SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378448429|ref|YP_005235788.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378448429|ref|YP_005235788.1|
Domain Number 1 Region: 105-322
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, catalytic domain 2.49e-73
Family MurCDEF 0.0000000903
Further Details:      
 
Domain Number 2 Region: 323-476
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, peptide-binding domain 2.01e-44
Family MurCDEF C-terminal domain 0.00000202
Further Details:      
 
Domain Number 3 Region: 20-106
Classification Level Classification E-value
Superfamily MurCD N-terminal domain 3.4e-29
Family MurCD N-terminal domain 0.0000473
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|378448429|ref|YP_005235788.1|
Sequence length 491
Comment UDP-N-acetylmuramate--L-alanine ligase [Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S]
Sequence
MNTQQLAKLRSIVPEMRRVRHIHFVGIGGAGMGGIAEVLANEGYQISGSDLAPNPVTQQL
TSLGATIFFNHRPENVRDASVVVVSSAISADNPEIVAAHEARIPVIRRAEMLAELMRFRH
GIAIAGTHGKTTTTAMVSSIYAEAGLDPTFVNGGLVKAAGVHARLGHSRYLIAEADESDA
SFLHLQPMVAIVTNIEADHMDTYHGDFENLKQTFINFLHNLPFYGRAVMCVDDPVIRELL
PRVGRQTTTYGFSEDADVRVEDYQQIGPQGHFTLLRQGMPDLHVTLNAPGRHNALNAAAA
VAVATEEGIADDAILRALESFQGTGRRFDFLGEFPLEPVNGKAGTAMLVDDYGHHPTEVD
ATIKAARAGWPDKNLVMLFQPHRYTRTRDLYDDFANVLTQVDALLMLDVYPAGEAPIPGA
DSRSLCRTIRNRGKIDPILVSDPAQVATMLAPVLTGNDLILVQGAGNVGKIARYLSEIKL
KPQIQEEEQHG
Download sequence
Identical sequences A0A0D6HJ05 A0A0F6AWS1 A0A0F7J3D0 A0A0H3N932 A0A0L9F389 A0A0M0PMZ3 A0A0U1IGS8 A0A1C2ZP99 A0A1S0ZB66 A0A1Z3QC49 A0A221YUD6 A0A265B1Z3 A0A271CK03 A0A2D3AKV7 A0A2H9YG67 A0A2I6MCF0 A0A2I6MQ52 A0A2I6NV29 A9MZM0 B4TJ88 B4TXH9 E8XH40 Q8ZRU2 V7V349
gi|194734645|ref|YP_002113147.1| gi|526219081|ref|YP_008264388.1| ABAK02000001|CDS_4289455-4290930 ABAM02000001|CDS_652437-653912 ABAO01000001|CDS_197433-198908 ABEH02000001|CDS_546328-547803 ABEI01000003|CDS_191734-193209 ABEJ01000001|CDS_329045-330520 ABEL01000008|CDS_89148-87673 ABFF01000009|CDS_105705-104230 ABFH02000001|CDS_147990-146515 AE006468|CDS_151143-152618 CP000886|CDS_145251-146726 CP001120|CDS_146342-147817 CP001127|CDS_151035-152510 CP001363|CDS_151855-153330 FN424405|CDS_151144-152619 IDP00906 gi|378448429|ref|YP_005235788.1| NP_459134.1.58477 WP_001096070.1.100010 WP_001096070.1.100129 WP_001096070.1.100137 WP_001096070.1.100234 WP_001096070.1.100258 WP_001096070.1.100376 WP_001096070.1.100424 WP_001096070.1.100436 WP_001096070.1.100484 WP_001096070.1.100488 WP_001096070.1.100521 WP_001096070.1.100589 WP_001096070.1.100597 WP_001096070.1.100642 WP_001096070.1.100650 WP_001096070.1.100714 WP_001096070.1.100730 WP_001096070.1.10074 WP_001096070.1.10076 WP_001096070.1.100781 WP_001096070.1.100793 WP_001096070.1.100814 WP_001096070.1.100869 WP_001096070.1.100871 WP_001096070.1.100882 WP_001096070.1.100886 WP_001096070.1.100944 WP_001096070.1.100948 WP_001096070.1.101007 WP_001096070.1.101020 WP_001096070.1.101074 WP_001096070.1.101078 WP_001096070.1.101126 WP_001096070.1.101147 WP_001096070.1.101180 WP_001096070.1.101185 WP_001096070.1.101259 WP_001096070.1.101284 WP_001096070.1.101291 WP_001096070.1.1013 WP_001096070.1.101320 WP_001096070.1.101353 WP_001096070.1.101386 WP_001096070.1.101404 WP_001096070.1.101420 WP_001096070.1.101425 WP_001096070.1.101454 WP_001096070.1.101519 WP_001096070.1.101589 WP_001096070.1.101636 WP_001096070.1.10164 WP_001096070.1.101707 WP_001096070.1.101734 WP_001096070.1.10177 WP_001096070.1.101839 WP_001096070.1.101868 WP_001096070.1.101878 WP_001096070.1.101949 WP_001096070.1.101953 WP_001096070.1.102009 WP_001096070.1.102103 WP_001096070.1.10220 WP_001096070.1.10231 WP_001096070.1.10266 WP_001096070.1.10293 WP_001096070.1.10429 WP_001096070.1.10439 WP_001096070.1.10566 WP_001096070.1.10678 WP_001096070.1.10753 WP_001096070.1.10992 WP_001096070.1.11000 WP_001096070.1.11024 WP_001096070.1.11031 WP_001096070.1.11098 WP_001096070.1.1110 WP_001096070.1.11156 WP_001096070.1.11168 WP_001096070.1.11190 WP_001096070.1.11295 WP_001096070.1.113 WP_001096070.1.11362 WP_001096070.1.11444 WP_001096070.1.11455 WP_001096070.1.11458 WP_001096070.1.11479 WP_001096070.1.11511 WP_001096070.1.11518 WP_001096070.1.11532 WP_001096070.1.11543 WP_001096070.1.11588 WP_001096070.1.11603 WP_001096070.1.11677 WP_001096070.1.11681 WP_001096070.1.11687 WP_001096070.1.11735 WP_001096070.1.11763 WP_001096070.1.11772 WP_001096070.1.11834 WP_001096070.1.11865 WP_001096070.1.11868 WP_001096070.1.11897 WP_001096070.1.11964 WP_001096070.1.12017 WP_001096070.1.12025 WP_001096070.1.12114 WP_001096070.1.12144 WP_001096070.1.12159 WP_001096070.1.12282 WP_001096070.1.12351 WP_001096070.1.12370 WP_001096070.1.12472 WP_001096070.1.12546 WP_001096070.1.1264 WP_001096070.1.12701 WP_001096070.1.12718 WP_001096070.1.12728 WP_001096070.1.12877 WP_001096070.1.12879 WP_001096070.1.12936 WP_001096070.1.12995 WP_001096070.1.13027 WP_001096070.1.13101 WP_001096070.1.13106 WP_001096070.1.13130 WP_001096070.1.13207 WP_001096070.1.13311 WP_001096070.1.13334 WP_001096070.1.13414 WP_001096070.1.13488 WP_001096070.1.13509 WP_001096070.1.13528 WP_001096070.1.13661 WP_001096070.1.13669 WP_001096070.1.13691 WP_001096070.1.13741 WP_001096070.1.13764 WP_001096070.1.13799 WP_001096070.1.13827 WP_001096070.1.13857 WP_001096070.1.1387 WP_001096070.1.13908 WP_001096070.1.13932 WP_001096070.1.13968 WP_001096070.1.14001 WP_001096070.1.14011 WP_001096070.1.14050 WP_001096070.1.14056 WP_001096070.1.14111 WP_001096070.1.14151 WP_001096070.1.14239 WP_001096070.1.14296 WP_001096070.1.14320 WP_001096070.1.14369 WP_001096070.1.14379 WP_001096070.1.1440 WP_001096070.1.14406 WP_001096070.1.14410 WP_001096070.1.14436 WP_001096070.1.14446 WP_001096070.1.14458 WP_001096070.1.14466 WP_001096070.1.14495 WP_001096070.1.14505 WP_001096070.1.14519 WP_001096070.1.14524 WP_001096070.1.14554 WP_001096070.1.14618 WP_001096070.1.14725 WP_001096070.1.14737 WP_001096070.1.14852 WP_001096070.1.14876 WP_001096070.1.1489 WP_001096070.1.14927 WP_001096070.1.14932 WP_001096070.1.14964 WP_001096070.1.15046 WP_001096070.1.15054 WP_001096070.1.15055 WP_001096070.1.15079 WP_001096070.1.15124 WP_001096070.1.15223 WP_001096070.1.15226 WP_001096070.1.15316 