796445.1.51756 WP_000796445.1.51764 WP_000796445.1.51810 WP_000796445.1.51831 WP_000796445.1.51841 WP_000796445.1.51868 WP_000796445.1.51888 WP_000796445.1.51911 WP_000796445.1.51930 WP_000796445.1.51932 WP_000796445.1.51989 WP_000796445.1.51994 WP_000796445.1.520 WP_000796445.1.5211 WP_000796445.1.52121 WP_000796445.1.52123 WP_000796445.1.52148 WP_000796445.1.52156 WP_000796445.1.52170 WP_000796445.1.52301 WP_000796445.1.52321 WP_000796445.1.52336 WP_000796445.1.52346 WP_000796445.1.52353 WP_000796445.1.52361 WP_000796445.1.52582 WP_000796445.1.52586 WP_000796445.1.52653 WP_000796445.1.52656 WP_000796445.1.52692 WP_000796445.1.52743 WP_000796445.1.52748 WP_000796445.1.52833 WP_000796445.1.52857 WP_000796445.1.52866 WP_000796445.1.52898 WP_000796445.1.52915 WP_000796445.1.52949 WP_000796445.1.52985 WP_000796445.1.53016 WP_000796445.1.53107 WP_000796445.1.53119 WP_000796445.1.5313 WP_000796445.1.5316 WP_000796445.1.53190 WP_000796445.1.53198 WP_000796445.1.53206 WP_000796445.1.53234 WP_000796445.1.53272 WP_000796445.1.53362 WP_000796445.1.53385 WP_000796445.1.53406 WP_000796445.1.53436 WP_000796445.1.53466 WP_000796445.1.53529 WP_000796445.1.53543 WP_000796445.1.53567 WP_000796445.1.53664 WP_000796445.1.53688 WP_000796445.1.53757 WP_000796445.1.53778 WP_000796445.1.53781 WP_000796445.1.53812 WP_000796445.1.53896 WP_000796445.1.53905 WP_000796445.1.53961 WP_000796445.1.54033 WP_000796445.1.54068 WP_000796445.1.54075 WP_000796445.1.54196 WP_000796445.1.542 WP_000796445.1.54209 WP_000796445.1.54271 WP_000796445.1.54273 WP_000796445.1.54274 WP_000796445.1.54283 WP_000796445.1.54319 WP_000796445.1.54333 WP_000796445.1.54364 WP_000796445.1.54366 WP_000796445.1.54400 WP_000796445.1.54469 WP_000796445.1.54526 WP_000796445.1.54615 WP_000796445.1.54644 WP_000796445.1.54662 WP_000796445.1.54722 WP_000796445.1.54749 WP_000796445.1.54764 WP_000796445.1.54833 WP_000796445.1.54877 WP_000796445.1.54936 WP_000796445.1.55008 WP_000796445.1.55152 WP_000796445.1.55156 WP_000796445.1.55285 WP_000796445.1.55325 WP_000796445.1.55430 WP_000796445.1.55475 WP_000796445.1.55477 WP_000796445.1.55496 WP_000796445.1.55559 WP_000796445.1.5560 WP_000796445.1.55640 WP_000796445.1.55647 WP_000796445.1.55718 WP_000796445.1.5572 WP_000796445.1.55743 WP_000796445.1.55768 WP_000796445.1.5577 WP_000796445.1.55782 WP_000796445.1.55796 WP_000796445.1.55853 WP_000796445.1.55923 WP_000796445.1.55948 WP_000796445.1.55973 WP_000796445.1.55993 WP_000796445.1.56002 WP_000796445.1.56012 WP_000796445.1.56082 WP_000796445.1.56105 WP_000796445.1.56235 WP_000796445.1.56238 WP_000796445.1.56244 WP_000796445.1.56263 WP_000796445.1.56286 WP_000796445.1.56304 WP_000796445.1.56414 WP_000796445.1.56438 WP_000796445.1.56559 WP_000796445.1.56560 WP_000796445.1.56597 WP_000796445.1.56601 WP_000796445.1.56614 WP_000796445.1.56660 WP_000796445.1.56671 WP_000796445.1.5668 WP_000796445.1.56682 WP_000796445.1.56851 WP_000796445.1.56861 WP_000796445.1.56875 WP_000796445.1.56877 WP_000796445.1.56898 WP_000796445.1.56950 WP_000796445.1.57026 WP_000796445.1.57039 WP_000796445.1.57056 WP_000796445.1.5711 WP_000796445.1.57143 WP_000796445.1.57168 WP_000796445.1.57187 WP_000796445.1.57232 WP_000796445.1.57246 WP_000796445.1.57296 WP_000796445.1.57356 WP_000796445.1.57362 WP_000796445.1.57377 WP_000796445.1.57399 WP_000796445.1.57418 WP_000796445.1.57433 WP_000796445.1.57515 WP_000796445.1.57529 WP_000796445.1.57559 