SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378448433|ref|YP_005235792.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378448433|ref|YP_005235792.1|
Domain Number 1 Region: 12-207
Classification Level Classification E-value
Superfamily Tubulin nucleotide-binding domain-like 1.83e-69
Family Tubulin, GTPase domain 0.00000014
Further Details:      
 
Domain Number 2 Region: 203-319
Classification Level Classification E-value
Superfamily Tubulin C-terminal domain-like 7.33e-43
Family Tubulin, C-terminal domain 0.0000129
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|378448433|ref|YP_005235792.1|
Sequence length 383
Comment cell division protein FtsZ [Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S]
Sequence
MFEPMELTNDAVIKVIGVGGGGGNAVEHMVRERIEGVEFFAVNTDAQALRKTAVGQTIQI
GSGITKGLGAGANPEVGRNAADEDREALRAALEGADMVFIAAGMGGGTGTGAAPVVAEVA
KDLGILTVAVVTKPFNFEGKKRMAFAEQGITELSKHVDSLITIPNDKLLKVLGRGISLLD
AFGAANDVLKGAVQGIAELITRPGLMNVDFADVRTVMSEMGYAMMGSGVASGEDRAEEAA
EMAISSPLLEDIDLSGARGVLVNITAGFDLRLDEFETVGNTIRAFASDNATVVIGTSLDP
DMNDELRVTVVATGIGMDKRPEITLVTNKQVQQPVLDRYQQHGMAPLTQEQKTVAKVVND
NTPQAAKEPDYLDIPAFLRKQAD
Download sequence
Identical sequences A0A0D6HHJ5 A0A0F5B8D7 A0A0F6AWS5 A0A0F7J531 A0A0G2NJ23 A0A0H2WLD6 A0A0H3BRA6 A0A0H3NH98 A0A0L9F3B7 A0A0M0QDF2 A0A0N1QZ50 A0A0R9PLY6 A0A0U0WQ46 A0A0U1G100 A0A0V2DEW3 A0A1C2ZQ05 A0A1R3C1T0 A0A1S0ZB64 A0A1S1ALP6 A0A1X2RP57 A0A1X2T7Z5 A0A1X2V814 A0A1X2YAR0 A0A1Z3QC22 A0A221YUC5 A0A221Z425 A0A241SHB0 A0A267SJQ7 A0A271CIX5 A0A271CXD3 A0A2C6G8Z8 A0A2C9P3M9 A0A2D1XVT2 A0A2D1Y9D6 A0A2D3TZU6 A0A2G1PD55 A0A2H9YG74 A0A2I5HKG1 A0A2I6MCE7 A0A2I6MPZ4 A0A2I6N3H6 A0A2I6NH98 A0A2I6NV60 A0A2I6P7X3 A0A2K3A000 B5F7W9 B5RH69 C0Q5J1 E8XH44 G4BXG9 G5L425 G5PI54 Q8ZRU0 S4I4M7 S5HE02 V1GVY5 V1WVV8 V7IV23 V7V3F2
gi|378443587|ref|YP_005231219.1| gi|197361341|ref|YP_002140976.1| gi|378982674|ref|YP_005245829.1| gi|452121562|ref|YP_007471810.1| gi|525839401|ref|YP_008256690.1| gi|525948405|ref|YP_008310028.1| gi|194444484|ref|YP_002039365.1| gi|549478246|ref|YP_008611966.1| gi|197249720|ref|YP_002145119.1| gi|383494955|ref|YP_005395644.1| gi|194737199|ref|YP_002113151.1| gi|563651734|ref|YP_008859788.1| gi|205351472|ref|YP_002225273.1| gi|538360704|ref|YP_008503989.1| gi|529218880|ref|YP_008379718.1| gi|379699354|ref|YP_005241082.1| gi|526219085|ref|YP_008264392.1| gi|549722858|ref|YP_008643048.1| gi|378987539|ref|YP_005250703.1| gi|378953936|ref|YP_005211423.1| gi|525856552|ref|YP_008259365.1| NP_459138.1.58477 WP_000462785.1.100002 WP_000462785.1.100031 WP_000462785.1.100077 WP_000462785.1.100115 WP_000462785.1.100129 WP_000462785.1.10013 WP_000462785.1.100137 WP_000462785.1.100149 WP_000462785.1.100165 WP_000462785.1.100191 WP_000462785.1.1002 WP_000462785.1.100234 WP_000462785.1.100258 WP_000462785.1.100266 WP_000462785.1.100288 WP_000462785.1.100376 WP_000462785.1.100392 WP_000462785.1.100412 WP_000462785.1.100413 WP_000462785.1.100424 WP_000462785.1.100432 WP_000462785.1.100436 WP_000462785.1.100438 WP_000462785.1.100457 WP_000462785.1.100472 WP_000462785.1.100484 WP_000462785.1.100488 WP_000462785.1.100502 WP_000462785.1.100521 WP_000462785.1.100541 WP_000462785.1.100557 WP_000462785.1.100584 WP_000462785.1.100589 WP_000462785.1.100597 WP_000462785.1.100605 WP_000462785.1.100642 WP_000462785.1.10065 WP_000462785.1.100650 WP_000462785.1.100707 WP_000462785.1.100711 WP_000462785.1.100714 WP_000462785.1.100721 WP_000462785.1.10074 WP_000462785.1.100750 WP_000462785.1.10076 WP_000462785.1.100773 WP_000462785.1.100776 WP_000462785.1.100781 WP_000462785.1.100790 WP_000462785.1.100793 WP_000462785.1.10081 WP_000462785.1.100857 WP_000462785.1.100865 WP_000462785.1.100869 WP_000462785.1.100870 WP_000462785.1.100871 WP_000462785.1.100882 WP_000462785.1.100886 WP_000462785.1.100895 WP_000462785.1.100932 WP_000462785.1.100944 WP_000462785.1.100948 WP_000462785.1.101007 WP_000462785.1.101020 WP_000462785.1.101042 WP_000462785.1.101074 WP_000462785.1.101078 WP_000462785.1.101091 WP_000462785.1.101094 WP_000462785.1.101111 WP_000462785.1.101112 WP_000462785.1.101123 WP_000462785.1.101126 WP_000462785.1.101147 WP_000462785.1.101180 WP_000462785.1.101185 WP_000462785.1.101199 WP_000462785.1.101223 WP_000462785.1.101239 WP_000462785.1.101259 WP_000462785.1.101284 WP_000462785.1.101291 WP_000462785.1.101320 WP_000462785.1.101353 WP_000462785.1.101386 WP_000462785.1.101404 WP_000462785.1.101420 WP_000462785.1.101425 WP_000462785.1.101454 WP_000462785.1.101473 WP_000462785.1.101519 WP_000462785.1.101520 WP_000462785.1.101541 WP_000462785.1.101589 WP_000462785.1.101609 WP_000462785.1.101612 WP_000462785.1.101634 WP_000462785.1.101636 WP_000462785.1.101639 WP_000462785.1.10164 WP_000462785.1.101666 WP_000462785.1.101674 WP_000462785.1.101707 WP_000462785.1.101724 WP_000462785.1.101734 WP_000462785.1.101740 WP_000462785.1.101741 WP_000462785.1.101744 WP_000462785.1.101759 WP_000462785.1.10177 WP_000462785.1.101776 WP_000462785.1.101815 WP_000462785.1.101832 WP_000462785.1.101839 WP_000462785.1.101841 WP_000462785.1.101868 WP_000462785.1.101878 WP_000462785.1.101904 WP_000462785.1.10191 WP_000462785.1.101917 WP_000462785.1.101949 WP_000462785.1.101953 WP_000462785.1.101975 WP_000462785.1.102009 WP_000462785.1.102103 WP_000462785.1.102111 WP_000462785.1.10220 WP_000462785.1.10237 WP_000462785.1.10266 WP_000462785.1.10276 WP_000462785.1.10293 WP_000462785.1.10300 WP_000462785.1.10310 WP_000462785.1.10394 WP_000462785.1.10439 WP_000462785.1.10463 WP_000462785.1.10465 WP_000462785.1.10498 WP_000462785.1.10507 WP_000462785.1.10521 WP_000462785.1.10562 WP_000462785.1.10568 WP_000462785.1.106 WP_000462785.1.10631 WP_000462785.1.10675 WP_000462785.1.10678 WP_000462785.1.10711 WP_000462785.1.10720 WP_000462785.1.10753 WP_000462785.1.10755 WP_000462785.1.10797 WP_000462785.1.10868 WP_000462785.1.10898 WP_000462785.1.10992 WP_000462785.1.11000 WP_000462785.1.11024 WP_000462785.1.11031 WP_000462785.1.11041 WP_000462785.1.11098 WP_000462785.1.11119 WP_000462785.1.11168 WP_000462785.1.11190 WP_000462785.1.11213 WP_000462785.1.11216 WP_000462785.1.11254 WP_000462785.1.11295 WP_000462785.1.113 WP_000462785.1.11304 WP_000462785.1.1135 WP_000462785.1.11362 WP_000462785.1.11369 WP_000462785.1.1137 WP_000462785.1.11405 WP_000462785.1.11444 WP_000462785.1.11455 WP_000462785.1.11458 WP_000462785.1.11479 WP_000462785.1.1150 WP_000462785.1.11511 WP_000462785.1.11518 WP_000462785.1.11526 WP_000462785.1.11528 WP_000462785.1.11532 WP_000462785.1.11543 WP_000462785.1.11544 WP_000462785.1.1156 WP_000462785.1.11565 WP_000462785.1.11603 WP_000462785.1.11621 WP_000462785.1.11681 WP_000462785.1.1169 WP_000462785.1.1174 WP_000462785.1.11763 WP_000462785.1.11772 WP_000462785.1.11810 WP_000462785.1.11824 WP_000462785.1.11841 WP_000462785.1.11865 WP_000462785.1.11868 WP_000462785.1.11875 WP_000462785.1.11897 WP_000462785.1.11900 WP_000462785.1.11936 WP_000462785.1.11938 WP_000462785.1.11964 WP_000462785.1.11978 WP_000462785.1.12007 