WP_001096070.1.15369 WP_001096070.1.1540 WP_001096070.1.15508 WP_001096070.1.1551 WP_001096070.1.15627 WP_001096070.1.15784 WP_001096070.1.15830 WP_001096070.1.15862 WP_001096070.1.15909 WP_001096070.1.15910 WP_001096070.1.15922 WP_001096070.1.15986 WP_001096070.1.16000 WP_001096070.1.16004 WP_001096070.1.16047 WP_001096070.1.16062 WP_001096070.1.16063 WP_001096070.1.16103 WP_001096070.1.16201 WP_001096070.1.16226 WP_001096070.1.16233 WP_001096070.1.16244 WP_001096070.1.16273 WP_001096070.1.16284 WP_001096070.1.16328 WP_001096070.1.1635 WP_001096070.1.16361 WP_001096070.1.16468 WP_001096070.1.16525 WP_001096070.1.16551 WP_001096070.1.16614 WP_001096070.1.16650 WP_001096070.1.16686 WP_001096070.1.16691 WP_001096070.1.167 WP_001096070.1.16732 WP_001096070.1.16735 WP_001096070.1.16736 WP_001096070.1.16786 WP_001096070.1.16804 WP_001096070.1.16846 WP_001096070.1.16858 WP_001096070.1.16873 WP_001096070.1.16896 WP_001096070.1.16903 WP_001096070.1.16916 WP_001096070.1.16942 WP_001096070.1.16944 WP_001096070.1.16965 WP_001096070.1.1700 WP_001096070.1.17270 WP_001096070.1.17307 WP_001096070.1.1737 WP_001096070.1.174 WP_001096070.1.17480 WP_001096070.1.1749 WP_001096070.1.17546 WP_001096070.1.1757 WP_001096070.1.17629 WP_001096070.1.17702 WP_001096070.1.17705 WP_001096070.1.17743 WP_001096070.1.17747 WP_001096070.1.17865 WP_001096070.1.17891 WP_001096070.1.1798 WP_001096070.1.18019 WP_001096070.1.18103 WP_001096070.1.18111 WP_001096070.1.18122 WP_001096070.1.1814 WP_001096070.1.18163 WP_001096070.1.1818 WP_001096070.1.18249 WP_001096070.1.1825 WP_001096070.1.18254 WP_001096070.1.18265 WP_001096070.1.18267 WP_001096070.1.18277 WP_001096070.1.18282 WP_001096070.1.18365 WP_001096070.1.18468 WP_001096070.1.18607 WP_001096070.1.18705 WP_001096070.1.18715 WP_001096070.1.18776 WP_001096070.1.18822 WP_001096070.1.18881 WP_001096070.1.18895 WP_001096070.1.18949 WP_001096070.1.19053 WP_001096070.1.19174 WP_001096070.1.19240 WP_001096070.1.19273 WP_001096070.1.19291 WP_001096070.1.19320 WP_001096070.1.19340 WP_001096070.1.19405 WP_001096070.1.19458 WP_001096070.1.19460 WP_001096070.1.19461 WP_001096070.1.1954 WP_001096070.1.19588 WP_001096070.1.19614 WP_001096070.1.19616 WP_001096070.1.19642 WP_001096070.1.1968 WP_001096070.1.19702 WP_001096070.1.19706 WP_001096070.1.19724 WP_001096070.1.19740 WP_001096070.1.19749 WP_001096070.1.19784 WP_001096070.1.19793 WP_001096070.1.19802 WP_001096070.1.19809 WP_001096070.1.19867 WP_001096070.1.19884 WP_001096070.1.19970 WP_001096070.1.19975 WP_001096070.1.1998 WP_001096070.1.19987 WP_001096070.1.20 WP_001096070.1.2010 WP_001096070.1.20212 WP_001096070.1.20266 WP_001096070.1.20271 WP_001096070.1.20330 WP_001096070.1.20349 WP_001096070.1.20362 WP_001096070.1.20415 WP_001096070.1.20418 WP_001096070.1.20443 WP_001096070.1.20446 WP_001096070.1.20525 WP_001096070.1.2054 WP_001096070.1.20553 WP_001096070.1.20614 WP_001096070.1.20626 WP_001096070.1.20646 WP_001096070.1.20760 WP_001096070.1.20810 WP_001096070.1.20862 WP_001096070.1.20886 WP_001096070.1.20900 WP_001096070.1.20908 WP_001096070.1.21049 WP_001096070.1.21136 WP_001096070.1.21146 WP_001096070.1.21181 WP_001096070.1.21245 WP_001096070.1.21246 WP_001096070.1.21260 WP_001096070.1.21269 WP_001096070.1.21286 WP_001096070.1.2130 WP_001096070.1.21351 WP_001096070.1.21399 WP_001096070.1.21400 WP_001096070.1.21443 WP_001096070.1.21453 WP_001096070.1.2146 WP_001096070.1.21473 WP_001096070.1.21497 WP_001096070.1.21499 WP_001096070.1.21548 WP_001096070.1.21603 WP_001096070.1.21728 WP_001096070.1.21730 WP_001096070.1.21751 WP_001096070.1.21757 WP_001096070.1.21877 WP_001096070.1.21910 WP_001096070.1.21991 WP_001096070.1.22024 WP_001096070.1.2205 WP_001096070.1.22062 WP_001096070.1.22067 WP_001096070.1.22069 WP_001096070.1.22205 WP_001096070.1.2221 WP_001096070.1.22235 WP_001096070.1.2235 WP_001096070.1.22379 WP_001096070.1.22388 WP_001096070.1.22427 WP_001096070.1.2246 WP_001096070.1.22485 WP_001096070.1.22537 WP_001096070.1.22565 WP_001096070.1.22575 WP_001096070.1.22620 WP_001096070.1.22692 WP_001096070.1.2283 WP_001096070.1.22855 WP_001096070.1.22864 WP_001096070.1.22870 WP_001096070.1.22966 WP_001096070.1.22979 WP_001096070.1.23053 WP_001096070.1.23102 WP_001096070.1.23114 WP_001096070.1.2314 WP_001096070.1.23172 WP_001096070.1.23175 WP_001096070.1.23192 WP_001096070.1.23201 WP_001096070.1.23259 WP_001096070.1.23311 WP_001096070.1.23343 WP_001096070.1.23379 WP_001096070.1.23409 WP_001096070.1.23444 WP_001096070.1.23460 WP_001096070.1.23472 WP_001096070.1.23482 WP_001096070.1.23500 WP_001096070.1.23509 WP_001096070.1.23621 WP_001096070.1.23634 WP_001096070.1.2364 WP_001096070.1.23646 WP_001096070.1.237 WP_001096070.1.23707 WP_001096070.1.23720 WP_001096070.1.23755 WP_001096070.1.2380 WP_001096070.1.23932 WP_001096070.1.23959 WP_001096070.1.24017 WP_001096070.1.24082 WP_001096070.1.24206 WP_001096070.1.24259 WP_001096070.1.24308 WP_001096070.1.24412 WP_001096070.1.24450 WP_001096070.1.24521 WP_001096070.1.24567 WP_001096070.1.24578 WP_001096070.1.24686 WP_001096070.1.24727 WP_001096070.1.24737 WP_001096070.1.24779 WP_001096070.1.24839 WP_001096070.1.24995 WP_001096070.1.25008 WP_001096070.1.25015 WP_001096070.1.25064 WP_001096070.1.25119 WP_001096070.1.25206 WP_001096070.1.25397 WP_001096070.1.25405 WP_001096070.1.25454 WP_001096070.1.25493 WP_001096070.1.25498 WP_001096070.1.2554 WP_001096070.1.25596 WP_001096070.1.25668 WP_001096070.1.25690 WP_001096070.1.2570 WP_001096070.1.25708 WP_001096070.1.25740 WP_001096070.1.25814 WP_001096070.1.25928 WP_001096070.1.25988 WP_001096070.1.26213 WP_001096070.1.26282 WP_001096070.1.26311 WP_001096070.1.26319 WP_001096070.1.26429 WP_001096070.1.26440 WP_001096070.1.26493 WP_001096070.1.26551 WP_001096070.1.26563 WP_001096070.1.26567 WP_001096070.1.2667 WP_001096070.1.26741 WP_001096070.1.26758 WP_001096070.1.26833 WP_001096070.1.26882 WP_001096070.1.26892 WP_001096070.1.26919 WP_001096070.1.27010 WP_001096070.1.27055 WP_001096070.1.27072 WP_001096070.1.27084 WP_001096070.1.27122 WP_001096070.1.27169 WP_001096070.1.27173 WP_001096070.1.27206 WP_001096070.1.27223 WP_001096070.1.27423 WP_001096070.1.27535 WP_001096070.1.27544 