WP_000796445.1.57576 WP_000796445.1.57601 WP_000796445.1.57607 WP_000796445.1.57631 WP_000796445.1.57641 WP_000796445.1.5774 WP_000796445.1.57763 WP_000796445.1.57835 WP_000796445.1.57862 WP_000796445.1.57890 WP_000796445.1.57891 WP_000796445.1.57893 WP_000796445.1.57978 WP_000796445.1.5801 WP_000796445.1.58041 WP_000796445.1.58090 WP_000796445.1.5828 WP_000796445.1.58290 WP_000796445.1.58358 WP_000796445.1.58407 WP_000796445.1.58418 WP_000796445.1.58443 WP_000796445.1.58451 WP_000796445.1.58486 WP_000796445.1.58489 WP_000796445.1.5854 WP_000796445.1.58548 WP_000796445.1.5858 WP_000796445.1.58662 WP_000796445.1.58669 WP_000796445.1.587 WP_000796445.1.58745 WP_000796445.1.58749 WP_000796445.1.58803 WP_000796445.1.5886 WP_000796445.1.58884 WP_000796445.1.58926 WP_000796445.1.58932 WP_000796445.1.59094 WP_000796445.1.59142 WP_000796445.1.59163 WP_000796445.1.59224 WP_000796445.1.59335 WP_000796445.1.59375 WP_000796445.1.59420 WP_000796445.1.59427 WP_000796445.1.59458 WP_000796445.1.59490 WP_000796445.1.59508 WP_000796445.1.5953 WP_000796445.1.59538 WP_000796445.1.59548 WP_000796445.1.59646 WP_000796445.1.59648 WP_000796445.1.59684 WP_000796445.1.59694 WP_000796445.1.59771 WP_000796445.1.5979 WP_000796445.1.59848 WP_000796445.1.5993 WP_000796445.1.59953 WP_000796445.1.60004 WP_000796445.1.60008 WP_000796445.1.60021 WP_000796445.1.60052 WP_000796445.1.60069 WP_000796445.1.60106 WP_000796445.1.60126 WP_000796445.1.60137 WP_000796445.1.60140 WP_000796445.1.60155 WP_000796445.1.60285 WP_000796445.1.60320 WP_000796445.1.6033 WP_000796445.1.60379 WP_000796445.1.60425 WP_000796445.1.60464 WP_000796445.1.60545 WP_000796445.1.60560 WP_000796445.1.60561 WP_000796445.1.60713 WP_000796445.1.60772 WP_000796445.1.608 WP_000796445.1.60855 WP_000796445.1.60866 WP_000796445.1.60874 WP_000796445.1.60897 WP_000796445.1.60941 WP_000796445.1.61078 WP_000796445.1.6114 WP_000796445.1.61232 WP_000796445.1.6129 WP_000796445.1.61296 WP_000796445.1.61345 WP_000796445.1.61356 WP_000796445.1.61381 WP_000796445.1.61417 WP_000796445.1.61497 WP_000796445.1.61501 WP_000796445.1.61574 WP_000796445.1.61594 WP_000796445.1.61595 WP_000796445.1.61609 WP_000796445.1.61671 WP_000796445.1.61712 WP_000796445.1.61714 WP_000796445.1.61730 WP_000796445.1.61857 WP_000796445.1.61908 WP_000796445.1.61918 WP_000796445.1.61952 WP_000796445.1.62007 WP_000796445.1.62020 WP_000796445.1.62025 WP_000796445.1.6209 WP_000796445.1.62158 WP_000796445.1.62201 WP_000796445.1.62204 WP_000796445.1.62210 WP_000796445.1.62245 WP_000796445.1.62257 WP_000796445.1.62304 WP_000796445.1.62364 WP_000796445.1.62374 WP_000796445.1.62403 WP_000796445.1.62412 WP_000796445.1.6253 WP_000796445.1.62570 WP_000796445.1.627 WP_000796445.1.62745 WP_000796445.1.62757 WP_000796445.1.62853 WP_000796445.1.62903 WP_000796445.1.62910 WP_000796445.1.6292 WP_000796445.1.62955 WP_000796445.1.62983 WP_000796445.1.62988 WP_000796445.1.63045 WP_000796445.1.63063 WP_000796445.1.63102 WP_000796445.1.63129 WP_000796445.1.63181 WP_000796445.1.63203 WP_000796445.1.63229 WP_000796445.1.63250 WP_000796445.1.63256 WP_000796445.1.63290 WP_000796445.1.63358 WP_000796445.1.63382 WP_000796445.1.63432 WP_000796445.1.63461 WP_000796445.1.63479 WP_000796445.1.63497 WP_000796445.1.63509 WP_000796445.1.63529 WP_000796445.1.63577 WP_000796445.1.63585 WP_000796445.1.63603 WP_000796445.1.63664 WP_000796445.1.6370 WP_000796445.1.63718 WP_000796445.1.63748 