WP_000462785.1.12025 WP_000462785.1.12027 WP_000462785.1.12047 WP_000462785.1.12059 WP_000462785.1.12063 WP_000462785.1.12106 WP_000462785.1.12114 WP_000462785.1.12144 WP_000462785.1.1215 WP_000462785.1.12159 WP_000462785.1.12160 WP_000462785.1.12168 WP_000462785.1.12210 WP_000462785.1.12244 WP_000462785.1.12280 WP_000462785.1.12282 WP_000462785.1.12308 WP_000462785.1.12340 WP_000462785.1.12351 WP_000462785.1.12370 WP_000462785.1.12374 WP_000462785.1.12396 WP_000462785.1.12397 WP_000462785.1.12456 WP_000462785.1.1246 WP_000462785.1.12472 WP_000462785.1.12484 WP_000462785.1.12485 WP_000462785.1.1250 WP_000462785.1.12517 WP_000462785.1.12546 WP_000462785.1.12568 WP_000462785.1.12569 WP_000462785.1.12584 WP_000462785.1.12585 WP_000462785.1.1264 WP_000462785.1.12650 WP_000462785.1.12696 WP_000462785.1.12701 WP_000462785.1.12718 WP_000462785.1.12728 WP_000462785.1.12864 WP_000462785.1.12865 WP_000462785.1.12877 WP_000462785.1.12879 WP_000462785.1.12936 WP_000462785.1.1299 WP_000462785.1.12995 WP_000462785.1.1300 WP_000462785.1.13027 WP_000462785.1.13076 WP_000462785.1.13101 WP_000462785.1.13102 WP_000462785.1.13106 WP_000462785.1.13130 WP_000462785.1.13247 WP_000462785.1.1326 WP_000462785.1.13262 WP_000462785.1.13274 WP_000462785.1.13311 WP_000462785.1.13334 WP_000462785.1.13367 WP_000462785.1.13391 WP_000462785.1.13414 WP_000462785.1.13429 WP_000462785.1.13446 WP_000462785.1.1346 WP_000462785.1.13488 WP_000462785.1.13509 WP_000462785.1.13528 WP_000462785.1.13543 WP_000462785.1.13573 WP_000462785.1.13602 WP_000462785.1.13625 WP_000462785.1.13669 WP_000462785.1.13677 WP_000462785.1.13691 WP_000462785.1.13741 WP_000462785.1.13750 WP_000462785.1.13764 WP_000462785.1.13799 WP_000462785.1.13812 WP_000462785.1.13819 WP_000462785.1.13827 WP_000462785.1.13829 WP_000462785.1.13848 WP_000462785.1.13857 WP_000462785.1.1387 WP_000462785.1.13908 WP_000462785.1.13932 WP_000462785.1.13967 WP_000462785.1.13968 WP_000462785.1.14001 WP_000462785.1.14011 WP_000462785.1.14041 WP_000462785.1.14050 WP_000462785.1.14056 WP_000462785.1.1412 WP_000462785.1.14151 WP_000462785.1.14212 WP_000462785.1.14239 WP_000462785.1.14286 WP_000462785.1.14296 WP_000462785.1.14320 WP_000462785.1.14369 WP_000462785.1.14379 WP_000462785.1.1440 WP_000462785.1.14406 WP_000462785.1.14410 WP_000462785.1.14446 WP_000462785.1.14466 WP_000462785.1.14495 WP_000462785.1.14505 WP_000462785.1.14516 WP_000462785.1.14519 WP_000462785.1.14524 WP_000462785.1.14528 WP_000462785.1.14554 WP_000462785.1.146 WP_000462785.1.14688 WP_000462785.1.14706 WP_000462785.1.14708 WP_000462785.1.14725 WP_000462785.1.14737 WP_000462785.1.14789 WP_000462785.1.14793 WP_000462785.1.14808 WP_000462785.1.14819 WP_000462785.1.14852 WP_000462785.1.14876 WP_000462785.1.14884 WP_000462785.1.1489 WP_000462785.1.14913 WP_000462785.1.14917 WP_000462785.1.14927 WP_000462785.1.14932 WP_000462785.1.14936 WP_000462785.1.14964 WP_000462785.1.15011 WP_000462785.1.15054 WP_000462785.1.15055 WP_000462785.1.15059 WP_000462785.1.15067 WP_000462785.1.15079 WP_000462785.1.15100 WP_000462785.1.15102 WP_000462785.1.15124 WP_000462785.1.15223 WP_000462785.1.15226 WP_000462785.1.15276 WP_000462785.1.15316 WP_000462785.1.15318 WP_000462785.1.15353 WP_000462785.1.15369 WP_000462785.1.1540 WP_000462785.1.15479 WP_000462785.1.15483 WP_000462785.1.15486 WP_000462785.1.15508 WP_000462785.1.1551 WP_000462785.1.15585 WP_000462785.1.15586 WP_000462785.1.15612 WP_000462785.1.15616 WP_000462785.1.15625 WP_000462785.1.15627 WP_000462785.1.15637 WP_000462785.1.15644 WP_000462785.1.1568 WP_000462785.1.15708 WP_000462785.1.15775 WP_000462785.1.15777 WP_000462785.1.15784 WP_000462785.1.15795 WP_000462785.1.158 WP_000462785.1.15830 WP_000462785.1.15835 WP_000462785.1.15881 WP_000462785.1.15909 WP_000462785.1.1592 WP_000462785.1.15922 WP_000462785.1.15938 WP_000462785.1.15978 WP_000462785.1.15995 WP_000462785.1.16000 WP_000462785.1.16006 WP_000462785.1.1601 WP_000462785.1.16028 WP_000462785.1.16032 WP_000462785.1.16062 WP_000462785.1.16063 WP_000462785.1.16103 WP_000462785.1.1611 WP_000462785.1.16125 WP_000462785.1.16158 WP_000462785.1.16166 WP_000462785.1.16172 WP_000462785.1.16201 WP_000462785.1.16226 WP_000462785.1.16233 WP_000462785.1.16244 WP_000462785.1.16273 WP_000462785.1.16284 WP_000462785.1.16328 WP_000462785.1.16331 WP_000462785.1.1635 WP_000462785.1.16363 WP_000462785.1.16365 WP_000462785.1.16366 WP_000462785.1.16394 WP_000462785.1.16468 WP_000462785.1.16474 WP_000462785.1.16508 WP_000462785.1.16551 WP_000462785.1.16565 WP_000462785.1.16581 WP_000462785.1.16614 WP_000462785.1.16650 WP_000462785.1.16656 WP_000462785.1.1668 WP_000462785.1.16686 WP_000462785.1.16691 WP_000462785.1.167 WP_000462785.1.16710 WP_000462785.1.16729 WP_000462785.1.16732 WP_000462785.1.16735 WP_000462785.1.16736 WP_000462785.1.16786 WP_000462785.1.16804 WP_000462785.1.16817 WP_000462785.1.16819 WP_000462785.1.16826 WP_000462785.1.16846 WP_000462785.1.16855 WP_000462785.1.1689 WP_000462785.1.16896 WP_000462785.1.16910 WP_000462785.1.16941 WP_000462785.1.16942 WP_000462785.1.16944 WP_000462785.1.16949 WP_000462785.1.16965 WP_000462785.1.16972 WP_000462785.1.16998 WP_000462785.1.1700 WP_000462785.1.17031 WP_000462785.1.17060 WP_000462785.1.17096 WP_000462785.1.17098 WP_000462785.1.17105 WP_000462785.1.17188 WP_000462785.1.17270 WP_000462785.1.17285 WP_000462785.1.17307 WP_000462785.1.1733 WP_000462785.1.1737 WP_000462785.1.17390 WP_000462785.1.174 WP_000462785.1.17439 WP_000462785.1.17447 WP_000462785.1.17480 WP_000462785.1.17482 WP_000462785.1.1749 WP_000462785.1.17504 WP_000462785.1.17525 WP_000462785.1.17546 WP_000462785.1.17560 WP_000462785.1.1757 WP_000462785.1.17583 WP_000462785.1.17629 WP_000462785.1.17693 WP_000462785.1.17702 WP_000462785.1.17703 WP_000462785.1.17705 WP_000462785.1.17732 WP_000462785.1.17747 WP_000462785.1.17755 WP_000462785.1.17865 WP_000462785.1.17886 WP_000462785.1.17901 WP_000462785.1.17914 WP_000462785.1.17919 WP_000462785.1.17936 WP_000462785.1.17949 WP_000462785.1.17991 WP_000462785.1.18019 WP_000462785.1.18022 WP_000462785.1.18056 WP_000462785.1.18061 WP_000462785.1.1807 WP_000462785.1.18089 WP_000462785.1.18092 WP_000462785.1.18103 WP_000462785.1.18109 WP_000462785.1.18111 WP_000462785.1.1814 WP_000462785.1.18149 WP_000462785.1.18163 WP_000462785.1.18177 WP_000462785.1.18178 WP_000462785.1.18192 WP_000462785.1.18249 WP_000462785.1.1825 WP_000462785.1.18265 WP_000462785.1.18267 WP_000462785.1.18277 WP_000462785.1.18281 WP_000462785.1.18282 WP_000462785.1.18355 WP_000462785.1.18365 WP_000462785.1.18384 WP_000462785.1.18426 WP_000462785.1.18441 WP_000462785.1.18445 WP_000462785.1.18468 WP_000462785.1.18483 WP_000462785.1.18485 WP_000462785.1.18489 WP_000462785.1.18607 WP_000462785.1.18641 WP_000462785.1.18686 WP_000462785.1.18688 WP_000462785.1.18692 WP_000462785.1.18705 WP_000462785.1.18715 WP_000462785.1.18737 WP_000462785.1.18776 WP_000462785.1.18822 WP_000462785.1.18847 WP_000462785.1.18881 WP_000462785.1.18886 