WP_001096070.1.27561 WP_001096070.1.2763 WP_001096070.1.27655 WP_001096070.1.27665 WP_001096070.1.27707 WP_001096070.1.27713 WP_001096070.1.27761 WP_001096070.1.2777 WP_001096070.1.27857 WP_001096070.1.27977 WP_001096070.1.28032 WP_001096070.1.2806 WP_001096070.1.28073 WP_001096070.1.28094 WP_001096070.1.28116 WP_001096070.1.28126 WP_001096070.1.28170 WP_001096070.1.28174 WP_001096070.1.28267 WP_001096070.1.28302 WP_001096070.1.2835 WP_001096070.1.28370 WP_001096070.1.28538 WP_001096070.1.28575 WP_001096070.1.28625 WP_001096070.1.28655 WP_001096070.1.28673 WP_001096070.1.28694 WP_001096070.1.28776 WP_001096070.1.2879 WP_001096070.1.28830 WP_001096070.1.2890 WP_001096070.1.28902 WP_001096070.1.28921 WP_001096070.1.28938 WP_001096070.1.28946 WP_001096070.1.28948 WP_001096070.1.28963 WP_001096070.1.29006 WP_001096070.1.29010 WP_001096070.1.29099 WP_001096070.1.2910 WP_001096070.1.29113 WP_001096070.1.29255 WP_001096070.1.29349 WP_001096070.1.29509 WP_001096070.1.29588 WP_001096070.1.29593 WP_001096070.1.29601 WP_001096070.1.29606 WP_001096070.1.29615 WP_001096070.1.29619 WP_001096070.1.29704 WP_001096070.1.29827 WP_001096070.1.29898 WP_001096070.1.29969 WP_001096070.1.29990 WP_001096070.1.30006 WP_001096070.1.30018 WP_001096070.1.30022 WP_001096070.1.30027 WP_001096070.1.30093 WP_001096070.1.30170 WP_001096070.1.30180 WP_001096070.1.30195 WP_001096070.1.30202 WP_001096070.1.30213 WP_001096070.1.30225 WP_001096070.1.30246 WP_001096070.1.30389 WP_001096070.1.30425 WP_001096070.1.30469 WP_001096070.1.30505 WP_001096070.1.30507 WP_001096070.1.30535 WP_001096070.1.30547 WP_001096070.1.30635 WP_001096070.1.3066 WP_001096070.1.3068 WP_001096070.1.30794 WP_001096070.1.30802 WP_001096070.1.30823 WP_001096070.1.30833 WP_001096070.1.30835 WP_001096070.1.3089 WP_001096070.1.30934 WP_001096070.1.30972 WP_001096070.1.31 WP_001096070.1.31011 WP_001096070.1.31042 WP_001096070.1.31092 WP_001096070.1.31122 WP_001096070.1.3113 WP_001096070.1.3114 WP_001096070.1.31185 WP_001096070.1.3119 WP_001096070.1.31190 WP_001096070.1.31195 WP_001096070.1.31196 WP_001096070.1.31198 WP_001096070.1.31219 WP_001096070.1.3127 WP_001096070.1.31281 WP_001096070.1.31362 WP_001096070.1.31451 WP_001096070.1.31504 WP_001096070.1.31515 WP_001096070.1.31578 WP_001096070.1.31658 WP_001096070.1.31665 WP_001096070.1.3185 WP_001096070.1.31940 WP_001096070.1.31952 WP_001096070.1.31967 WP_001096070.1.31972 WP_001096070.1.32038 WP_001096070.1.32054 WP_001096070.1.32056 WP_001096070.1.32170 WP_001096070.1.32192 WP_001096070.1.32206 WP_001096070.1.32260 WP_001096070.1.32277 WP_001096070.1.32357 WP_001096070.1.32368 WP_001096070.1.32438 WP_001096070.1.32459 WP_001096070.1.32491 WP_001096070.1.32515 WP_001096070.1.32527 WP_001096070.1.32545 WP_001096070.1.32629 WP_001096070.1.32643 WP_001096070.1.32660 WP_001096070.1.32702 WP_001096070.1.32714 WP_001096070.1.32786 WP_001096070.1.32804 WP_001096070.1.32860 WP_001096070.1.32907 WP_001096070.1.32930 WP_001096070.1.33030 WP_001096070.1.3304 WP_001096070.1.33106 WP_001096070.1.33114 WP_001096070.1.33127 WP_001096070.1.33143 WP_001096070.1.33248 WP_001096070.1.33261 WP_001096070.1.333 WP_001096070.1.33492 WP_001096070.1.33553 WP_001096070.1.33580 WP_001096070.1.33592 WP_001096070.1.33693 WP_001096070.1.33817 WP_001096070.1.33894 WP_001096070.1.3394 WP_001096070.1.3395 WP_001096070.1.33986 WP_001096070.1.34022 WP_001096070.1.34043 WP_001096070.1.34075 WP_001096070.1.34184 WP_001096070.1.34257 WP_001096070.1.34279 WP_001096070.1.34319 WP_001096070.1.34417 WP_001096070.1.34453 WP_001096070.1.34458 WP_001096070.1.34610 WP_001096070.1.34647 WP_001096070.1.34703 WP_001096070.1.34707 WP_001096070.1.34745 WP_001096070.1.3476 WP_001096070.1.34801 WP_001096070.1.34817 WP_001096070.1.34854 WP_001096070.1.34856 WP_001096070.1.34972 WP_001096070.1.34975 WP_001096070.1.34977 WP_001096070.1.35035 WP_001096070.1.35045 WP_001096070.1.35075 WP_001096070.1.35125 WP_001096070.1.35129 WP_001096070.1.35184 WP_001096070.1.35193 WP_001096070.1.35294 WP_001096070.1.35404 WP_001096070.1.35408 WP_001096070.1.35425 WP_001096070.1.35429 WP_001096070.1.35446 WP_001096070.1.35460 WP_001096070.1.35463 WP_001096070.1.35503 WP_001096070.1.35509 WP_001096070.1.35590 WP_001096070.1.3566 WP_001096070.1.35892 WP_001096070.1.35940 WP_001096070.1.36003 WP_001096070.1.3601 WP_001096070.1.36017 WP_001096070.1.36236 WP_001096070.1.36425 WP_001096070.1.36547 WP_001096070.1.36564 WP_001096070.1.36592 WP_001096070.1.36609 WP_001096070.1.36652 WP_001096070.1.36690 WP_001096070.1.3670 WP_001096070.1.36705 WP_001096070.1.36839 WP_001096070.1.3688 WP_001096070.1.36899 WP_001096070.1.36918 WP_001096070.1.36931 WP_001096070.1.37028 WP_001096070.1.37063 WP_001096070.1.37073 WP_001096070.1.37100 WP_001096070.1.37111 WP_001096070.1.37112 WP_001096070.1.37256 WP_001096070.1.37293 WP_001096070.1.37351 WP_001096070.1.37370 WP_001096070.1.37376 WP_001096070.1.3744 WP_001096070.1.37478 WP_001096070.1.37498 WP_001096070.1.37504 WP_001096070.1.3751 WP_001096070.1.37521 WP_001096070.1.37610 WP_001096070.1.37618 WP_001096070.1.37687 WP_001096070.1.37719 WP_001096070.1.37808 WP_001096070.1.37968 WP_001096070.1.37978 WP_001096070.1.38125 WP_001096070.1.38145 WP_001096070.1.383 WP_001096070.1.38322 WP_001096070.1.38349 WP_001096070.1.38393 WP_001096070.1.38408 WP_001096070.1.3848 WP_001096070.1.38512 WP_001096070.1.38569 WP_001096070.1.38613 WP_001096070.1.38622 WP_001096070.1.38673 WP_001096070.1.3869 WP_001096070.1.38693 WP_001096070.1.38773 WP_001096070.1.38781 WP_001096070.1.38797 WP_001096070.1.38830 WP_001096070.1.38882 WP_001096070.1.38913 WP_001096070.1.39003 WP_001096070.1.39059 WP_001096070.1.39075 WP_001096070.1.39128 WP_001096070.1.39136 WP_001096070.1.39146 WP_001096070.1.39197 WP_001096070.1.39229 WP_001096070.1.39275 WP_001096070.1.39405 WP_001096070.1.39420 WP_001096070.1.39449 WP_001096070.1.39512 WP_001096070.1.39553 WP_001096070.1.39556 WP_001096070.1.39584 WP_001096070.1.39609 WP_001096070.1.39629 WP_001096070.1.39723 WP_001096070.1.39724 WP_001096070.1.39763 WP_001096070.1.39808 WP_001096070.1.39862 WP_001096070.1.39921 WP_001096070.1.39923 WP_001096070.1.40017 WP_001096070.1.40025 