WP_000796445.1.6375 WP_000796445.1.63757 WP_000796445.1.63766 WP_000796445.1.63781 WP_000796445.1.63797 WP_000796445.1.63834 WP_000796445.1.63851 WP_000796445.1.63863 WP_000796445.1.6399 WP_000796445.1.64010 WP_000796445.1.64018 WP_000796445.1.64046 WP_000796445.1.64085 WP_000796445.1.64109 WP_000796445.1.64121 WP_000796445.1.64157 WP_000796445.1.64229 WP_000796445.1.6423 WP_000796445.1.64244 WP_000796445.1.64350 WP_000796445.1.64385 WP_000796445.1.64387 WP_000796445.1.64403 WP_000796445.1.64412 WP_000796445.1.64462 WP_000796445.1.64500 WP_000796445.1.64597 WP_000796445.1.64649 WP_000796445.1.64702 WP_000796445.1.64711 WP_000796445.1.64757 WP_000796445.1.64781 WP_000796445.1.64831 WP_000796445.1.6489 WP_000796445.1.64894 WP_000796445.1.65011 WP_000796445.1.65018 WP_000796445.1.65028 WP_000796445.1.65171 WP_000796445.1.65248 WP_000796445.1.65269 WP_000796445.1.6535 WP_000796445.1.65357 WP_000796445.1.65474 WP_000796445.1.65572 WP_000796445.1.65601 WP_000796445.1.65633 WP_000796445.1.6565 WP_000796445.1.65696 WP_000796445.1.65698 WP_000796445.1.6575 WP_000796445.1.65771 WP_000796445.1.65782 WP_000796445.1.65790 WP_000796445.1.65881 WP_000796445.1.65883 WP_000796445.1.65901 WP_000796445.1.6594 WP_000796445.1.65940 WP_000796445.1.6595 WP_000796445.1.65956 WP_000796445.1.66049 WP_000796445.1.66122 WP_000796445.1.66171 WP_000796445.1.66289 WP_000796445.1.6630 WP_000796445.1.66314 WP_000796445.1.66315 WP_000796445.1.66330 WP_000796445.1.66358 WP_000796445.1.66362 WP_000796445.1.6638 WP_000796445.1.66385 WP_000796445.1.6640 WP_000796445.1.66400 WP_000796445.1.66428 WP_000796445.1.66446 WP_000796445.1.6647 WP_000796445.1.66539 WP_000796445.1.66600 WP_000796445.1.66678 WP_000796445.1.66698 WP_000796445.1.66733 WP_000796445.1.6680 WP_000796445.1.66824 WP_000796445.1.66834 WP_000796445.1.66901 WP_000796445.1.6692 WP_000796445.1.66937 WP_000796445.1.66959 WP_000796445.1.66962 WP_000796445.1.67037 WP_000796445.1.67045 WP_000796445.1.67075 WP_000796445.1.6710 WP_000796445.1.67100 WP_000796445.1.67173 WP_000796445.1.67181 WP_000796445.1.67235 WP_000796445.1.67268 WP_000796445.1.67279 WP_000796445.1.67347 WP_000796445.1.6739 WP_000796445.1.67465 WP_000796445.1.67552 WP_000796445.1.6760 WP_000796445.1.67682 WP_000796445.1.6782 WP_000796445.1.67829 WP_000796445.1.67887 WP_000796445.1.67932 WP_000796445.1.68073 WP_000796445.1.68140 WP_000796445.1.68159 WP_000796445.1.68201 WP_000796445.1.68206 WP_000796445.1.6827 WP_000796445.1.68275 WP_000796445.1.68401 WP_000796445.1.68477 WP_000796445.1.6849 WP_000796445.1.68547 WP_000796445.1.68589 WP_000796445.1.68652 WP_000796445.1.68655 WP_000796445.1.68656 WP_000796445.1.68677 WP_000796445.1.68778 WP_000796445.1.68787 WP_000796445.1.68893 WP_000796445.1.68894 WP_000796445.1.68895 WP_000796445.1.68928 WP_000796445.1.68975 WP_000796445.1.69001 WP_000796445.1.69006 WP_000796445.1.6904 WP_000796445.1.6907 WP_000796445.1.69080 WP_000796445.1.69086 WP_000796445.1.6913 WP_000796445.1.69131 WP_000796445.1.69146 WP_000796445.1.69151 WP_000796445.1.69236 WP_000796445.1.69255 WP_000796445.1.69273 WP_000796445.1.69357 WP_000796445.1.69359 WP_000796445.1.69397 WP_000796445.1.69485 WP_000796445.1.6954 WP_000796445.1.69564 WP_000796445.1.69575 WP_000796445.1.69616 WP_000796445.1.69644 WP_000796445.1.69704 WP_000796445.1.69754 WP_000796445.1.69758 WP_000796445.1.69767 WP_000796445.1.69890 WP_000796445.1.69965 WP_000796445.1.70088 