WP_000462785.1.18895 WP_000462785.1.18919 WP_000462785.1.18940 WP_000462785.1.18949 WP_000462785.1.1895 WP_000462785.1.1897 WP_000462785.1.18972 WP_000462785.1.19030 WP_000462785.1.19038 WP_000462785.1.19053 WP_000462785.1.19064 WP_000462785.1.19093 WP_000462785.1.19163 WP_000462785.1.19174 WP_000462785.1.19240 WP_000462785.1.19291 WP_000462785.1.19320 WP_000462785.1.19340 WP_000462785.1.1935 WP_000462785.1.19357 WP_000462785.1.19373 WP_000462785.1.1939 WP_000462785.1.19405 WP_000462785.1.19433 WP_000462785.1.19458 WP_000462785.1.19460 WP_000462785.1.19461 WP_000462785.1.19469 WP_000462785.1.1954 WP_000462785.1.1955 WP_000462785.1.19614 WP_000462785.1.19642 WP_000462785.1.19656 WP_000462785.1.19660 WP_000462785.1.1968 WP_000462785.1.19683 WP_000462785.1.19702 WP_000462785.1.19706 WP_000462785.1.19723 WP_000462785.1.19724 WP_000462785.1.19740 WP_000462785.1.19749 WP_000462785.1.19784 WP_000462785.1.19802 WP_000462785.1.19809 WP_000462785.1.19823 WP_000462785.1.19834 WP_000462785.1.19851 WP_000462785.1.19863 WP_000462785.1.19867 WP_000462785.1.19882 WP_000462785.1.19884 WP_000462785.1.1990 WP_000462785.1.19938 WP_000462785.1.19967 WP_000462785.1.19970 WP_000462785.1.1998 WP_000462785.1.19987 WP_000462785.1.20 WP_000462785.1.20023 WP_000462785.1.20034 WP_000462785.1.20081 WP_000462785.1.20086 WP_000462785.1.20089 WP_000462785.1.20091 WP_000462785.1.2010 WP_000462785.1.20119 WP_000462785.1.20212 WP_000462785.1.20218 WP_000462785.1.2026 WP_000462785.1.20261 WP_000462785.1.20266 WP_000462785.1.20271 WP_000462785.1.20330 WP_000462785.1.20349 WP_000462785.1.2036 WP_000462785.1.20362 WP_000462785.1.20364 WP_000462785.1.20376 WP_000462785.1.20391 WP_000462785.1.2041 WP_000462785.1.20415 WP_000462785.1.20418 WP_000462785.1.20425 WP_000462785.1.20437 WP_000462785.1.20443 WP_000462785.1.2047 WP_000462785.1.20488 WP_000462785.1.20503 WP_000462785.1.20525 WP_000462785.1.2054 WP_000462785.1.20553 WP_000462785.1.20564 WP_000462785.1.20573 WP_000462785.1.20626 WP_000462785.1.20631 WP_000462785.1.20646 WP_000462785.1.20695 WP_000462785.1.20700 WP_000462785.1.20721 WP_000462785.1.20760 WP_000462785.1.20787 WP_000462785.1.20789 WP_000462785.1.20795 WP_000462785.1.20810 WP_000462785.1.20839 WP_000462785.1.20862 WP_000462785.1.20886 WP_000462785.1.20900 WP_000462785.1.20908 WP_000462785.1.2091 WP_000462785.1.2101 WP_000462785.1.21049 WP_000462785.1.2107 WP_000462785.1.21075 WP_000462785.1.21079 WP_000462785.1.21086 WP_000462785.1.21089 WP_000462785.1.21103 WP_000462785.1.2116 WP_000462785.1.21165 WP_000462785.1.21181 WP_000462785.1.21194 WP_000462785.1.21202 WP_000462785.1.21241 WP_000462785.1.21245 WP_000462785.1.21246 WP_000462785.1.21260 WP_000462785.1.21269 WP_000462785.1.21286 WP_000462785.1.2130 WP_000462785.1.21309 WP_000462785.1.21326 WP_000462785.1.21332 WP_000462785.1.21362 WP_000462785.1.2139 WP_000462785.1.21399 WP_000462785.1.21400 WP_000462785.1.21404 WP_000462785.1.21423 WP_000462785.1.21443 WP_000462785.1.21453 WP_000462785.1.2146 WP_000462785.1.21473 WP_000462785.1.21497 WP_000462785.1.21499 WP_000462785.1.21534 WP_000462785.1.21548 WP_000462785.1.21603 WP_000462785.1.21681 WP_000462785.1.21692 WP_000462785.1.21715 WP_000462785.1.21728 WP_000462785.1.21730 WP_000462785.1.21750 WP_000462785.1.21751 WP_000462785.1.21757 WP_000462785.1.21792 WP_000462785.1.21825 WP_000462785.1.21845 WP_000462785.1.21877 WP_000462785.1.21886 WP_000462785.1.21909 WP_000462785.1.21910 WP_000462785.1.21940 WP_000462785.1.21950 WP_000462785.1.21981 WP_000462785.1.22019 WP_000462785.1.22024 WP_000462785.1.22030 WP_000462785.1.2205 WP_000462785.1.22051 WP_000462785.1.22062 WP_000462785.1.22067 WP_000462785.1.22069 WP_000462785.1.22096 WP_000462785.1.22117 WP_000462785.1.22136 WP_000462785.1.22158 WP_000462785.1.22162 WP_000462785.1.22169 WP_000462785.1.22205 WP_000462785.1.2221 WP_000462785.1.2224 WP_000462785.1.22240 WP_000462785.1.22296 WP_000462785.1.22303 WP_000462785.1.22315 WP_000462785.1.22323 WP_000462785.1.22337 WP_000462785.1.22346 WP_000462785.1.2235 WP_000462785.1.22379 WP_000462785.1.22388 WP_000462785.1.22427 WP_000462785.1.22449 WP_000462785.1.22451 WP_000462785.1.22453 WP_000462785.1.22454 WP_000462785.1.2246 WP_000462785.1.22460 WP_000462785.1.22485 WP_000462785.1.22514 WP_000462785.1.22537 WP_000462785.1.22565 WP_000462785.1.22566 WP_000462785.1.22575 WP_000462785.1.22582 WP_000462785.1.22595 WP_000462785.1.22604 WP_000462785.1.22605 WP_000462785.1.22620 WP_000462785.1.22623 WP_000462785.1.22645 WP_000462785.1.22676 WP_000462785.1.22760 WP_000462785.1.2283 WP_000462785.1.22845 WP_000462785.1.22855 WP_000462785.1.22857 WP_000462785.1.22870 WP_000462785.1.22880 WP_000462785.1.22902 WP_000462785.1.22947 WP_000462785.1.22966 WP_000462785.1.22979 WP_000462785.1.23010 WP_000462785.1.23041 WP_000462785.1.23053 WP_000462785.1.23080 WP_000462785.1.23102 WP_000462785.1.23114 WP_000462785.1.2314 WP_000462785.1.23148 WP_000462785.1.23155 WP_000462785.1.23169 WP_000462785.1.23172 WP_000462785.1.23175 WP_000462785.1.23192 WP_000462785.1.23201 WP_000462785.1.2324 WP_000462785.1.23246 WP_000462785.1.23258 WP_000462785.1.23259 WP_000462785.1.23274 WP_000462785.1.23279 WP_000462785.1.23309 WP_000462785.1.23311 WP_000462785.1.23329 WP_000462785.1.23341 WP_000462785.1.23343 WP_000462785.1.23409 WP_000462785.1.2342 WP_000462785.1.2343 WP_000462785.1.23442 WP_000462785.1.23444 WP_000462785.1.23460 WP_000462785.1.23466 WP_000462785.1.23472 WP_000462785.1.23482 WP_000462785.1.23485 WP_000462785.1.235 WP_000462785.1.23500 WP_000462785.1.23503 WP_000462785.1.23513 WP_000462785.1.23529 WP_000462785.1.2358 WP_000462785.1.23587 WP_000462785.1.23621 WP_000462785.1.23629 WP_000462785.1.23631 WP_000462785.1.23634 WP_000462785.1.23639 WP_000462785.1.2364 WP_000462785.1.23643 WP_000462785.1.23646 WP_000462785.1.23670 WP_000462785.1.23675 WP_000462785.1.23685 WP_000462785.1.237 WP_000462785.1.23707 WP_000462785.1.23720 WP_000462785.1.23736 WP_000462785.1.23746 WP_000462785.1.23755 WP_000462785.1.2376 WP_000462785.1.2380 WP_000462785.1.23819 WP_000462785.1.23932 WP_000462785.1.24017 WP_000462785.1.24145 WP_000462785.1.2415 WP_000462785.1.24158 WP_000462785.1.24163 WP_000462785.1.24206 WP_000462785.1.24214 WP_000462785.1.24250 WP_000462785.1.24259 WP_000462785.1.24297 WP_000462785.1.24303 WP_000462785.1.24308 WP_000462785.1.24325 WP_000462785.1.24361 WP_000462785.1.24376 WP_000462785.1.24392 WP_000462785.1.24394 WP_000462785.1.24408 WP_000462785.1.24409 WP_000462785.1.24412 WP_000462785.1.24419 WP_000462785.1.24433 WP_000462785.1.24444 WP_000462785.1.24450 WP_000462785.1.24476 WP_000462785.1.24494 WP_000462785.1.24521 WP_000462785.1.24555 WP_000462785.1.24567 WP_000462785.1.24578 WP_000462785.1.2467 WP_000462785.1.24673 WP_000462785.1.24686 WP_000462785.1.24689 WP_000462785.1.24696 WP_000462785.1.24727 WP_000462785.1.24737 WP_000462785.1.24779 WP_000462785.1.24837 WP_000462785.1.24839 WP_000462785.1.24873 WP_000462785.1.24901 