WP_001096070.1.40072 WP_001096070.1.40073 WP_001096070.1.4011 WP_001096070.1.40170 WP_001096070.1.40205 WP_001096070.1.40208 WP_001096070.1.40229 WP_001096070.1.40240 WP_001096070.1.40257 WP_001096070.1.40258 WP_001096070.1.40292 WP_001096070.1.40305 WP_001096070.1.40311 WP_001096070.1.40341 WP_001096070.1.40380 WP_001096070.1.40395 WP_001096070.1.40465 WP_001096070.1.40508 WP_001096070.1.40583 WP_001096070.1.40693 WP_001096070.1.40710 WP_001096070.1.40722 WP_001096070.1.4075 WP_001096070.1.4087 WP_001096070.1.40877 WP_001096070.1.4088 WP_001096070.1.40935 WP_001096070.1.40996 WP_001096070.1.41017 WP_001096070.1.41018 WP_001096070.1.41086 WP_001096070.1.41091 WP_001096070.1.41226 WP_001096070.1.41279 WP_001096070.1.41516 WP_001096070.1.41554 WP_001096070.1.41572 WP_001096070.1.41591 WP_001096070.1.41662 WP_001096070.1.41708 WP_001096070.1.41761 WP_001096070.1.41859 WP_001096070.1.41862 WP_001096070.1.41877 WP_001096070.1.41882 WP_001096070.1.41904 WP_001096070.1.41931 WP_001096070.1.41979 WP_001096070.1.41985 WP_001096070.1.41994 WP_001096070.1.42104 WP_001096070.1.42109 WP_001096070.1.42156 WP_001096070.1.4222 WP_001096070.1.42243 WP_001096070.1.42244 WP_001096070.1.42320 WP_001096070.1.42342 WP_001096070.1.42356 WP_001096070.1.4239 WP_001096070.1.42422 WP_001096070.1.42433 WP_001096070.1.42444 WP_001096070.1.42489 WP_001096070.1.42655 WP_001096070.1.42676 WP_001096070.1.4276 WP_001096070.1.42767 WP_001096070.1.42794 WP_001096070.1.42864 WP_001096070.1.4288 WP_001096070.1.42978 WP_001096070.1.43018 WP_001096070.1.43041 WP_001096070.1.43077 WP_001096070.1.43086 WP_001096070.1.43126 WP_001096070.1.43160 WP_001096070.1.43244 WP_001096070.1.43258 WP_001096070.1.43276 WP_001096070.1.43312 WP_001096070.1.4332 WP_001096070.1.43334 WP_001096070.1.43339 WP_001096070.1.43351 WP_001096070.1.43371 WP_001096070.1.43437 WP_001096070.1.43441 WP_001096070.1.43476 WP_001096070.1.43520 WP_001096070.1.43522 WP_001096070.1.43535 WP_001096070.1.43606 WP_001096070.1.43613 WP_001096070.1.43654 WP_001096070.1.43668 WP_001096070.1.43778 WP_001096070.1.43839 WP_001096070.1.43886 WP_001096070.1.43951 WP_001096070.1.43954 WP_001096070.1.44005 WP_001096070.1.44043 WP_001096070.1.44099 WP_001096070.1.44113 WP_001096070.1.44121 WP_001096070.1.44291 WP_001096070.1.44300 WP_001096070.1.44310 WP_001096070.1.44339 WP_001096070.1.44386 WP_001096070.1.44433 WP_001096070.1.44479 WP_001096070.1.44640 WP_001096070.1.4467 WP_001096070.1.44747 WP_001096070.1.4485 WP_001096070.1.44877 WP_001096070.1.449 WP_001096070.1.44927 WP_001096070.1.44933 WP_001096070.1.44971 WP_001096070.1.44985 WP_001096070.1.44998 WP_001096070.1.45045 WP_001096070.1.45067 WP_001096070.1.45074 WP_001096070.1.45079 WP_001096070.1.45098 WP_001096070.1.45145 WP_001096070.1.45154 WP_001096070.1.45177 WP_001096070.1.45184 WP_001096070.1.45229 WP_001096070.1.45259 WP_001096070.1.45344 WP_001096070.1.45349 WP_001096070.1.45365 WP_001096070.1.4540 WP_001096070.1.45402 WP_001096070.1.45434 WP_001096070.1.45522 WP_001096070.1.45550 WP_001096070.1.45582 WP_001096070.1.45585 WP_001096070.1.45622 WP_001096070.1.45660 WP_001096070.1.45690 WP_001096070.1.45781 WP_001096070.1.45797 WP_001096070.1.458 WP_001096070.1.45848 WP_001096070.1.45984 WP_001096070.1.46011 WP_001096070.1.46069 WP_001096070.1.46091 WP_001096070.1.46112 WP_001096070.1.46173 WP_001096070.1.46174 WP_001096070.1.46187 WP_001096070.1.46205 WP_001096070.1.46278 WP_001096070.1.46303 WP_001096070.1.46323 WP_001096070.1.46434 WP_001096070.1.46572 WP_001096070.1.46595 WP_001096070.1.46620 WP_001096070.1.46675 WP_001096070.1.46804 WP_001096070.1.46930 WP_001096070.1.47005 WP_001096070.1.47008 WP_001096070.1.47057 WP_001096070.1.47058 WP_001096070.1.47214 WP_001096070.1.47389 WP_001096070.1.47429 WP_001096070.1.47448 WP_001096070.1.4747 WP_001096070.1.47472 WP_001096070.1.47478 WP_001096070.1.47506 WP_001096070.1.47579 WP_001096070.1.47621 WP_001096070.1.4770 WP_001096070.1.4775 WP_001096070.1.47799 WP_001096070.1.47928 WP_001096070.1.48124 WP_001096070.1.48242 WP_001096070.1.48253 WP_001096070.1.48262 WP_001096070.1.483 WP_001096070.1.48367 WP_001096070.1.48377 WP_001096070.1.48493 WP_001096070.1.4853 WP_001096070.1.48647 WP_001096070.1.48788 WP_001096070.1.4885 WP_001096070.1.48894 WP_001096070.1.48918 WP_001096070.1.48919 WP_001096070.1.48931 WP_001096070.1.49012 WP_001096070.1.49084 WP_001096070.1.49090 WP_001096070.1.49113 WP_001096070.1.49155 WP_001096070.1.49204 WP_001096070.1.49239 WP_001096070.1.49256 WP_001096070.1.49276 WP_001096070.1.49290 WP_001096070.1.49340 WP_001096070.1.49358 WP_001096070.1.49366 WP_001096070.1.49375 WP_001096070.1.49443 WP_001096070.1.49490 WP_001096070.1.49515 WP_001096070.1.49572 WP_001096070.1.49686 WP_001096070.1.49778 WP_001096070.1.49780 WP_001096070.1.4979 WP_001096070.1.49803 WP_001096070.1.49805 WP_001096070.1.49827 WP_001096070.1.49929 WP_001096070.1.50 WP_001096070.1.50080 WP_001096070.1.50161 WP_001096070.1.50211 WP_001096070.1.50238 WP_001096070.1.50251 WP_001096070.1.50389 WP_001096070.1.50404 WP_001096070.1.50480 WP_001096070.1.50576 WP_001096070.1.50676 WP_001096070.1.50769 WP_001096070.1.50774 WP_001096070.1.50782 WP_001096070.1.50804 WP_001096070.1.50808 WP_001096070.1.50811 WP_001096070.1.5088 WP_001096070.1.50893 WP_001096070.1.50908 WP_001096070.1.50918 WP_001096070.1.50941 WP_001096070.1.50999 WP_001096070.1.51014 WP_001096070.1.51022 WP_001096070.1.51066 WP_001096070.1.51179 WP_001096070.1.51182 WP_001096070.1.51186 WP_001096070.1.51224 WP_001096070.1.51414 WP_001096070.1.51464 WP_001096070.1.51487 WP_001096070.1.51488 WP_001096070.1.51594 WP_001096070.1.51634 WP_001096070.1.51649 WP_001096070.1.51686 WP_001096070.1.51756 WP_001096070.1.51831 WP_001096070.1.51841 WP_001096070.1.51888 WP_001096070.1.51911 WP_001096070.1.51932 WP_001096070.1.51989 WP_001096070.1.52121 WP_001096070.1.52148 WP_001096070.1.52170 WP_001096070.1.52336 WP_001096070.1.52346 WP_001096070.1.52353 WP_001096070.1.52361 WP_001096070.1.52456 WP_001096070.1.52527 WP_001096070.1.52608 WP_001096070.1.52653 WP_001096070.1.52656 WP_001096070.1.52675 WP_001096070.1.52692 WP_001096070.1.52743 WP_001096070.1.52744 WP_001096070.1.52824 