WP_000796445.1.7021 WP_000796445.1.70241 WP_000796445.1.70269 WP_000796445.1.70272 WP_000796445.1.70289 WP_000796445.1.70303 WP_000796445.1.70440 WP_000796445.1.70447 WP_000796445.1.70485 WP_000796445.1.70531 WP_000796445.1.70596 WP_000796445.1.70643 WP_000796445.1.70678 WP_000796445.1.70683 WP_000796445.1.70785 WP_000796445.1.70837 WP_000796445.1.70883 WP_000796445.1.70922 WP_000796445.1.70929 WP_000796445.1.70948 WP_000796445.1.70959 WP_000796445.1.70977 WP_000796445.1.70985 WP_000796445.1.71010 WP_000796445.1.71023 WP_000796445.1.71116 WP_000796445.1.71146 WP_000796445.1.71165 WP_000796445.1.71172 WP_000796445.1.71184 WP_000796445.1.71188 WP_000796445.1.71201 WP_000796445.1.71202 WP_000796445.1.71243 WP_000796445.1.71305 WP_000796445.1.71306 WP_000796445.1.71337 WP_000796445.1.71363 WP_000796445.1.71378 WP_000796445.1.71401 WP_000796445.1.71407 WP_000796445.1.71481 WP_000796445.1.71500 WP_000796445.1.71600 WP_000796445.1.71626 WP_000796445.1.71636 WP_000796445.1.71649 WP_000796445.1.71691 WP_000796445.1.71702 WP_000796445.1.71750 WP_000796445.1.71798 WP_000796445.1.71845 WP_000796445.1.71881 WP_000796445.1.71908 WP_000796445.1.71952 WP_000796445.1.71973 WP_000796445.1.71979 WP_000796445.1.71984 WP_000796445.1.720 WP_000796445.1.72100 WP_000796445.1.72105 WP_000796445.1.72190 WP_000796445.1.72203 WP_000796445.1.72220 WP_000796445.1.72221 WP_000796445.1.72300 WP_000796445.1.72325 WP_000796445.1.72339 WP_000796445.1.72372 WP_000796445.1.72376 WP_000796445.1.72403 WP_000796445.1.72470 WP_000796445.1.72532 WP_000796445.1.72594 WP_000796445.1.72602 WP_000796445.1.72625 WP_000796445.1.72716 WP_000796445.1.72718 WP_000796445.1.72728 WP_000796445.1.72865 WP_000796445.1.72871 WP_000796445.1.7295 WP_000796445.1.72968 WP_000796445.1.72975 WP_000796445.1.73062 WP_000796445.1.73068 WP_000796445.1.73125 WP_000796445.1.7315 WP_000796445.1.73164 WP_000796445.1.73200 WP_000796445.1.7334 WP_000796445.1.73377 WP_000796445.1.73461 WP_000796445.1.73481 WP_000796445.1.7356 WP_000796445.1.73561 WP_000796445.1.73581 WP_000796445.1.73596 WP_000796445.1.73617 WP_000796445.1.73667 WP_000796445.1.73701 WP_000796445.1.73708 WP_000796445.1.73753 WP_000796445.1.73758 WP_000796445.1.73764 WP_000796445.1.73794 WP_000796445.1.73847 WP_000796445.1.7387 WP_000796445.1.73901 WP_000796445.1.73924 WP_000796445.1.73926 WP_000796445.1.7394 WP_000796445.1.73945 WP_000796445.1.74029 WP_000796445.1.74049 WP_000796445.1.74174 WP_000796445.1.74181 WP_000796445.1.74191 WP_000796445.1.74207 WP_000796445.1.74248 WP_000796445.1.743 WP_000796445.1.74300 WP_000796445.1.7433 WP_000796445.1.74402 WP_000796445.1.74410 WP_000796445.1.74466 WP_000796445.1.745 WP_000796445.1.74500 WP_000796445.1.74529 WP_000796445.1.74545 WP_000796445.1.74578 WP_000796445.1.74745 WP_000796445.1.7491 WP_000796445.1.74972 WP_000796445.1.75051 WP_000796445.1.75056 WP_000796445.1.75129 WP_000796445.1.75148 WP_000796445.1.75159 WP_000796445.1.75177 WP_000796445.1.75187 WP_000796445.1.75288 WP_000796445.1.75334 WP_000796445.1.75362 WP_000796445.1.75385 WP_000796445.1.75392 WP_000796445.1.75400 WP_000796445.1.75450 WP_000796445.1.7558 WP_000796445.1.75607 WP_000796445.1.75716 WP_000796445.1.75751 WP_000796445.1.75760 WP_000796445.1.75764 WP_000796445.1.75794 WP_000796445.1.75810 WP_000796445.1.75828 WP_000796445.1.75837 WP_000796445.1.75863 WP_000796445.1.75874 WP_000796445.1.75902 WP_000796445.1.75945 WP_000796445.1.76020 