WP_000462785.1.24944 WP_000462785.1.24995 WP_000462785.1.25008 WP_000462785.1.25015 WP_000462785.1.25036 WP_000462785.1.25064 WP_000462785.1.25072 WP_000462785.1.25130 WP_000462785.1.25159 WP_000462785.1.25175 WP_000462785.1.25205 WP_000462785.1.25206 WP_000462785.1.25217 WP_000462785.1.25229 WP_000462785.1.2525 WP_000462785.1.25354 WP_000462785.1.25397 WP_000462785.1.25405 WP_000462785.1.25426 WP_000462785.1.25454 WP_000462785.1.25493 WP_000462785.1.25498 WP_000462785.1.25514 WP_000462785.1.2554 WP_000462785.1.25546 WP_000462785.1.25564 WP_000462785.1.25596 WP_000462785.1.25607 WP_000462785.1.25618 WP_000462785.1.25668 WP_000462785.1.25690 WP_000462785.1.25692 WP_000462785.1.2570 WP_000462785.1.25700 WP_000462785.1.25703 WP_000462785.1.25708 WP_000462785.1.25722 WP_000462785.1.25740 WP_000462785.1.25780 WP_000462785.1.25793 WP_000462785.1.25809 WP_000462785.1.2581 WP_000462785.1.25814 WP_000462785.1.25825 WP_000462785.1.25846 WP_000462785.1.25928 WP_000462785.1.25932 WP_000462785.1.25944 WP_000462785.1.25951 WP_000462785.1.25988 WP_000462785.1.26030 WP_000462785.1.26034 WP_000462785.1.26075 WP_000462785.1.26083 WP_000462785.1.26093 WP_000462785.1.26122 WP_000462785.1.26123 WP_000462785.1.26129 WP_000462785.1.26194 WP_000462785.1.26199 WP_000462785.1.26213 WP_000462785.1.26224 WP_000462785.1.26269 WP_000462785.1.26311 WP_000462785.1.26319 WP_000462785.1.2634 WP_000462785.1.26363 WP_000462785.1.26384 WP_000462785.1.26426 WP_000462785.1.26429 WP_000462785.1.26440 WP_000462785.1.26441 WP_000462785.1.26493 WP_000462785.1.26512 WP_000462785.1.26551 WP_000462785.1.26563 WP_000462785.1.26567 WP_000462785.1.26576 WP_000462785.1.26582 WP_000462785.1.2660 WP_000462785.1.26646 WP_000462785.1.2667 WP_000462785.1.26709 WP_000462785.1.2672 WP_000462785.1.26750 WP_000462785.1.26758 WP_000462785.1.26787 WP_000462785.1.26794 WP_000462785.1.26833 WP_000462785.1.26856 WP_000462785.1.26882 WP_000462785.1.26883 WP_000462785.1.26892 WP_000462785.1.26924 WP_000462785.1.26936 WP_000462785.1.26980 WP_000462785.1.27010 WP_000462785.1.27051 WP_000462785.1.27055 WP_000462785.1.27072 WP_000462785.1.27122 WP_000462785.1.27142 WP_000462785.1.27169 WP_000462785.1.27173 WP_000462785.1.272 WP_000462785.1.27206 WP_000462785.1.2723 WP_000462785.1.27255 WP_000462785.1.27272 WP_000462785.1.27279 WP_000462785.1.27314 WP_000462785.1.27342 WP_000462785.1.27383 WP_000462785.1.27419 WP_000462785.1.27423 WP_000462785.1.27452 WP_000462785.1.27513 WP_000462785.1.27522 WP_000462785.1.27523 WP_000462785.1.27535 WP_000462785.1.27547 WP_000462785.1.27556 WP_000462785.1.27561 WP_000462785.1.27616 WP_000462785.1.2763 WP_000462785.1.27632 WP_000462785.1.27638 WP_000462785.1.27655 WP_000462785.1.27658 WP_000462785.1.27665 WP_000462785.1.27679 WP_000462785.1.27707 WP_000462785.1.27713 WP_000462785.1.27755 WP_000462785.1.27761 WP_000462785.1.2777 WP_000462785.1.27776 WP_000462785.1.27798 WP_000462785.1.27800 WP_000462785.1.27815 WP_000462785.1.27833 WP_000462785.1.27857 WP_000462785.1.27883 WP_000462785.1.27892 WP_000462785.1.27969 WP_000462785.1.27977 WP_000462785.1.27995 WP_000462785.1.27997 WP_000462785.1.28002 WP_000462785.1.28037 WP_000462785.1.2806 WP_000462785.1.28073 WP_000462785.1.28094 WP_000462785.1.28116 WP_000462785.1.28126 WP_000462785.1.28139 WP_000462785.1.28170 WP_000462785.1.28174 WP_000462785.1.28200 WP_000462785.1.28225 WP_000462785.1.28232 WP_000462785.1.28233 WP_000462785.1.28235 WP_000462785.1.2825 WP_000462785.1.28267 WP_000462785.1.2829 WP_000462785.1.28301 WP_000462785.1.28302 WP_000462785.1.28303 WP_000462785.1.2835 WP_000462785.1.28370 WP_000462785.1.28393 WP_000462785.1.28462 WP_000462785.1.28504 WP_000462785.1.28512 WP_000462785.1.28514 WP_000462785.1.2853 WP_000462785.1.28538 WP_000462785.1.28570 WP_000462785.1.28575 WP_000462785.1.28612 WP_000462785.1.28620 WP_000462785.1.28625 WP_000462785.1.28655 WP_000462785.1.28673 WP_000462785.1.28694 WP_000462785.1.287 WP_000462785.1.28733 WP_000462785.1.28773 WP_000462785.1.28775 WP_000462785.1.28776 WP_000462785.1.2879 WP_000462785.1.28811 WP_000462785.1.28830 WP_000462785.1.2890 WP_000462785.1.28902 WP_000462785.1.28921 WP_000462785.1.28938 WP_000462785.1.28946 WP_000462785.1.28948 WP_000462785.1.28963 WP_000462785.1.28977 WP_000462785.1.29006 WP_000462785.1.29010 WP_000462785.1.29099 WP_000462785.1.2910 WP_000462785.1.29130 WP_000462785.1.29168 WP_000462785.1.29174 WP_000462785.1.29190 WP_000462785.1.29218 WP_000462785.1.2924 WP_000462785.1.29255 WP_000462785.1.29265 WP_000462785.1.2932 WP_000462785.1.29349 WP_000462785.1.29379 WP_000462785.1.29422 WP_000462785.1.29436 WP_000462785.1.29454 WP_000462785.1.29530 WP_000462785.1.29588 WP_000462785.1.29593 WP_000462785.1.29601 WP_000462785.1.29606 WP_000462785.1.29615 WP_000462785.1.29619 WP_000462785.1.29682 WP_000462785.1.29704 WP_000462785.1.29711 WP_000462785.1.29732 WP_000462785.1.29768 WP_000462785.1.29774 WP_000462785.1.29775 WP_000462785.1.2984 WP_000462785.1.29845 WP_000462785.1.29898 WP_000462785.1.29923 WP_000462785.1.29924 WP_000462785.1.29969 WP_000462785.1.30006 WP_000462785.1.30018 WP_000462785.1.30027 WP_000462785.1.3005 WP_000462785.1.30059 WP_000462785.1.30086 WP_000462785.1.30093 WP_000462785.1.30165 WP_000462785.1.3017 WP_000462785.1.30170 WP_000462785.1.30179 WP_000462785.1.30180 WP_000462785.1.30195 WP_000462785.1.30210 WP_000462785.1.30225 WP_000462785.1.30238 WP_000462785.1.30246 WP_000462785.1.30278 WP_000462785.1.30331 WP_000462785.1.30356 WP_000462785.1.30386 WP_000462785.1.30389 WP_000462785.1.30425 WP_000462785.1.30437 WP_000462785.1.30469 WP_000462785.1.30492 WP_000462785.1.30505 WP_000462785.1.30507 WP_000462785.1.30535 WP_000462785.1.30547 WP_000462785.1.30548 WP_000462785.1.30555 WP_000462785.1.30573 WP_000462785.1.30589 WP_000462785.1.30602 WP_000462785.1.30619 WP_000462785.1.30627 WP_000462785.1.30635 WP_000462785.1.3066 WP_000462785.1.3068 WP_000462785.1.30696 WP_000462785.1.30752 WP_000462785.1.3076 WP_000462785.1.30794 WP_000462785.1.3080 WP_000462785.1.30802 WP_000462785.1.30803 WP_000462785.1.30819 WP_000462785.1.30823 WP_000462785.1.30833 WP_000462785.1.30835 WP_000462785.1.3089 WP_000462785.1.30909 WP_000462785.1.30934 WP_000462785.1.3095 WP_000462785.1.30951 WP_000462785.1.30968 WP_000462785.1.30972 WP_000462785.1.31 WP_000462785.1.31001 WP_000462785.1.31011 WP_000462785.1.31042 WP_000462785.1.31069 WP_000462785.1.31086 WP_000462785.1.31107 WP_000462785.1.31111 WP_000462785.1.3113 WP_000462785.1.3114 WP_000462785.1.31155 WP_000462785.1.31156 WP_000462785.1.31167 WP_000462785.1.31171 WP_000462785.1.31185 WP_000462785.1.3119 WP_000462785.1.31190 WP_000462785.1.31195 WP_000462785.1.31196 WP_000462785.1.31198 WP_000462785.1.31210 WP_000462785.1.31214 WP_000462785.1.31219 WP_000462785.1.31222 WP_000462785.1.3124 WP_000462785.1.31240 WP_000462785.1.31251 WP_000462785.1.31262 WP_000462785.1.3127 WP_000462785.1.31272 WP_000462785.1.31281 WP_000462785.1.31335 WP_000462785.1.31362 WP_000462785.1.31435 