WP_001096070.1.52851 WP_001096070.1.52857 WP_001096070.1.52866 WP_001096070.1.52898 WP_001096070.1.52915 WP_001096070.1.52949 WP_001096070.1.5301 WP_001096070.1.53190 WP_001096070.1.53203 WP_001096070.1.53272 WP_001096070.1.53286 WP_001096070.1.53328 WP_001096070.1.53406 WP_001096070.1.53436 WP_001096070.1.53466 WP_001096070.1.53529 WP_001096070.1.53543 WP_001096070.1.53688 WP_001096070.1.53757 WP_001096070.1.53812 WP_001096070.1.53905 WP_001096070.1.54033 WP_001096070.1.54075 WP_001096070.1.54136 WP_001096070.1.54159 WP_001096070.1.54196 WP_001096070.1.542 WP_001096070.1.54209 WP_001096070.1.54271 WP_001096070.1.54273 WP_001096070.1.54274 WP_001096070.1.54319 WP_001096070.1.54364 WP_001096070.1.54400 WP_001096070.1.54526 WP_001096070.1.5456 WP_001096070.1.5459 WP_001096070.1.54644 WP_001096070.1.54662 WP_001096070.1.54722 WP_001096070.1.54749 WP_001096070.1.54764 WP_001096070.1.54814 WP_001096070.1.54827 WP_001096070.1.54845 WP_001096070.1.55008 WP_001096070.1.55073 WP_001096070.1.55152 WP_001096070.1.55156 WP_001096070.1.5525 WP_001096070.1.55285 WP_001096070.1.55325 WP_001096070.1.55361 WP_001096070.1.55430 WP_001096070.1.55475 WP_001096070.1.55557 WP_001096070.1.5560 WP_001096070.1.55647 WP_001096070.1.55672 WP_001096070.1.55680 WP_001096070.1.55743 WP_001096070.1.55768 WP_001096070.1.55782 WP_001096070.1.55796 WP_001096070.1.55973 WP_001096070.1.55993 WP_001096070.1.56002 WP_001096070.1.56012 WP_001096070.1.56026 WP_001096070.1.56069 WP_001096070.1.56082 WP_001096070.1.56105 WP_001096070.1.56152 WP_001096070.1.56238 WP_001096070.1.56244 WP_001096070.1.56286 WP_001096070.1.56304 WP_001096070.1.56413 WP_001096070.1.56414 WP_001096070.1.56438 WP_001096070.1.56559 WP_001096070.1.56560 WP_001096070.1.56597 WP_001096070.1.56601 WP_001096070.1.56614 WP_001096070.1.56642 WP_001096070.1.56647 WP_001096070.1.56660 WP_001096070.1.56671 WP_001096070.1.56682 WP_001096070.1.56875 WP_001096070.1.56877 WP_001096070.1.57000 WP_001096070.1.57168 WP_001096070.1.57187 WP_001096070.1.57232 WP_001096070.1.57356 WP_001096070.1.57377 WP_001096070.1.57418 WP_001096070.1.57433 WP_001096070.1.57494 WP_001096070.1.57495 WP_001096070.1.57515 WP_001096070.1.57529 WP_001096070.1.57576 WP_001096070.1.57601 WP_001096070.1.57607 WP_001096070.1.57709 WP_001096070.1.5774 WP_001096070.1.57763 WP_001096070.1.57778 WP_001096070.1.57862 WP_001096070.1.57890 WP_001096070.1.57891 WP_001096070.1.57978 WP_001096070.1.5801 WP_001096070.1.58041 WP_001096070.1.58144 WP_001096070.1.58153 WP_001096070.1.58251 WP_001096070.1.58334 WP_001096070.1.58358 WP_001096070.1.58407 WP_001096070.1.58418 WP_001096070.1.58451 WP_001096070.1.5846 WP_001096070.1.5854 WP_001096070.1.58548 WP_001096070.1.58564 WP_001096070.1.5858 WP_001096070.1.58633 WP_001096070.1.58662 WP_001096070.1.58669 WP_001096070.1.58698 WP_001096070.1.58745 WP_001096070.1.5878 WP_001096070.1.58803 WP_001096070.1.5886 WP_001096070.1.59084 WP_001096070.1.59094 WP_001096070.1.59224 WP_001096070.1.59295 WP_001096070.1.59375 WP_001096070.1.59412 WP_001096070.1.59420 WP_001096070.1.59458 WP_001096070.1.59486 WP_001096070.1.59490 WP_001096070.1.59508 WP_001096070.1.5953 WP_001096070.1.59562 WP_001096070.1.59587 WP_001096070.1.59604 WP_001096070.1.59636 WP_001096070.1.59684 WP_001096070.1.59694 WP_001096070.1.59771 WP_001096070.1.5979 WP_001096070.1.59953 WP_001096070.1.60008 WP_001096070.1.60021 WP_001096070.1.60052 WP_001096070.1.60069 WP_001096070.1.60106 WP_001096070.1.60140 WP_001096070.1.60155 WP_001096070.1.60209 WP_001096070.1.60285 WP_001096070.1.60379 WP_001096070.1.60464 WP_001096070.1.60545 WP_001096070.1.60561 WP_001096070.1.60772 WP_001096070.1.60851 WP_001096070.1.60857 WP_001096070.1.6086 WP_001096070.1.60874 WP_001096070.1.6090 WP_001096070.1.60941 WP_001096070.1.60976 WP_001096070.1.61078 WP_001096070.1.6114 WP_001096070.1.61200 WP_001096070.1.61201 WP_001096070.1.61232 WP_001096070.1.6129 WP_001096070.1.61296 WP_001096070.1.61345 WP_001096070.1.61417 WP_001096070.1.61434 WP_001096070.1.61574 WP_001096070.1.61582 WP_001096070.1.61609 WP_001096070.1.61712 WP_001096070.1.61714 WP_001096070.1.61730 WP_001096070.1.61737 WP_001096070.1.61743 WP_001096070.1.61857 WP_001096070.1.61918 WP_001096070.1.61924 WP_001096070.1.61952 WP_001096070.1.61968 WP_001096070.1.62007 WP_001096070.1.62020 WP_001096070.1.62025 WP_001096070.1.6209 WP_001096070.1.62108 WP_001096070.1.62120 WP_001096070.1.62122 WP_001096070.1.62142 WP_001096070.1.62184 WP_001096070.1.62204 WP_001096070.1.62257 WP_001096070.1.62271 WP_001096070.1.62304 WP_001096070.1.62339 WP_001096070.1.62361 WP_001096070.1.62364 WP_001096070.1.62374 WP_001096070.1.62403 WP_001096070.1.62486 WP_001096070.1.62488 WP_001096070.1.62504 WP_001096070.1.62522 WP_001096070.1.6253 WP_001096070.1.62570 WP_001096070.1.62648 WP_001096070.1.62853 WP_001096070.1.62903 WP_001096070.1.62910 WP_001096070.1.62955 WP_001096070.1.62976 WP_001096070.1.63063 WP_001096070.1.63129 WP_001096070.1.63150 WP_001096070.1.63181 WP_001096070.1.63186 WP_001096070.1.63250 WP_001096070.1.63256 WP_001096070.1.63290 WP_001096070.1.63382 WP_001096070.1.63422 WP_001096070.1.63432 WP_001096070.1.63455 WP_001096070.1.63461 WP_001096070.1.63479 WP_001096070.1.63513 WP_001096070.1.6357 WP_001096070.1.63577 WP_001096070.1.63633 WP_001096070.1.63664 WP_001096070.1.63718 WP_001096070.1.6375 WP_001096070.1.63757 WP_001096070.1.63766 WP_001096070.1.63782 WP_001096070.1.63797 WP_001096070.1.63834 WP_001096070.1.63903 WP_001096070.1.6399 WP_001096070.1.64018 WP_001096070.1.64046 WP_001096070.1.6423 WP_001096070.1.64244 WP_001096070.1.64294 WP_001096070.1.64387 WP_001096070.1.64389 WP_001096070.1.64403 WP_001096070.1.64649 WP_001096070.1.64690 WP_001096070.1.64702 WP_001096070.1.64757 WP_001096070.1.64771 WP_001096070.1.64781 WP_001096070.1.64831 WP_001096070.1.6489 WP_001096070.1.64894 WP_001096070.1.64920 WP_001096070.1.65018 WP_001096070.1.65028 WP_001096070.1.65052 WP_001096070.1.65171 WP_001096070.1.65185 WP_001096070.1.65248 WP_001096070.1.6525 WP_001096070.1.65269 WP_001096070.1.65295 WP_001096070.1.65348 WP_001096070.1.6535 WP_001096070.1.65363 WP_001096070.1.65437 WP_001096070.1.65474 WP_001096070.1.65538 