WP_000796445.1.76108 WP_000796445.1.76137 WP_000796445.1.76252 WP_000796445.1.76327 WP_000796445.1.76345 WP_000796445.1.76445 WP_000796445.1.76451 WP_000796445.1.76495 WP_000796445.1.7660 WP_000796445.1.76673 WP_000796445.1.76706 WP_000796445.1.76721 WP_000796445.1.76756 WP_000796445.1.76760 WP_000796445.1.76776 WP_000796445.1.76875 WP_000796445.1.76880 WP_000796445.1.76899 WP_000796445.1.76913 WP_000796445.1.76968 WP_000796445.1.77038 WP_000796445.1.77047 WP_000796445.1.77067 WP_000796445.1.77080 WP_000796445.1.7712 WP_000796445.1.77177 WP_000796445.1.77180 WP_000796445.1.77184 WP_000796445.1.77244 WP_000796445.1.77267 WP_000796445.1.77292 WP_000796445.1.77306 WP_000796445.1.77349 WP_000796445.1.77356 WP_000796445.1.77475 WP_000796445.1.77496 WP_000796445.1.77514 WP_000796445.1.77529 WP_000796445.1.77549 WP_000796445.1.77692 WP_000796445.1.77710 WP_000796445.1.7782 WP_000796445.1.77851 WP_000796445.1.77898 WP_000796445.1.77918 WP_000796445.1.7792 WP_000796445.1.7793 WP_000796445.1.77951 WP_000796445.1.77960 WP_000796445.1.77971 WP_000796445.1.77983 WP_000796445.1.77989 WP_000796445.1.7802 WP_000796445.1.78026 WP_000796445.1.78051 WP_000796445.1.78076 WP_000796445.1.78096 WP_000796445.1.78100 WP_000796445.1.78110 WP_000796445.1.78120 WP_000796445.1.78372 WP_000796445.1.78383 WP_000796445.1.78407 WP_000796445.1.78443 WP_000796445.1.78501 WP_000796445.1.78603 WP_000796445.1.7861 WP_000796445.1.78618 WP_000796445.1.78632 WP_000796445.1.78658 WP_000796445.1.78673 WP_000796445.1.78697 WP_000796445.1.78734 WP_000796445.1.78735 WP_000796445.1.7877 WP_000796445.1.78802 WP_000796445.1.78815 WP_000796445.1.78830 WP_000796445.1.78838 WP_000796445.1.78871 WP_000796445.1.78874 WP_000796445.1.78877 WP_000796445.1.78896 WP_000796445.1.78918 WP_000796445.1.78930 WP_000796445.1.79099 WP_000796445.1.79140 WP_000796445.1.79151 WP_000796445.1.79167 WP_000796445.1.79289 WP_000796445.1.79335 WP_000796445.1.79370 WP_000796445.1.79462 WP_000796445.1.79468 WP_000796445.1.79472 WP_000796445.1.79490 WP_000796445.1.79495 WP_000796445.1.79529 WP_000796445.1.79570 WP_000796445.1.79580 WP_000796445.1.79586 WP_000796445.1.7964 WP_000796445.1.79659 WP_000796445.1.79668 WP_000796445.1.79708 WP_000796445.1.79734 WP_000796445.1.79757 WP_000796445.1.7982 WP_000796445.1.79845 WP_000796445.1.7991 WP_000796445.1.80137 WP_000796445.1.80182 WP_000796445.1.80236 WP_000796445.1.80249 WP_000796445.1.80254 WP_000796445.1.80296 WP_000796445.1.80366 WP_000796445.1.80380 WP_000796445.1.80443 WP_000796445.1.80480 WP_000796445.1.80542 WP_000796445.1.80609 WP_000796445.1.80741 WP_000796445.1.80760 WP_000796445.1.80780 WP_000796445.1.80831 WP_000796445.1.80850 WP_000796445.1.80874 WP_000796445.1.80876 WP_000796445.1.80881 WP_000796445.1.80939 WP_000796445.1.8096 WP_000796445.1.81037 WP_000796445.1.8106 WP_000796445.1.81069 WP_000796445.1.81107 WP_000796445.1.81109 WP_000796445.1.81110 WP_000796445.1.81149 WP_000796445.1.81175 WP_000796445.1.8119 WP_000796445.1.81193 WP_000796445.1.81197 WP_000796445.1.81225 WP_000796445.1.8130 WP_000796445.1.81305 WP_000796445.1.81320 WP_000796445.1.81328 WP_000796445.1.8134 WP_000796445.1.81354 WP_000796445.1.81388 WP_000796445.1.81410 WP_000796445.1.81425 WP_000796445.1.81455 WP_000796445.1.81528 WP_000796445.1.81668 WP_000796445.1.81735 WP_000796445.1.81750 WP_000796445.1.81760 WP_000796445.1.81768 WP_000796445.1.81785 WP_000796445.1.81795 