WP_000462785.1.31476 WP_000462785.1.31504 WP_000462785.1.31515 WP_000462785.1.31546 WP_000462785.1.31578 WP_000462785.1.31585 WP_000462785.1.31658 WP_000462785.1.31665 WP_000462785.1.3170 WP_000462785.1.31720 WP_000462785.1.31725 WP_000462785.1.31762 WP_000462785.1.31782 WP_000462785.1.31845 WP_000462785.1.3185 WP_000462785.1.31854 WP_000462785.1.31895 WP_000462785.1.31901 WP_000462785.1.31927 WP_000462785.1.31940 WP_000462785.1.31952 WP_000462785.1.31967 WP_000462785.1.31972 WP_000462785.1.32006 WP_000462785.1.32038 WP_000462785.1.32054 WP_000462785.1.32056 WP_000462785.1.32109 WP_000462785.1.32116 WP_000462785.1.32170 WP_000462785.1.32192 WP_000462785.1.32204 WP_000462785.1.32206 WP_000462785.1.32252 WP_000462785.1.32255 WP_000462785.1.32274 WP_000462785.1.32275 WP_000462785.1.32277 WP_000462785.1.32309 WP_000462785.1.32357 WP_000462785.1.32368 WP_000462785.1.32408 WP_000462785.1.32423 WP_000462785.1.32424 WP_000462785.1.32434 WP_000462785.1.32438 WP_000462785.1.32459 WP_000462785.1.32491 WP_000462785.1.32515 WP_000462785.1.32519 WP_000462785.1.32527 WP_000462785.1.32545 WP_000462785.1.32629 WP_000462785.1.32643 WP_000462785.1.32660 WP_000462785.1.32668 WP_000462785.1.32702 WP_000462785.1.32714 WP_000462785.1.32740 WP_000462785.1.32747 WP_000462785.1.32750 WP_000462785.1.3278 WP_000462785.1.32786 WP_000462785.1.32804 WP_000462785.1.32832 WP_000462785.1.32860 WP_000462785.1.32881 WP_000462785.1.32899 WP_000462785.1.329 WP_000462785.1.32900 WP_000462785.1.32902 WP_000462785.1.32907 WP_000462785.1.32930 WP_000462785.1.32961 WP_000462785.1.32977 WP_000462785.1.33010 WP_000462785.1.33030 WP_000462785.1.3304 WP_000462785.1.33068 WP_000462785.1.33078 WP_000462785.1.3310 WP_000462785.1.33106 WP_000462785.1.33114 WP_000462785.1.33127 WP_000462785.1.33134 WP_000462785.1.33143 WP_000462785.1.33144 WP_000462785.1.33160 WP_000462785.1.33248 WP_000462785.1.33253 WP_000462785.1.33261 WP_000462785.1.33270 WP_000462785.1.333 WP_000462785.1.33343 WP_000462785.1.33392 WP_000462785.1.33409 WP_000462785.1.33420 WP_000462785.1.33486 WP_000462785.1.33492 WP_000462785.1.33499 WP_000462785.1.335 WP_000462785.1.33504 WP_000462785.1.33553 WP_000462785.1.3356 WP_000462785.1.33586 WP_000462785.1.33592 WP_000462785.1.33609 WP_000462785.1.33629 WP_000462785.1.3364 WP_000462785.1.33693 WP_000462785.1.33786 WP_000462785.1.33817 WP_000462785.1.33825 WP_000462785.1.33870 WP_000462785.1.33894 WP_000462785.1.3395 WP_000462785.1.3396 WP_000462785.1.33986 WP_000462785.1.34 WP_000462785.1.34022 WP_000462785.1.34043 WP_000462785.1.34075 WP_000462785.1.34081 WP_000462785.1.34084 WP_000462785.1.34091 WP_000462785.1.34107 WP_000462785.1.34126 WP_000462785.1.34179 WP_000462785.1.34184 WP_000462785.1.34185 WP_000462785.1.34257 WP_000462785.1.34259 WP_000462785.1.34279 WP_000462785.1.34292 WP_000462785.1.34304 WP_000462785.1.34319 WP_000462785.1.34330 WP_000462785.1.3438 WP_000462785.1.34424 WP_000462785.1.34431 WP_000462785.1.3445 WP_000462785.1.34453 WP_000462785.1.34454 WP_000462785.1.34458 WP_000462785.1.34496 WP_000462785.1.34610 WP_000462785.1.34614 WP_000462785.1.34647 WP_000462785.1.34659 WP_000462785.1.34667 WP_000462785.1.34703 WP_000462785.1.34704 WP_000462785.1.34707 WP_000462785.1.34711 WP_000462785.1.34745 WP_000462785.1.3476 WP_000462785.1.34801 WP_000462785.1.34817 WP_000462785.1.34820 WP_000462785.1.34854 WP_000462785.1.34856 WP_000462785.1.34881 WP_000462785.1.3489 WP_000462785.1.34972 WP_000462785.1.34975 WP_000462785.1.34977 WP_000462785.1.35035 WP_000462785.1.35045 WP_000462785.1.35075 WP_000462785.1.35125 WP_000462785.1.35129 WP_000462785.1.35184 WP_000462785.1.35219 WP_000462785.1.35294 WP_000462785.1.35298 WP_000462785.1.35321 WP_000462785.1.35331 WP_000462785.1.35371 WP_000462785.1.35404 WP_000462785.1.35408 WP_000462785.1.3541 WP_000462785.1.35425 WP_000462785.1.35429 WP_000462785.1.35446 WP_000462785.1.35460 WP_000462785.1.35463 WP_000462785.1.35494 WP_000462785.1.35503 WP_000462785.1.35507 WP_000462785.1.35509 WP_000462785.1.3556 WP_000462785.1.35563 WP_000462785.1.35570 WP_000462785.1.35575 WP_000462785.1.35590 WP_000462785.1.35594 WP_000462785.1.35624 WP_000462785.1.35648 WP_000462785.1.3566 WP_000462785.1.35777 WP_000462785.1.35809 WP_000462785.1.35835 WP_000462785.1.35868 WP_000462785.1.35887 WP_000462785.1.35936 WP_000462785.1.35940 WP_000462785.1.35993 WP_000462785.1.36003 WP_000462785.1.3601 WP_000462785.1.36011 WP_000462785.1.36037 WP_000462785.1.36057 WP_000462785.1.36063 WP_000462785.1.3610 WP_000462785.1.36157 WP_000462785.1.36172 WP_000462785.1.36229 WP_000462785.1.36232 WP_000462785.1.36236 WP_000462785.1.36286 WP_000462785.1.36409 WP_000462785.1.36425 WP_000462785.1.36445 WP_000462785.1.36512 WP_000462785.1.36542 WP_000462785.1.36564 WP_000462785.1.36584 WP_000462785.1.36586 WP_000462785.1.36592 WP_000462785.1.36609 WP_000462785.1.36652 WP_000462785.1.36685 WP_000462785.1.36690 WP_000462785.1.3670 WP_000462785.1.36705 WP_000462785.1.36721 WP_000462785.1.36751 WP_000462785.1.36764 WP_000462785.1.36765 WP_000462785.1.36792 WP_000462785.1.36839 WP_000462785.1.36875 WP_000462785.1.3688 WP_000462785.1.36885 WP_000462785.1.36889 WP_000462785.1.36899 WP_000462785.1.36918 WP_000462785.1.36931 WP_000462785.1.36949 WP_000462785.1.36978 WP_000462785.1.37013 WP_000462785.1.37021 WP_000462785.1.37028 WP_000462785.1.37029 WP_000462785.1.37063 WP_000462785.1.37073 WP_000462785.1.37100 WP_000462785.1.37111 WP_000462785.1.37112 WP_000462785.1.37114 WP_000462785.1.37119 WP_000462785.1.37147 WP_000462785.1.37158 WP_000462785.1.37190 WP_000462785.1.37191 WP_000462785.1.37256 WP_000462785.1.37267 WP_000462785.1.3728 WP_000462785.1.37293 WP_000462785.1.37297 WP_000462785.1.37320 WP_000462785.1.3734 WP_000462785.1.37351 WP_000462785.1.37363 WP_000462785.1.37370 WP_000462785.1.37376 WP_000462785.1.37405 WP_000462785.1.3741 WP_000462785.1.3744 WP_000462785.1.37478 WP_000462785.1.3748 WP_000462785.1.37498 WP_000462785.1.37504 WP_000462785.1.3751 WP_000462785.1.37521 WP_000462785.1.37558 WP_000462785.1.3756 WP_000462785.1.37610 WP_000462785.1.37618 WP_000462785.1.37666 WP_000462785.1.37687 WP_000462785.1.3771 WP_000462785.1.37719 WP_000462785.1.3778 WP_000462785.1.37808 WP_000462785.1.37848 WP_000462785.1.37864 WP_000462785.1.3790 WP_000462785.1.37965 WP_000462785.1.37968 WP_000462785.1.37978 WP_000462785.1.38001 WP_000462785.1.38026 WP_000462785.1.38037 WP_000462785.1.38047 WP_000462785.1.38055 WP_000462785.1.38113 WP_000462785.1.38125 WP_000462785.1.38145 WP_000462785.1.38199 WP_000462785.1.38273 WP_000462785.1.3828 WP_000462785.1.383 WP_000462785.1.38322 WP_000462785.1.38341 WP_000462785.1.38344 WP_000462785.1.38349 WP_000462785.1.38408 WP_000462785.1.38452 WP_000462785.1.3848 WP_000462785.1.38512 WP_000462785.1.38609 WP_000462785.1.38613 WP_000462785.1.38620 WP_000462785.1.38622 WP_000462785.1.38673 WP_000462785.1.3869 WP_000462785.1.38693 WP_000462785.1.38740 WP_000462785.1.38773 WP_000462785.1.38797 WP_000462785.1.38830 