WP_001096070.1.65572 WP_001096070.1.65633 WP_001096070.1.6565 WP_001096070.1.65687 WP_001096070.1.65696 WP_001096070.1.6575 WP_001096070.1.65782 WP_001096070.1.65876 WP_001096070.1.6594 WP_001096070.1.65940 WP_001096070.1.65956 WP_001096070.1.66049 WP_001096070.1.66082 WP_001096070.1.66250 WP_001096070.1.6630 WP_001096070.1.66314 WP_001096070.1.66330 WP_001096070.1.66358 WP_001096070.1.66362 WP_001096070.1.66368 WP_001096070.1.6638 WP_001096070.1.6640 WP_001096070.1.66600 WP_001096070.1.66630 WP_001096070.1.66678 WP_001096070.1.66698 WP_001096070.1.66702 WP_001096070.1.6680 WP_001096070.1.66800 WP_001096070.1.66825 WP_001096070.1.66834 WP_001096070.1.66901 WP_001096070.1.66962 WP_001096070.1.67 WP_001096070.1.67037 WP_001096070.1.67045 WP_001096070.1.67100 WP_001096070.1.67175 WP_001096070.1.67181 WP_001096070.1.67235 WP_001096070.1.67268 WP_001096070.1.67347 WP_001096070.1.6739 WP_001096070.1.67465 WP_001096070.1.67552 WP_001096070.1.67603 WP_001096070.1.67617 WP_001096070.1.67633 WP_001096070.1.67637 WP_001096070.1.67682 WP_001096070.1.67731 WP_001096070.1.67803 WP_001096070.1.67827 WP_001096070.1.67829 WP_001096070.1.67887 WP_001096070.1.67942 WP_001096070.1.67970 WP_001096070.1.67988 WP_001096070.1.68073 WP_001096070.1.68075 WP_001096070.1.6809 WP_001096070.1.68167 WP_001096070.1.68201 WP_001096070.1.68206 WP_001096070.1.6827 WP_001096070.1.68275 WP_001096070.1.6833 WP_001096070.1.68401 WP_001096070.1.6849 WP_001096070.1.68547 WP_001096070.1.6858 WP_001096070.1.68589 WP_001096070.1.68629 WP_001096070.1.68655 WP_001096070.1.68656 WP_001096070.1.68778 WP_001096070.1.68787 WP_001096070.1.6879 WP_001096070.1.68816 WP_001096070.1.6883 WP_001096070.1.68894 WP_001096070.1.68928 WP_001096070.1.68975 WP_001096070.1.69001 WP_001096070.1.69006 WP_001096070.1.6904 WP_001096070.1.6905 WP_001096070.1.6913 WP_001096070.1.69139 WP_001096070.1.69146 WP_001096070.1.69151 WP_001096070.1.69255 WP_001096070.1.69359 WP_001096070.1.69397 WP_001096070.1.6954 WP_001096070.1.69564 WP_001096070.1.69644 WP_001096070.1.69704 WP_001096070.1.69710 WP_001096070.1.69754 WP_001096070.1.69758 WP_001096070.1.69760 WP_001096070.1.69808 WP_001096070.1.69817 WP_001096070.1.69848 WP_001096070.1.69975 WP_001096070.1.70047 WP_001096070.1.7010 WP_001096070.1.70183 WP_001096070.1.7021 WP_001096070.1.70241 WP_001096070.1.70269 WP_001096070.1.70281 WP_001096070.1.70289 WP_001096070.1.70290 WP_001096070.1.70355 WP_001096070.1.7044 WP_001096070.1.70447 WP_001096070.1.70485 WP_001096070.1.70488 WP_001096070.1.70491 WP_001096070.1.7055 WP_001096070.1.70580 WP_001096070.1.70643 WP_001096070.1.70683 WP_001096070.1.70685 WP_001096070.1.70883 WP_001096070.1.70914 WP_001096070.1.70922 WP_001096070.1.7093 WP_001096070.1.70948 WP_001096070.1.70959 WP_001096070.1.70986 WP_001096070.1.71023 WP_001096070.1.71088 WP_001096070.1.71116 WP_001096070.1.71146 WP_001096070.1.71150 WP_001096070.1.71165 WP_001096070.1.71188 WP_001096070.1.71202 WP_001096070.1.71243 WP_001096070.1.71248 WP_001096070.1.71299 WP_001096070.1.71306 WP_001096070.1.71337 WP_001096070.1.71363 WP_001096070.1.71378 WP_001096070.1.71401 WP_001096070.1.71407 WP_001096070.1.71450 WP_001096070.1.71452 WP_001096070.1.71481 WP_001096070.1.71583 WP_001096070.1.71636 WP_001096070.1.71667 WP_001096070.1.71691 WP_001096070.1.71702 WP_001096070.1.71750 WP_001096070.1.71798 WP_001096070.1.71845 WP_001096070.1.71881 WP_001096070.1.71908 WP_001096070.1.71923 WP_001096070.1.71952 WP_001096070.1.71973 WP_001096070.1.72105 WP_001096070.1.72203 WP_001096070.1.72277 WP_001096070.1.72281 WP_001096070.1.72283 WP_001096070.1.72372 WP_001096070.1.72376 WP_001096070.1.72403 WP_001096070.1.7243 WP_001096070.1.72438 WP_001096070.1.72594 WP_001096070.1.72728 WP_001096070.1.72850 WP_001096070.1.72871 WP_001096070.1.72872 WP_001096070.1.72894 WP_001096070.1.72944 WP_001096070.1.72975 WP_001096070.1.73062 WP_001096070.1.7315 WP_001096070.1.7316 WP_001096070.1.73164 WP_001096070.1.73200 WP_001096070.1.73328 WP_001096070.1.7334 WP_001096070.1.73377 WP_001096070.1.73461 WP_001096070.1.73481 WP_001096070.1.7356 WP_001096070.1.73561 WP_001096070.1.73581 WP_001096070.1.73617 WP_001096070.1.73667 WP_001096070.1.7374 WP_001096070.1.73753 WP_001096070.1.73758 WP_001096070.1.73794 WP_001096070.1.73847 WP_001096070.1.7387 WP_001096070.1.73924 WP_001096070.1.73926 WP_001096070.1.7394 WP_001096070.1.73965 WP_001096070.1.74028 WP_001096070.1.74029 WP_001096070.1.74049 WP_001096070.1.74181 WP_001096070.1.74191 WP_001096070.1.7433 WP_001096070.1.74379 WP_001096070.1.74410 WP_001096070.1.74466 WP_001096070.1.74469 WP_001096070.1.745 WP_001096070.1.74529 WP_001096070.1.74545 WP_001096070.1.7458 WP_001096070.1.74632 WP_001096070.1.74661 WP_001096070.1.74745 WP_001096070.1.74757 WP_001096070.1.74876 WP_001096070.1.7491 WP_001096070.1.74946 WP_001096070.1.75009 WP_001096070.1.75129 WP_001096070.1.75168 WP_001096070.1.75177 WP_001096070.1.75187 WP_001096070.1.75288 WP_001096070.1.7531 WP_001096070.1.75334 WP_001096070.1.75362 WP_001096070.1.75385 WP_001096070.1.75392 WP_001096070.1.7543 WP_001096070.1.75494 WP_001096070.1.75585 WP_001096070.1.75609 WP_001096070.1.75626 WP_001096070.1.75760 WP_001096070.1.75764 WP_001096070.1.75828 WP_001096070.1.75837 WP_001096070.1.75874 WP_001096070.1.75945 WP_001096070.1.76 WP_001096070.1.76020 WP_001096070.1.76164 WP_001096070.1.76197 WP_001096070.1.76252 WP_001096070.1.76327 WP_001096070.1.7634 WP_001096070.1.76346 WP_001096070.1.76445 WP_001096070.1.76529 WP_001096070.1.76548 WP_001096070.1.7655 WP_001096070.1.7657 WP_001096070.1.76576 WP_001096070.1.7660 WP_001096070.1.76611 WP_001096070.1.76673 WP_001096070.1.76706 WP_001096070.1.7672 WP_001096070.1.76721 WP_001096070.1.76738 WP_001096070.1.76756 WP_001096070.1.76760 WP_001096070.1.76875 WP_001096070.1.76880 WP_001096070.1.76899 WP_001096070.1.77033 WP_001096070.1.77038 WP_001096070.1.77047 WP_001096070.1.77080 WP_001096070.1.7712 WP_001096070.1.77177 WP_001096070.1.77180 WP_001096070.1.77244 WP_001096070.1.77267 WP_001096070.1.77292 WP_001096070.1.77313 WP_001096070.1.77349 WP_001096070.1.77414 WP_001096070.1.77431 WP_001096070.1.77440 WP_001096070.1.77514 WP_001096070.1.77529 WP_001096070.1.77549 