WP_000796445.1.81902 WP_000796445.1.81974 WP_000796445.1.82149 WP_000796445.1.82192 WP_000796445.1.82232 WP_000796445.1.82337 WP_000796445.1.82401 WP_000796445.1.82420 WP_000796445.1.82434 WP_000796445.1.82464 WP_000796445.1.8247 WP_000796445.1.82474 WP_000796445.1.82479 WP_000796445.1.82503 WP_000796445.1.82515 WP_000796445.1.82569 WP_000796445.1.82584 WP_000796445.1.82676 WP_000796445.1.82761 WP_000796445.1.8282 WP_000796445.1.82867 WP_000796445.1.82937 WP_000796445.1.82944 WP_000796445.1.82956 WP_000796445.1.83005 WP_000796445.1.83006 WP_000796445.1.83092 WP_000796445.1.83204 WP_000796445.1.83305 WP_000796445.1.83331 WP_000796445.1.83354 WP_000796445.1.83356 WP_000796445.1.83365 WP_000796445.1.83407 WP_000796445.1.83413 WP_000796445.1.83491 WP_000796445.1.83523 WP_000796445.1.8354 WP_000796445.1.83558 WP_000796445.1.83651 WP_000796445.1.83721 WP_000796445.1.83760 WP_000796445.1.8399 WP_000796445.1.83995 WP_000796445.1.84000 WP_000796445.1.84001 WP_000796445.1.84011 WP_000796445.1.84075 WP_000796445.1.84083 WP_000796445.1.84086 WP_000796445.1.84100 WP_000796445.1.84103 WP_000796445.1.84154 WP_000796445.1.8425 WP_000796445.1.84283 WP_000796445.1.84291 WP_000796445.1.84300 WP_000796445.1.84392 WP_000796445.1.84397 WP_000796445.1.8441 WP_000796445.1.84497 WP_000796445.1.84515 WP_000796445.1.84532 WP_000796445.1.84572 WP_000796445.1.84598 WP_000796445.1.84659 WP_000796445.1.84693 WP_000796445.1.84876 WP_000796445.1.84899 WP_000796445.1.8497 WP_000796445.1.84983 WP_000796445.1.85040 WP_000796445.1.85079 WP_000796445.1.85126 WP_000796445.1.85134 WP_000796445.1.85178 WP_000796445.1.85180 WP_000796445.1.85190 WP_000796445.1.8526 WP_000796445.1.85271 WP_000796445.1.85301 WP_000796445.1.8533 WP_000796445.1.8545 WP_000796445.1.85481 WP_000796445.1.85483 WP_000796445.1.85541 WP_000796445.1.8556 WP_000796445.1.85568 WP_000796445.1.85615 WP_000796445.1.85617 WP_000796445.1.85663 WP_000796445.1.85671 WP_000796445.1.85672 WP_000796445.1.85759 WP_000796445.1.85777 WP_000796445.1.85855 WP_000796445.1.85886 WP_000796445.1.85900 WP_000796445.1.85904 WP_000796445.1.85976 WP_000796445.1.85982 WP_000796445.1.86043 WP_000796445.1.86138 WP_000796445.1.86157 WP_000796445.1.86159 WP_000796445.1.8616 WP_000796445.1.86173 WP_000796445.1.86240 WP_000796445.1.86306 WP_000796445.1.86316 WP_000796445.1.86347 WP_000796445.1.86356 WP_000796445.1.86380 WP_000796445.1.86450 WP_000796445.1.86469 WP_000796445.1.8647 WP_000796445.1.86514 WP_000796445.1.86580 WP_000796445.1.86588 WP_000796445.1.86610 WP_000796445.1.86661 WP_000796445.1.8671 WP_000796445.1.8672 WP_000796445.1.8678 WP_000796445.1.86810 WP_000796445.1.8684 WP_000796445.1.86895 WP_000796445.1.86906 WP_000796445.1.86915 WP_000796445.1.87038 WP_000796445.1.87095 WP_000796445.1.87187 WP_000796445.1.87219 WP_000796445.1.87323 WP_000796445.1.8736 WP_000796445.1.87460 WP_000796445.1.87484 WP_000796445.1.87500 WP_000796445.1.87552 WP_000796445.1.87583 WP_000796445.1.87618 WP_000796445.1.87695 WP_000796445.1.87712 WP_000796445.1.87760 WP_000796445.1.87779 WP_000796445.1.87899 WP_000796445.1.87905 WP_000796445.1.8792 WP_000796445.1.87936 WP_000796445.1.87945 WP_000796445.1.88019 WP_000796445.1.88052 WP_000796445.1.88073 WP_000796445.1.8809 WP_000796445.1.88092 WP_000796445.1.88185 WP_000796445.1.88275 WP_000796445.1.88291 WP_000796445.1.88293 WP_000796445.1.88356 WP_000796445.1.8837 WP_000796445.1.88393 WP_000796445.1.88474 