WP_000462785.1.38857 WP_000462785.1.38881 WP_000462785.1.38882 WP_000462785.1.38886 WP_000462785.1.38895 WP_000462785.1.38898 WP_000462785.1.3891 WP_000462785.1.38913 WP_000462785.1.38942 WP_000462785.1.38995 WP_000462785.1.39003 WP_000462785.1.39038 WP_000462785.1.39048 WP_000462785.1.39055 WP_000462785.1.39059 WP_000462785.1.39065 WP_000462785.1.39075 WP_000462785.1.39082 WP_000462785.1.39112 WP_000462785.1.39113 WP_000462785.1.39128 WP_000462785.1.39136 WP_000462785.1.39140 WP_000462785.1.39146 WP_000462785.1.39183 WP_000462785.1.39197 WP_000462785.1.39229 WP_000462785.1.39275 WP_000462785.1.39311 WP_000462785.1.39312 WP_000462785.1.39385 WP_000462785.1.39395 WP_000462785.1.39405 WP_000462785.1.39420 WP_000462785.1.39449 WP_000462785.1.39466 WP_000462785.1.39471 WP_000462785.1.39484 WP_000462785.1.39497 WP_000462785.1.39503 WP_000462785.1.39512 WP_000462785.1.39553 WP_000462785.1.39556 WP_000462785.1.39576 WP_000462785.1.39609 WP_000462785.1.39629 WP_000462785.1.39632 WP_000462785.1.39722 WP_000462785.1.39723 WP_000462785.1.39763 WP_000462785.1.39808 WP_000462785.1.39862 WP_000462785.1.39921 WP_000462785.1.39923 WP_000462785.1.39953 WP_000462785.1.40008 WP_000462785.1.40017 WP_000462785.1.40025 WP_000462785.1.40031 WP_000462785.1.40072 WP_000462785.1.40073 WP_000462785.1.40081 WP_000462785.1.4011 WP_000462785.1.40111 WP_000462785.1.40155 WP_000462785.1.40170 WP_000462785.1.40171 WP_000462785.1.40205 WP_000462785.1.40208 WP_000462785.1.40224 WP_000462785.1.40229 WP_000462785.1.40240 WP_000462785.1.40254 WP_000462785.1.40257 WP_000462785.1.40258 WP_000462785.1.40259 WP_000462785.1.40292 WP_000462785.1.40305 WP_000462785.1.40307 WP_000462785.1.40311 WP_000462785.1.4037 WP_000462785.1.40374 WP_000462785.1.40380 WP_000462785.1.40395 WP_000462785.1.40414 WP_000462785.1.40465 WP_000462785.1.40492 WP_000462785.1.40493 WP_000462785.1.40508 WP_000462785.1.40528 WP_000462785.1.40533 WP_000462785.1.40577 WP_000462785.1.40583 WP_000462785.1.40605 WP_000462785.1.40622 WP_000462785.1.40648 WP_000462785.1.40688 WP_000462785.1.40693 WP_000462785.1.40695 WP_000462785.1.40710 WP_000462785.1.40722 WP_000462785.1.40745 WP_000462785.1.4075 WP_000462785.1.40771 WP_000462785.1.40788 WP_000462785.1.40849 WP_000462785.1.4087 WP_000462785.1.40877 WP_000462785.1.40910 WP_000462785.1.40930 WP_000462785.1.40935 WP_000462785.1.40973 WP_000462785.1.40979 WP_000462785.1.41017 WP_000462785.1.41048 WP_000462785.1.41050 WP_000462785.1.41086 WP_000462785.1.4109 WP_000462785.1.41091 WP_000462785.1.41116 WP_000462785.1.41128 WP_000462785.1.41192 WP_000462785.1.41225 WP_000462785.1.41226 WP_000462785.1.41265 WP_000462785.1.41277 WP_000462785.1.41279 WP_000462785.1.41299 WP_000462785.1.41308 WP_000462785.1.41310 WP_000462785.1.41345 WP_000462785.1.41375 WP_000462785.1.41427 WP_000462785.1.41438 WP_000462785.1.41440 WP_000462785.1.41468 WP_000462785.1.41516 WP_000462785.1.41528 WP_000462785.1.41554 WP_000462785.1.41572 WP_000462785.1.41591 WP_000462785.1.41593 WP_000462785.1.41610 WP_000462785.1.41628 WP_000462785.1.41662 WP_000462785.1.41688 WP_000462785.1.41690 WP_000462785.1.41708 WP_000462785.1.41724 WP_000462785.1.41735 WP_000462785.1.41761 WP_000462785.1.4178 WP_000462785.1.41789 WP_000462785.1.41799 WP_000462785.1.41802 WP_000462785.1.4184 WP_000462785.1.41859 WP_000462785.1.41862 WP_000462785.1.41877 WP_000462785.1.41882 WP_000462785.1.41897 WP_000462785.1.41904 WP_000462785.1.41911 WP_000462785.1.41931 WP_000462785.1.41938 WP_000462785.1.41949 WP_000462785.1.41978 WP_000462785.1.41979 WP_000462785.1.41985 WP_000462785.1.41994 WP_000462785.1.41998 WP_000462785.1.42009 WP_000462785.1.42098 WP_000462785.1.42104 WP_000462785.1.42109 WP_000462785.1.42136 WP_000462785.1.422 WP_000462785.1.42238 WP_000462785.1.42244 WP_000462785.1.42248 WP_000462785.1.42262 WP_000462785.1.42263 WP_000462785.1.42276 WP_000462785.1.4229 WP_000462785.1.42320 WP_000462785.1.42322 WP_000462785.1.42328 WP_000462785.1.42342 WP_000462785.1.42356 WP_000462785.1.42372 WP_000462785.1.4239 WP_000462785.1.42392 WP_000462785.1.42394 WP_000462785.1.42404 WP_000462785.1.42422 WP_000462785.1.42433 WP_000462785.1.42453 WP_000462785.1.42489 WP_000462785.1.42491 WP_000462785.1.4254 WP_000462785.1.4257 WP_000462785.1.42595 WP_000462785.1.42605 WP_000462785.1.42655 WP_000462785.1.42666 WP_000462785.1.42675 WP_000462785.1.42683 WP_000462785.1.42685 WP_000462785.1.42707 WP_000462785.1.42734 WP_000462785.1.4276 WP_000462785.1.42767 WP_000462785.1.42794 WP_000462785.1.42797 WP_000462785.1.42829 WP_000462785.1.42861 WP_000462785.1.42864 WP_000462785.1.4288 WP_000462785.1.42887 WP_000462785.1.4289 WP_000462785.1.42892 WP_000462785.1.42923 WP_000462785.1.42932 WP_000462785.1.42957 WP_000462785.1.42978 WP_000462785.1.42981 WP_000462785.1.43018 WP_000462785.1.43041 WP_000462785.1.43070 WP_000462785.1.43086 WP_000462785.1.43089 WP_000462785.1.43126 WP_000462785.1.43149 WP_000462785.1.43160 WP_000462785.1.43201 WP_000462785.1.43244 WP_000462785.1.43258 WP_000462785.1.43272 WP_000462785.1.43276 WP_000462785.1.43299 WP_000462785.1.43312 WP_000462785.1.4332 WP_000462785.1.43334 WP_000462785.1.43351 WP_000462785.1.43437 WP_000462785.1.43438 WP_000462785.1.4344 WP_000462785.1.43441 WP_000462785.1.43476 WP_000462785.1.43508 WP_000462785.1.43520 WP_000462785.1.43522 WP_000462785.1.43528 WP_000462785.1.43535 WP_000462785.1.43606 WP_000462785.1.43613 WP_000462785.1.43654 WP_000462785.1.43668 WP_000462785.1.43676 WP_000462785.1.43685 WP_000462785.1.43710 WP_000462785.1.43711 WP_000462785.1.4373 WP_000462785.1.43763 WP_000462785.1.43782 WP_000462785.1.43785 WP_000462785.1.43828 WP_000462785.1.43839 WP_000462785.1.43864 WP_000462785.1.43873 WP_000462785.1.43875 WP_000462785.1.43886 WP_000462785.1.43954 WP_000462785.1.44005 WP_000462785.1.44010 WP_000462785.1.4404 WP_000462785.1.44043 WP_000462785.1.4405 WP_000462785.1.44063 WP_000462785.1.44099 WP_000462785.1.44113 WP_000462785.1.44121 WP_000462785.1.44132 WP_000462785.1.44144 WP_000462785.1.44187 WP_000462785.1.44191 WP_000462785.1.44208 WP_000462785.1.4422 WP_000462785.1.4423 WP_000462785.1.44250 WP_000462785.1.44291 WP_000462785.1.44337 WP_000462785.1.44339 WP_000462785.1.44359 WP_000462785.1.44380 WP_000462785.1.44386 WP_000462785.1.4440 WP_000462785.1.44438 WP_000462785.1.44440 WP_000462785.1.44443 WP_000462785.1.44453 WP_000462785.1.44474 WP_000462785.1.44479 WP_000462785.1.44549 WP_000462785.1.44578 WP_000462785.1.44593 WP_000462785.1.44606 WP_000462785.1.44607 WP_000462785.1.44633 WP_000462785.1.44636 WP_000462785.1.44640 WP_000462785.1.4467 WP_000462785.1.44678 WP_000462785.1.44687 WP_000462785.1.44702 WP_000462785.1.44705 WP_000462785.1.44747 WP_000462785.1.44781 WP_000462785.1.44791 WP_000462785.1.44795 WP_000462785.1.44831 WP_000462785.1.44833 WP_000462785.1.4485 WP_000462785.1.44877 WP_000462785.1.44887 WP_000462785.1.449 WP_000462785.1.44927 WP_000462785.1.44950 WP_000462785.1.44966 WP_000462785.1.44971 WP_000462785.1.44978 