WP_001096070.1.77629 WP_001096070.1.77646 WP_001096070.1.77692 WP_001096070.1.77710 WP_001096070.1.77761 WP_001096070.1.7782 WP_001096070.1.77851 WP_001096070.1.77898 WP_001096070.1.77918 WP_001096070.1.77960 WP_001096070.1.78016 WP_001096070.1.78026 WP_001096070.1.78033 WP_001096070.1.78076 WP_001096070.1.78096 WP_001096070.1.78100 WP_001096070.1.78110 WP_001096070.1.78120 WP_001096070.1.78259 WP_001096070.1.78301 WP_001096070.1.78372 WP_001096070.1.78383 WP_001096070.1.78407 WP_001096070.1.7861 WP_001096070.1.78618 WP_001096070.1.78673 WP_001096070.1.78735 WP_001096070.1.78738 WP_001096070.1.78789 WP_001096070.1.78802 WP_001096070.1.78830 WP_001096070.1.78835 WP_001096070.1.78838 WP_001096070.1.78871 WP_001096070.1.78874 WP_001096070.1.78918 WP_001096070.1.7893 WP_001096070.1.78930 WP_001096070.1.78951 WP_001096070.1.79081 WP_001096070.1.79140 WP_001096070.1.79151 WP_001096070.1.79167 WP_001096070.1.79189 WP_001096070.1.79297 WP_001096070.1.79335 WP_001096070.1.79462 WP_001096070.1.79472 WP_001096070.1.79490 WP_001096070.1.79495 WP_001096070.1.79529 WP_001096070.1.7956 WP_001096070.1.79570 WP_001096070.1.7964 WP_001096070.1.79659 WP_001096070.1.79668 WP_001096070.1.79708 WP_001096070.1.79734 WP_001096070.1.79778 WP_001096070.1.7979 WP_001096070.1.79845 WP_001096070.1.79945 WP_001096070.1.80077 WP_001096070.1.80137 WP_001096070.1.80182 WP_001096070.1.80229 WP_001096070.1.8024 WP_001096070.1.80296 WP_001096070.1.80333 WP_001096070.1.80366 WP_001096070.1.80496 WP_001096070.1.80638 WP_001096070.1.80651 WP_001096070.1.80741 WP_001096070.1.80780 WP_001096070.1.80803 WP_001096070.1.80819 WP_001096070.1.80831 WP_001096070.1.80840 WP_001096070.1.80850 WP_001096070.1.80881 WP_001096070.1.80927 WP_001096070.1.80939 WP_001096070.1.80959 WP_001096070.1.8096 WP_001096070.1.81037 WP_001096070.1.81062 WP_001096070.1.81067 WP_001096070.1.81069 WP_001096070.1.81118 WP_001096070.1.81149 WP_001096070.1.81175 WP_001096070.1.8119 WP_001096070.1.81193 WP_001096070.1.81231 WP_001096070.1.81305 WP_001096070.1.81320 WP_001096070.1.81328 WP_001096070.1.81354 WP_001096070.1.81409 WP_001096070.1.81410 WP_001096070.1.81425 WP_001096070.1.81504 WP_001096070.1.81528 WP_001096070.1.81548 WP_001096070.1.8168 WP_001096070.1.81735 WP_001096070.1.81746 WP_001096070.1.81750 WP_001096070.1.81760 WP_001096070.1.81785 WP_001096070.1.81902 WP_001096070.1.8196 WP_001096070.1.81974 WP_001096070.1.81995 WP_001096070.1.82144 WP_001096070.1.82192 WP_001096070.1.82232 WP_001096070.1.82258 WP_001096070.1.82269 WP_001096070.1.82337 WP_001096070.1.82352 WP_001096070.1.8236 WP_001096070.1.82369 WP_001096070.1.82464 WP_001096070.1.82479 WP_001096070.1.82503 WP_001096070.1.82515 WP_001096070.1.82529 WP_001096070.1.82562 WP_001096070.1.82584 WP_001096070.1.82636 WP_001096070.1.82637 WP_001096070.1.82676 WP_001096070.1.82761 WP_001096070.1.8282 WP_001096070.1.82867 WP_001096070.1.82886 WP_001096070.1.82899 WP_001096070.1.82937 WP_001096070.1.82944 WP_001096070.1.82946 WP_001096070.1.82956 WP_001096070.1.83092 WP_001096070.1.83128 WP_001096070.1.83139 WP_001096070.1.83163 WP_001096070.1.83221 WP_001096070.1.83247 WP_001096070.1.83252 WP_001096070.1.83305 WP_001096070.1.83365 WP_001096070.1.83378 WP_001096070.1.83382 WP_001096070.1.83388 WP_001096070.1.83413 WP_001096070.1.83491 WP_001096070.1.83523 WP_001096070.1.8354 WP_001096070.1.83572 WP_001096070.1.83598 WP_001096070.1.83651 WP_001096070.1.83721 WP_001096070.1.83760 WP_001096070.1.83995 WP_001096070.1.84031 WP_001096070.1.84103 WP_001096070.1.84115 WP_001096070.1.84168 WP_001096070.1.84179 WP_001096070.1.84198 WP_001096070.1.84229 WP_001096070.1.84283 WP_001096070.1.84291 WP_001096070.1.84325 WP_001096070.1.84392 WP_001096070.1.84397 WP_001096070.1.84403 WP_001096070.1.8441 WP_001096070.1.84461 WP_001096070.1.84523 WP_001096070.1.84532 WP_001096070.1.84554 WP_001096070.1.84659 WP_001096070.1.84693 WP_001096070.1.84721 WP_001096070.1.84899 WP_001096070.1.8497 WP_001096070.1.850 WP_001096070.1.85031 WP_001096070.1.85040 WP_001096070.1.85094 WP_001096070.1.85134 WP_001096070.1.85178 WP_001096070.1.85180 WP_001096070.1.85190 WP_001096070.1.85192 WP_001096070.1.85433 WP_001096070.1.8545 WP_001096070.1.85481 WP_001096070.1.85483 WP_001096070.1.85541 WP_001096070.1.8556 WP_001096070.1.85568 WP_001096070.1.85615 WP_001096070.1.85617 WP_001096070.1.85654 WP_001096070.1.85663 WP_001096070.1.85671 WP_001096070.1.85672 WP_001096070.1.85675 WP_001096070.1.85777 WP_001096070.1.85855 WP_001096070.1.85886 WP_001096070.1.85900 WP_001096070.1.85904 WP_001096070.1.85943 WP_001096070.1.85976 WP_001096070.1.86007 WP_001096070.1.86043 WP_001096070.1.86092 WP_001096070.1.86126 WP_001096070.1.86173 WP_001096070.1.86206 WP_001096070.1.86306 WP_001096070.1.86356 WP_001096070.1.86450 WP_001096070.1.86469 WP_001096070.1.86580 WP_001096070.1.86588 WP_001096070.1.86658 WP_001096070.1.86661 WP_001096070.1.86699 WP_001096070.1.8671 WP_001096070.1.8672 WP_001096070.1.86744 WP_001096070.1.8678 WP_001096070.1.86810 WP_001096070.1.8684 WP_001096070.1.86895 WP_001096070.1.86902 WP_001096070.1.86906 WP_001096070.1.86921 WP_001096070.1.87095 WP_001096070.1.87148 WP_001096070.1.87219 WP_001096070.1.87283 WP_001096070.1.87323 WP_001096070.1.8736 WP_001096070.1.87460 WP_001096070.1.87552 WP_001096070.1.87584 WP_001096070.1.8767 WP_001096070.1.87695 WP_001096070.1.87779 WP_001096070.1.87899 WP_001096070.1.8792 WP_001096070.1.87933 WP_001096070.1.87945 WP_001096070.1.87999 WP_001096070.1.88019 WP_001096070.1.88073 WP_001096070.1.8809 WP_001096070.1.88092 WP_001096070.1.88136 WP_001096070.1.88222 WP_001096070.1.88244 WP_001096070.1.88291 WP_001096070.1.88293 WP_001096070.1.8837 WP_001096070.1.88393 WP_001096070.1.88423 WP_001096070.1.88597 WP_001096070.1.88620 WP_001096070.1.88675 WP_001096070.1.88703 WP_001096070.1.88792 WP_001096070.1.88902 WP_001096070.1.8891 WP_001096070.1.88957 WP_001096070.1.88980 WP_001096070.1.88981 WP_001096070.1.88995 WP_001096070.1.89008 WP_001096070.1.89054 WP_001096070.1.89114 WP_001096070.1.89116 WP_001096070.1.89119 WP_001096070.1.89138 WP_001096070.1.89174 WP_001096070.1.89215 WP_001096070.1.89304 WP_001096070.1.89354 WP_001096070.1.89355 