WP_000796445.1.88508 WP_000796445.1.88703 WP_000796445.1.88731 WP_000796445.1.88792 WP_000796445.1.88854 WP_000796445.1.88902 WP_000796445.1.8891 WP_000796445.1.88957 WP_000796445.1.88966 WP_000796445.1.88968 WP_000796445.1.88980 WP_000796445.1.88981 WP_000796445.1.88982 WP_000796445.1.88998 WP_000796445.1.89008 WP_000796445.1.89114 WP_000796445.1.89116 WP_000796445.1.89119 WP_000796445.1.89120 WP_000796445.1.89138 WP_000796445.1.89177 WP_000796445.1.89221 WP_000796445.1.89304 WP_000796445.1.89362 WP_000796445.1.89408 WP_000796445.1.89425 WP_000796445.1.89512 WP_000796445.1.89527 WP_000796445.1.89570 WP_000796445.1.89604 WP_000796445.1.89606 WP_000796445.1.8961 WP_000796445.1.89622 WP_000796445.1.89634 WP_000796445.1.89657 WP_000796445.1.89659 WP_000796445.1.89680 WP_000796445.1.89765 WP_000796445.1.89817 WP_000796445.1.89832 WP_000796445.1.89902 WP_000796445.1.89940 WP_000796445.1.8996 WP_000796445.1.9003 WP_000796445.1.90097 WP_000796445.1.90252 WP_000796445.1.90311 WP_000796445.1.90409 WP_000796445.1.90417 WP_000796445.1.90421 WP_000796445.1.90453 WP_000796445.1.90458 WP_000796445.1.90522 WP_000796445.1.90540 WP_000796445.1.90557 WP_000796445.1.90563 WP_000796445.1.90585 WP_000796445.1.90641 WP_000796445.1.90701 WP_000796445.1.90734 WP_000796445.1.90748 WP_000796445.1.90759 WP_000796445.1.90859 WP_000796445.1.90959 WP_000796445.1.90973 WP_000796445.1.90983 WP_000796445.1.91003 WP_000796445.1.91056 WP_000796445.1.91069 WP_000796445.1.91179 WP_000796445.1.91215 WP_000796445.1.91278 WP_000796445.1.9131 WP_000796445.1.9137 WP_000796445.1.91372 WP_000796445.1.91424 WP_000796445.1.91453 WP_000796445.1.91474 WP_000796445.1.91505 WP_000796445.1.91512 WP_000796445.1.91524 WP_000796445.1.91564 WP_000796445.1.91579 WP_000796445.1.91621 WP_000796445.1.91628 WP_000796445.1.91655 WP_000796445.1.91724 WP_000796445.1.91732 WP_000796445.1.91742 WP_000796445.1.91772 WP_000796445.1.91776 WP_000796445.1.91788 WP_000796445.1.91795 WP_000796445.1.91898 WP_000796445.1.91904 WP_000796445.1.91974 WP_000796445.1.92013 WP_000796445.1.92060 WP_000796445.1.92082 WP_000796445.1.92093 WP_000796445.1.92108 WP_000796445.1.92129 WP_000796445.1.92165 WP_000796445.1.92171 WP_000796445.1.92183 WP_000796445.1.92208 WP_000796445.1.9222 WP_000796445.1.92268 WP_000796445.1.92310 WP_000796445.1.92318 WP_000796445.1.92443 WP_000796445.1.92452 WP_000796445.1.92482 WP_000796445.1.92531 WP_000796445.1.92557 WP_000796445.1.92628 WP_000796445.1.92669 WP_000796445.1.92671 WP_000796445.1.92738 WP_000796445.1.92754 WP_000796445.1.92806 WP_000796445.1.92890 WP_000796445.1.92893 WP_000796445.1.92929 WP_000796445.1.93059 WP_000796445.1.93061 WP_000796445.1.93076 WP_000796445.1.93086 WP_000796445.1.93101 WP_000796445.1.93136 WP_000796445.1.93155 WP_000796445.1.93215 WP_000796445.1.93275 WP_000796445.1.93339 WP_000796445.1.93350 WP_000796445.1.93365 WP_000796445.1.93376 WP_000796445.1.93410 WP_000796445.1.93524 WP_000796445.1.93543 WP_000796445.1.93577 WP_000796445.1.93650 WP_000796445.1.93656 WP_000796445.1.93662 WP_000796445.1.937 WP_000796445.1.93705 WP_000796445.1.9380 WP_000796445.1.93804 WP_000796445.1.93809 WP_000796445.1.9389 WP_000796445.1.93937 WP_000796445.1.93994 WP_000796445.1.94072 WP_000796445.1.94162 WP_000796445.1.94168 WP_000796445.1.94198 WP_000796445.1.9432 WP_000796445.1.94354 WP_000796445.1.94380 WP_000796445.1.9440 WP_000796445.1.94412 WP_000796445.1.94458 WP_000796445.1.94473 