WP_000462785.1.44985 WP_000462785.1.44996 WP_000462785.1.44997 WP_000462785.1.44998 WP_000462785.1.4500 WP_000462785.1.45027 WP_000462785.1.45038 WP_000462785.1.45045 WP_000462785.1.4505 WP_000462785.1.45067 WP_000462785.1.45074 WP_000462785.1.45079 WP_000462785.1.45098 WP_000462785.1.45123 WP_000462785.1.45134 WP_000462785.1.45138 WP_000462785.1.45154 WP_000462785.1.45173 WP_000462785.1.45177 WP_000462785.1.45184 WP_000462785.1.45229 WP_000462785.1.45251 WP_000462785.1.45259 WP_000462785.1.45268 WP_000462785.1.45302 WP_000462785.1.4531 WP_000462785.1.45322 WP_000462785.1.45344 WP_000462785.1.45349 WP_000462785.1.45351 WP_000462785.1.45365 WP_000462785.1.4540 WP_000462785.1.45402 WP_000462785.1.45432 WP_000462785.1.45462 WP_000462785.1.45468 WP_000462785.1.45522 WP_000462785.1.45535 WP_000462785.1.45549 WP_000462785.1.45550 WP_000462785.1.45566 WP_000462785.1.45569 WP_000462785.1.45571 WP_000462785.1.45583 WP_000462785.1.45585 WP_000462785.1.45660 WP_000462785.1.45690 WP_000462785.1.45706 WP_000462785.1.45781 WP_000462785.1.45797 WP_000462785.1.458 WP_000462785.1.45844 WP_000462785.1.45906 WP_000462785.1.45918 WP_000462785.1.45943 WP_000462785.1.45973 WP_000462785.1.45984 WP_000462785.1.46011 WP_000462785.1.46028 WP_000462785.1.46069 WP_000462785.1.46091 WP_000462785.1.46112 WP_000462785.1.46124 WP_000462785.1.46173 WP_000462785.1.46174 WP_000462785.1.46187 WP_000462785.1.46203 WP_000462785.1.46205 WP_000462785.1.46215 WP_000462785.1.46232 WP_000462785.1.46243 WP_000462785.1.46250 WP_000462785.1.46286 WP_000462785.1.46299 WP_000462785.1.46303 WP_000462785.1.46322 WP_000462785.1.46323 WP_000462785.1.46345 WP_000462785.1.46358 WP_000462785.1.46406 WP_000462785.1.46444 WP_000462785.1.46499 WP_000462785.1.46572 WP_000462785.1.46574 WP_000462785.1.46578 WP_000462785.1.46595 WP_000462785.1.46620 WP_000462785.1.46637 WP_000462785.1.46666 WP_000462785.1.46675 WP_000462785.1.46689 WP_000462785.1.46693 WP_000462785.1.4671 WP_000462785.1.46726 WP_000462785.1.46730 WP_000462785.1.46732 WP_000462785.1.4674 WP_000462785.1.46749 WP_000462785.1.46803 WP_000462785.1.46804 WP_000462785.1.4686 WP_000462785.1.46930 WP_000462785.1.46961 WP_000462785.1.46967 WP_000462785.1.46975 WP_000462785.1.46976 WP_000462785.1.47005 WP_000462785.1.47014 WP_000462785.1.47023 WP_000462785.1.47057 WP_000462785.1.47058 WP_000462785.1.47061 WP_000462785.1.47067 WP_000462785.1.47110 WP_000462785.1.47214 WP_000462785.1.47243 WP_000462785.1.47257 WP_000462785.1.47389 WP_000462785.1.47429 WP_000462785.1.47442 WP_000462785.1.47448 WP_000462785.1.47460 WP_000462785.1.4747 WP_000462785.1.47472 WP_000462785.1.47478 WP_000462785.1.47482 WP_000462785.1.47492 WP_000462785.1.47506 WP_000462785.1.47507 WP_000462785.1.47542 WP_000462785.1.47567 WP_000462785.1.47576 WP_000462785.1.4758 WP_000462785.1.47587 WP_000462785.1.47614 WP_000462785.1.47621 WP_000462785.1.47649 WP_000462785.1.47660 WP_000462785.1.4769 WP_000462785.1.4770 WP_000462785.1.47714 WP_000462785.1.4775 WP_000462785.1.47767 WP_000462785.1.47799 WP_000462785.1.47814 WP_000462785.1.47817 WP_000462785.1.47829 WP_000462785.1.47849 WP_000462785.1.47850 WP_000462785.1.47875 WP_000462785.1.47902 WP_000462785.1.47911 WP_000462785.1.47928 WP_000462785.1.4795 WP_000462785.1.47988 WP_000462785.1.47992 WP_000462785.1.48033 WP_000462785.1.48124 WP_000462785.1.48132 WP_000462785.1.48134 WP_000462785.1.48209 WP_000462785.1.48215 WP_000462785.1.48218 WP_000462785.1.48242 WP_000462785.1.48244 WP_000462785.1.48247 WP_000462785.1.48253 WP_000462785.1.48262 WP_000462785.1.483 WP_000462785.1.48342 WP_000462785.1.48367 WP_000462785.1.48377 WP_000462785.1.4839 WP_000462785.1.48399 WP_000462785.1.48455 WP_000462785.1.48493 WP_000462785.1.48510 WP_000462785.1.48524 WP_000462785.1.4853 WP_000462785.1.48570 WP_000462785.1.48647 WP_000462785.1.48651 WP_000462785.1.48751 WP_000462785.1.48755 WP_000462785.1.48768 WP_000462785.1.48774 WP_000462785.1.48788 WP_000462785.1.48797 WP_000462785.1.48841 WP_000462785.1.4885 WP_000462785.1.48855 WP_000462785.1.48876 WP_000462785.1.48886 WP_000462785.1.48894 WP_000462785.1.48896 WP_000462785.1.48908 WP_000462785.1.48918 WP_000462785.1.48919 WP_000462785.1.48931 WP_000462785.1.48985 WP_000462785.1.49005 WP_000462785.1.49012 WP_000462785.1.49084 WP_000462785.1.49090 WP_000462785.1.49102 WP_000462785.1.49155 WP_000462785.1.49162 WP_000462785.1.49175 WP_000462785.1.49204 WP_000462785.1.49214 WP_000462785.1.49226 WP_000462785.1.49233 WP_000462785.1.49239 WP_000462785.1.49256 WP_000462785.1.49262 WP_000462785.1.49276 WP_000462785.1.49290 WP_000462785.1.49304 WP_000462785.1.49309 WP_000462785.1.49311 WP_000462785.1.49334 WP_000462785.1.49340 WP_000462785.1.49358 WP_000462785.1.49366 WP_000462785.1.49375 WP_000462785.1.49430 WP_000462785.1.49443 WP_000462785.1.49472 WP_000462785.1.49490 WP_000462785.1.49494 WP_000462785.1.49515 WP_000462785.1.49534 WP_000462785.1.49550 WP_000462785.1.49572 WP_000462785.1.49574 WP_000462785.1.49590 WP_000462785.1.49595 WP_000462785.1.49602 WP_000462785.1.49626 WP_000462785.1.49630 WP_000462785.1.49647 WP_000462785.1.49650 WP_000462785.1.49710 WP_000462785.1.49770 WP_000462785.1.49778 WP_000462785.1.49780 WP_000462785.1.4979 WP_000462785.1.49790 WP_000462785.1.49803 WP_000462785.1.49805 WP_000462785.1.49827 WP_000462785.1.49848 WP_000462785.1.49929 WP_000462785.1.49931 WP_000462785.1.50 WP_000462785.1.50003 WP_000462785.1.50007 WP_000462785.1.50080 WP_000462785.1.5009 WP_000462785.1.50128 WP_000462785.1.50153 WP_000462785.1.50161 WP_000462785.1.50198 WP_000462785.1.50211 WP_000462785.1.50238 WP_000462785.1.50239 WP_000462785.1.50251 WP_000462785.1.50285 WP_000462785.1.50332 WP_000462785.1.50349 WP_000462785.1.50374 WP_000462785.1.50376 WP_000462785.1.50386 WP_000462785.1.50389 WP_000462785.1.50413 WP_000462785.1.50449 WP_000462785.1.50469 WP_000462785.1.50478 WP_000462785.1.50480 WP_000462785.1.50517 WP_000462785.1.50529 WP_000462785.1.50563 WP_000462785.1.50565 WP_000462785.1.50576 WP_000462785.1.5058 WP_000462785.1.50593 WP_000462785.1.50652 WP_000462785.1.50676 WP_000462785.1.50684 WP_000462785.1.50750 WP_000462785.1.50769 WP_000462785.1.50774 WP_000462785.1.50782 WP_000462785.1.50800 WP_000462785.1.50804 WP_000462785.1.50808 WP_000462785.1.50811 WP_000462785.1.5088 WP_000462785.1.50882 WP_000462785.1.50893 WP_000462785.1.50908 WP_000462785.1.50918 WP_000462785.1.50941 WP_000462785.1.50954 WP_000462785.1.50960 WP_000462785.1.51014 WP_000462785.1.51022 WP_000462785.1.51025 WP_000462785.1.51117 WP_000462785.1.51131 WP_000462785.1.51139 WP_000462785.1.5114 WP_000462785.1.51179 WP_000462785.1.51182 WP_000462785.1.51186 WP_000462785.1.5125 WP_000462785.1.51285 WP_000462785.1.51308 WP_000462785.1.51331 WP_000462785.1.51338 WP_000462785.1.51356 WP_000462785.1.5138 WP_000462785.1.51394 WP_000462785.1.51412 WP_000462785.1.51414 WP_000462785.1.51419 WP_000462785.1.51451 WP_000462785.1.51464 WP_000462785.1.51487 WP_000462785.1.51488 WP_000462785.1.51502 WP_000462785.1.51506 