WP_001096070.1.89512 WP_001096070.1.89527 WP_001096070.1.89570 WP_001096070.1.89604 WP_001096070.1.89622 WP_001096070.1.89647 WP_001096070.1.89657 WP_001096070.1.89659 WP_001096070.1.89765 WP_001096070.1.89777 WP_001096070.1.89817 WP_001096070.1.89902 WP_001096070.1.89914 WP_001096070.1.89940 WP_001096070.1.8996 WP_001096070.1.89975 WP_001096070.1.9002 WP_001096070.1.90033 WP_001096070.1.90097 WP_001096070.1.90220 WP_001096070.1.90248 WP_001096070.1.90252 WP_001096070.1.90311 WP_001096070.1.90348 WP_001096070.1.90409 WP_001096070.1.90417 WP_001096070.1.90453 WP_001096070.1.90458 WP_001096070.1.90521 WP_001096070.1.90557 WP_001096070.1.90585 WP_001096070.1.90641 WP_001096070.1.90686 WP_001096070.1.90734 WP_001096070.1.90792 WP_001096070.1.90866 WP_001096070.1.90876 WP_001096070.1.90878 WP_001096070.1.90991 WP_001096070.1.91003 WP_001096070.1.91023 WP_001096070.1.91056 WP_001096070.1.91069 WP_001096070.1.91179 WP_001096070.1.91278 WP_001096070.1.9131 WP_001096070.1.91459 WP_001096070.1.91473 WP_001096070.1.91512 WP_001096070.1.91524 WP_001096070.1.91564 WP_001096070.1.91621 WP_001096070.1.91628 WP_001096070.1.91655 WP_001096070.1.91724 WP_001096070.1.91732 WP_001096070.1.91736 WP_001096070.1.91788 WP_001096070.1.91806 WP_001096070.1.91914 WP_001096070.1.92013 WP_001096070.1.92039 WP_001096070.1.92060 WP_001096070.1.92093 WP_001096070.1.92108 WP_001096070.1.92149 WP_001096070.1.92165 WP_001096070.1.92171 WP_001096070.1.92183 WP_001096070.1.92208 WP_001096070.1.92213 WP_001096070.1.92268 WP_001096070.1.92310 WP_001096070.1.92318 WP_001096070.1.92411 WP_001096070.1.92443 WP_001096070.1.92482 WP_001096070.1.9253 WP_001096070.1.92531 WP_001096070.1.92575 WP_001096070.1.92659 WP_001096070.1.92669 WP_001096070.1.92671 WP_001096070.1.92738 WP_001096070.1.92836 WP_001096070.1.92843 WP_001096070.1.92875 WP_001096070.1.92879 WP_001096070.1.92883 WP_001096070.1.92893 WP_001096070.1.92895 WP_001096070.1.92926 WP_001096070.1.93059 WP_001096070.1.93086 WP_001096070.1.93101 WP_001096070.1.93136 WP_001096070.1.93155 WP_001096070.1.93275 WP_001096070.1.93322 WP_001096070.1.93339 WP_001096070.1.93365 WP_001096070.1.93376 WP_001096070.1.93543 WP_001096070.1.93604 WP_001096070.1.93650 WP_001096070.1.93656 WP_001096070.1.93662 WP_001096070.1.937 WP_001096070.1.93705 WP_001096070.1.93767 WP_001096070.1.93804 WP_001096070.1.93837 WP_001096070.1.9389 WP_001096070.1.93937 WP_001096070.1.93994 WP_001096070.1.94056 WP_001096070.1.94070 WP_001096070.1.94072 WP_001096070.1.94132 WP_001096070.1.94162 WP_001096070.1.94167 WP_001096070.1.94168 WP_001096070.1.94198 WP_001096070.1.9432 WP_001096070.1.94354 WP_001096070.1.94380 WP_001096070.1.94383 WP_001096070.1.94458 WP_001096070.1.94565 WP_001096070.1.94584 WP_001096070.1.94588 WP_001096070.1.94655 WP_001096070.1.94674 WP_001096070.1.94722 WP_001096070.1.94796 WP_001096070.1.94959 WP_001096070.1.94971 WP_001096070.1.94986 WP_001096070.1.9503 WP_001096070.1.95051 WP_001096070.1.95085 WP_001096070.1.95094 WP_001096070.1.95121 WP_001096070.1.95152 WP_001096070.1.95248 WP_001096070.1.95277 WP_001096070.1.95282 WP_001096070.1.95388 WP_001096070.1.95404 WP_001096070.1.95465 WP_001096070.1.95546 WP_001096070.1.95630 WP_001096070.1.95641 WP_001096070.1.95670 WP_001096070.1.95691 WP_001096070.1.95701 WP_001096070.1.95803 WP_001096070.1.95805 WP_001096070.1.95826 WP_001096070.1.95840 WP_001096070.1.95911 WP_001096070.1.95939 WP_001096070.1.95940 WP_001096070.1.96004 WP_001096070.1.9609 WP_001096070.1.96139 WP_001096070.1.96162 WP_001096070.1.96317 WP_001096070.1.96343 WP_001096070.1.96404 WP_001096070.1.96429 WP_001096070.1.9644 WP_001096070.1.96469 WP_001096070.1.96497 WP_001096070.1.96500 WP_001096070.1.96555 WP_001096070.1.96563 WP_001096070.1.96640 WP_001096070.1.96721 WP_001096070.1.96732 WP_001096070.1.9674 WP_001096070.1.96771 WP_001096070.1.9686 WP_001096070.1.96890 WP_001096070.1.97005 WP_001096070.1.97015 WP_001096070.1.97047 WP_001096070.1.97089 WP_001096070.1.97143 WP_001096070.1.97145 WP_001096070.1.97190 WP_001096070.1.97297 WP_001096070.1.97318 WP_001096070.1.97337 WP_001096070.1.97369 WP_001096070.1.97413 WP_001096070.1.97477 WP_001096070.1.97487 WP_001096070.1.97496 WP_001096070.1.97594 WP_001096070.1.97597 WP_001096070.1.97613 WP_001096070.1.97620 WP_001096070.1.97628 WP_001096070.1.97631 WP_001096070.1.97693 WP_001096070.1.97727 WP_001096070.1.97732 WP_001096070.1.97736 WP_001096070.1.9775 WP_001096070.1.97768 WP_001096070.1.97772 WP_001096070.1.97846 WP_001096070.1.9799 WP_001096070.1.98006 WP_001096070.1.98019 WP_001096070.1.98022 WP_001096070.1.98107 WP_001096070.1.98110 WP_001096070.1.98146 WP_001096070.1.98170 WP_001096070.1.98219 WP_001096070.1.9826 WP_001096070.1.98314 WP_001096070.1.98403 WP_001096070.1.9841 WP_001096070.1.98495 WP_001096070.1.98531 WP_001096070.1.98577 WP_001096070.1.98676 WP_001096070.1.98677 WP_001096070.1.98760 WP_001096070.1.98763 WP_001096070.1.98843 WP_001096070.1.9898 WP_001096070.1.99071 WP_001096070.1.99072 WP_001096070.1.99098 WP_001096070.1.99184 WP_001096070.1.9919 WP_001096070.1.99197 WP_001096070.1.99198 WP_001096070.1.99219 WP_001096070.1.99255 WP_001096070.1.99267 WP_001096070.1.99276 WP_001096070.1.99327 WP_001096070.1.99339 WP_001096070.1.9954 WP_001096070.1.99626 WP_001096070.1.99637 WP_001096070.1.99646 WP_001096070.1.99657 WP_001096070.1.99660 WP_001096070.1.99712 WP_001096070.1.99725 WP_001096070.1.99783 WP_001096070.1.99813 WP_001096070.1.99858 WP_001096070.1.99889 WP_001096070.1.99958 gi|16763519|ref|NP_459134.1| gi|378698109|ref|YP_005180066.1| gi|194450712|ref|YP_002044099.1| gi|378443583|ref|YP_005231215.1| gi|379699350|ref|YP_005241078.1| gi|525827824|ref|YP_008250543.1| gi|378987535|ref|YP_005250699.1| gi|386590008|ref|YP_006086408.1| gi|409248544|ref|YP_006884385.1| gi|550899554|ref|YP_008668646.1| gi|378982670|ref|YP_005245825.1| 272994.SPAB_00163 439843.SeSA_A0145 454169.SeHA_C0141 99287.STM0129 gi|525815986|ref|YP_008246004.1| gi|482902678|ref|YP_007901238.1| gi|549722854|ref|YP_008643044.1| gi|383494951|ref|YP_005395640.1| gi|525839405|ref|YP_008256694.1| gi|161612473|ref|YP_001586438.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]