WP_000796445.1.94565 WP_000796445.1.94584 WP_000796445.1.94598 WP_000796445.1.94649 WP_000796445.1.94655 WP_000796445.1.94670 WP_000796445.1.94796 WP_000796445.1.94817 WP_000796445.1.94835 WP_000796445.1.94959 WP_000796445.1.94983 WP_000796445.1.95051 WP_000796445.1.95085 WP_000796445.1.95121 WP_000796445.1.95248 WP_000796445.1.9527 WP_000796445.1.95277 WP_000796445.1.95282 WP_000796445.1.95298 WP_000796445.1.9530 WP_000796445.1.95388 WP_000796445.1.95434 WP_000796445.1.95447 WP_000796445.1.95456 WP_000796445.1.95546 WP_000796445.1.95558 WP_000796445.1.95607 WP_000796445.1.95630 WP_000796445.1.95656 WP_000796445.1.95670 WP_000796445.1.95691 WP_000796445.1.95744 WP_000796445.1.95757 WP_000796445.1.9586 WP_000796445.1.95866 WP_000796445.1.95911 WP_000796445.1.95939 WP_000796445.1.95963 WP_000796445.1.96004 WP_000796445.1.96107 WP_000796445.1.96139 WP_000796445.1.96141 WP_000796445.1.96162 WP_000796445.1.9624 WP_000796445.1.96317 WP_000796445.1.96340 WP_000796445.1.96343 WP_000796445.1.96348 WP_000796445.1.96349 WP_000796445.1.96380 WP_000796445.1.9644 WP_000796445.1.96469 WP_000796445.1.96490 WP_000796445.1.96497 WP_000796445.1.96500 WP_000796445.1.96521 WP_000796445.1.96537 WP_000796445.1.96555 WP_000796445.1.96563 WP_000796445.1.96584 WP_000796445.1.96588 WP_000796445.1.96732 WP_000796445.1.96735 WP_000796445.1.9674 WP_000796445.1.96771 WP_000796445.1.96876 WP_000796445.1.96993 WP_000796445.1.97015 WP_000796445.1.97047 WP_000796445.1.97103 WP_000796445.1.97143 WP_000796445.1.97145 WP_000796445.1.97190 WP_000796445.1.97297 WP_000796445.1.97318 WP_000796445.1.97322 WP_000796445.1.97328 WP_000796445.1.97369 WP_000796445.1.97477 WP_000796445.1.97487 WP_000796445.1.97547 WP_000796445.1.97597 WP_000796445.1.97613 WP_000796445.1.97620 WP_000796445.1.97631 WP_000796445.1.97648 WP_000796445.1.97656 WP_000796445.1.97704 WP_000796445.1.97727 WP_000796445.1.97732 WP_000796445.1.97736 WP_000796445.1.9774 WP_000796445.1.9775 WP_000796445.1.97800 WP_000796445.1.97846 WP_000796445.1.97907 WP_000796445.1.9793 WP_000796445.1.97981 WP_000796445.1.9799 WP_000796445.1.97991 WP_000796445.1.98006 WP_000796445.1.98019 WP_000796445.1.98022 WP_000796445.1.98110 WP_000796445.1.98119 WP_000796445.1.98146 WP_000796445.1.98170 WP_000796445.1.98219 WP_000796445.1.98236 WP_000796445.1.9826 WP_000796445.1.98338 WP_000796445.1.98402 WP_000796445.1.9841 WP_000796445.1.98440 WP_000796445.1.98472 WP_000796445.1.98495 WP_000796445.1.98531 WP_000796445.1.98570 WP_000796445.1.98577 WP_000796445.1.98676 WP_000796445.1.98677 WP_000796445.1.98726 WP_000796445.1.98760 WP_000796445.1.98763 WP_000796445.1.98843 WP_000796445.1.9898 WP_000796445.1.9899 WP_000796445.1.99057 WP_000796445.1.99072 WP_000796445.1.99097 WP_000796445.1.99098 WP_000796445.1.99164 WP_000796445.1.99184 WP_000796445.1.99215 WP_000796445.1.99267 WP_000796445.1.99276 WP_000796445.1.99456 WP_000796445.1.99490 WP_000796445.1.99493 WP_000796445.1.99577 WP_000796445.1.99613 WP_000796445.1.99626 WP_000796445.1.99630 WP_000796445.1.99646 WP_000796445.1.99657 WP_000796445.1.99660 WP_000796445.1.99712 WP_000796445.1.99813 WP_000796445.1.99824 WP_000796445.1.99858 WP_000796445.1.99889 WP_000796445.1.99924 WP_000796445.1.99958 WP_000796445.1.99961 gi|525841107|ref|YP_008256697.1| gi|537435496|ref|YP_008479873.1| gi|194448105|ref|YP_002044096.1| gi|378982667|ref|YP_005245822.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]