WP_000462785.1.51514 WP_000462785.1.51518 WP_000462785.1.51555 WP_000462785.1.51594 WP_000462785.1.51611 WP_000462785.1.51613 WP_000462785.1.51615 WP_000462785.1.51634 WP_000462785.1.51642 WP_000462785.1.51649 WP_000462785.1.51686 WP_000462785.1.51700 WP_000462785.1.51704 WP_000462785.1.51756 WP_000462785.1.51764 WP_000462785.1.51810 WP_000462785.1.51841 WP_000462785.1.5185 WP_000462785.1.51868 WP_000462785.1.51888 WP_000462785.1.51900 WP_000462785.1.51910 WP_000462785.1.51911 WP_000462785.1.51915 WP_000462785.1.51930 WP_000462785.1.51932 WP_000462785.1.51989 WP_000462785.1.51994 WP_000462785.1.520 WP_000462785.1.52047 WP_000462785.1.52101 WP_000462785.1.5211 WP_000462785.1.52121 WP_000462785.1.52123 WP_000462785.1.52148 WP_000462785.1.52156 WP_000462785.1.5216 WP_000462785.1.52161 WP_000462785.1.52255 WP_000462785.1.52301 WP_000462785.1.52321 WP_000462785.1.52336 WP_000462785.1.52346 WP_000462785.1.52353 WP_000462785.1.52356 WP_000462785.1.52361 WP_000462785.1.52438 WP_000462785.1.52446 WP_000462785.1.52456 WP_000462785.1.52527 WP_000462785.1.52528 WP_000462785.1.52582 WP_000462785.1.52586 WP_000462785.1.52608 WP_000462785.1.52637 WP_000462785.1.52653 WP_000462785.1.52656 WP_000462785.1.52675 WP_000462785.1.5273 WP_000462785.1.52738 WP_000462785.1.52743 WP_000462785.1.52744 WP_000462785.1.52748 WP_000462785.1.52824 WP_000462785.1.52833 WP_000462785.1.52857 WP_000462785.1.52858 WP_000462785.1.52898 WP_000462785.1.52910 WP_000462785.1.52915 WP_000462785.1.52924 WP_000462785.1.5301 WP_000462785.1.53016 WP_000462785.1.53100 WP_000462785.1.53107 WP_000462785.1.53119 WP_000462785.1.5313 WP_000462785.1.53158 WP_000462785.1.5316 WP_000462785.1.53179 WP_000462785.1.53190 WP_000462785.1.53198 WP_000462785.1.53203 WP_000462785.1.53206 WP_000462785.1.53234 WP_000462785.1.53274 WP_000462785.1.53286 WP_000462785.1.53315 WP_000462785.1.53316 WP_000462785.1.53328 WP_000462785.1.5333 WP_000462785.1.53362 WP_000462785.1.53385 WP_000462785.1.53406 WP_000462785.1.53436 WP_000462785.1.53454 WP_000462785.1.53466 WP_000462785.1.53529 WP_000462785.1.53543 WP_000462785.1.53567 WP_000462785.1.53664 WP_000462785.1.53675 WP_000462785.1.53688 WP_000462785.1.53694 WP_000462785.1.53696 WP_000462785.1.53757 WP_000462785.1.53772 WP_000462785.1.53778 WP_000462785.1.53781 WP_000462785.1.53790 WP_000462785.1.53812 WP_000462785.1.53814 WP_000462785.1.53896 WP_000462785.1.5392 WP_000462785.1.53935 WP_000462785.1.53961 WP_000462785.1.54033 WP_000462785.1.54061 WP_000462785.1.54068 WP_000462785.1.54075 WP_000462785.1.54082 WP_000462785.1.54085 WP_000462785.1.54136 WP_000462785.1.5415 WP_000462785.1.54159 WP_000462785.1.54196 WP_000462785.1.542 WP_000462785.1.54209 WP_000462785.1.54271 WP_000462785.1.54273 WP_000462785.1.54274 WP_000462785.1.54283 WP_000462785.1.54319 WP_000462785.1.54324 WP_000462785.1.54333 WP_000462785.1.54340 WP_000462785.1.54364 WP_000462785.1.54366 WP_000462785.1.54400 WP_000462785.1.54500 WP_000462785.1.54522 WP_000462785.1.54558 WP_000462785.1.5456 WP_000462785.1.54569 WP_000462785.1.5459 WP_000462785.1.54607 WP_000462785.1.54615 WP_000462785.1.5462 WP_000462785.1.54644 WP_000462785.1.54662 WP_000462785.1.54694 WP_000462785.1.54722 WP_000462785.1.54749 WP_000462785.1.54764 WP_000462785.1.54774 WP_000462785.1.54814 WP_000462785.1.54822 WP_000462785.1.54827 WP_000462785.1.54833 WP_000462785.1.54845 WP_000462785.1.5485 WP_000462785.1.54877 WP_000462785.1.5493 WP_000462785.1.54936 WP_000462785.1.54984 WP_000462785.1.54992 WP_000462785.1.55008 WP_000462785.1.55073 WP_000462785.1.55152 WP_000462785.1.55156 WP_000462785.1.55166 WP_000462785.1.5517 WP_000462785.1.55178 WP_000462785.1.55200 WP_000462785.1.55223 WP_000462785.1.55224 WP_000462785.1.5523 WP_000462785.1.5525 WP_000462785.1.55285 WP_000462785.1.55294 WP_000462785.1.55361 WP_000462785.1.55418 WP_000462785.1.55461 WP_000462785.1.55475 WP_000462785.1.55477 WP_000462785.1.55496 WP_000462785.1.55500 WP_000462785.1.5552 WP_000462785.1.55528 WP_000462785.1.55545 WP_000462785.1.5555 WP_000462785.1.55554 WP_000462785.1.55557 WP_000462785.1.55559 WP_000462785.1.55614 WP_000462785.1.55623 WP_000462785.1.55640 WP_000462785.1.55647 WP_000462785.1.55672 WP_000462785.1.55680 WP_000462785.1.55706 WP_000462785.1.55718 WP_000462785.1.5572 WP_000462785.1.55743 WP_000462785.1.55768 WP_000462785.1.5577 WP_000462785.1.55782 WP_000462785.1.55796 WP_000462785.1.55803 WP_000462785.1.55923 WP_000462785.1.55948 WP_000462785.1.55993 WP_000462785.1.55995 WP_000462785.1.56002 WP_000462785.1.56004 WP_000462785.1.56012 WP_000462785.1.56026 WP_000462785.1.56059 WP_000462785.1.56069 WP_000462785.1.56070 WP_000462785.1.56082 WP_000462785.1.56097 WP_000462785.1.56100 WP_000462785.1.56105 WP_000462785.1.56130 WP_000462785.1.56152 WP_000462785.1.56222 WP_000462785.1.56235 WP_000462785.1.56238 WP_000462785.1.56247 WP_000462785.1.56261 WP_000462785.1.56263 WP_000462785.1.56286 WP_000462785.1.56303 WP_000462785.1.56304 WP_000462785.1.56305 WP_000462785.1.5633 WP_000462785.1.56354 WP_000462785.1.56368 WP_000462785.1.56370 WP_000462785.1.56374 WP_000462785.1.56385 WP_000462785.1.56389 WP_000462785.1.56393 WP_000462785.1.56396 WP_000462785.1.56413 WP_000462785.1.56414 WP_000462785.1.56420 WP_000462785.1.56438 WP_000462785.1.56468 WP_000462785.1.56512 WP_000462785.1.56560 WP_000462785.1.56597 WP_000462785.1.56601 WP_000462785.1.56614 WP_000462785.1.56615 WP_000462785.1.56642 WP_000462785.1.56647 WP_000462785.1.56651 WP_000462785.1.56671 WP_000462785.1.5668 WP_000462785.1.56682 WP_000462785.1.56791 WP_000462785.1.56824 WP_000462785.1.56851 WP_000462785.1.56853 WP_000462785.1.56861 WP_000462785.1.56877 WP_000462785.1.56893 WP_000462785.1.56898 WP_000462785.1.56905 WP_000462785.1.56942 WP_000462785.1.57000 WP_000462785.1.57026 WP_000462785.1.57039 WP_000462785.1.57056 WP_000462785.1.57076 WP_000462785.1.57084 WP_000462785.1.5711 WP_000462785.1.57125 WP_000462785.1.57143 WP_000462785.1.57149 WP_000462785.1.57168 WP_000462785.1.57187 WP_000462785.1.57232 WP_000462785.1.57233 WP_000462785.1.57244 WP_000462785.1.57246 WP_000462785.1.57296 WP_000462785.1.57307 WP_000462785.1.57344 WP_000462785.1.57357 WP_000462785.1.57362 WP_000462785.1.57377 WP_000462785.1.57399 WP_000462785.1.57418 WP_000462785.1.57433 WP_000462785.1.57494 WP_000462785.1.57495 WP_000462785.1.57510 WP_000462785.1.57515 WP_000462785.1.57521 WP_000462785.1.57529 WP_000462785.1.5753 WP_000462785.1.57534 WP_000462785.1.57555 WP_000462785.1.57559 WP_000462785.1.57576 WP_000462785.1.57601 WP_000462785.1.57607 WP_000462785.1.5761 WP_000462785.1.57631 WP_000462785.1.57641 WP_000462785.1.57709 WP_000462785.1.57710 WP_000462785.1.57735 WP_000462785.1.57763 WP_000462785.1.57778 WP_000462785.1.57781 WP_000462785.1.57797 WP_000462785.1.5781 WP_000462785.1.57835 WP_000462785.1.57857 WP_000462785.1.57862 WP_000462785.1.57890 WP_000462785.1.57891 WP_000462785.1.57893 WP_000462785.1.57978 WP_000462785.1.5801 WP_000462785.1.58040 WP_000462785.1.58041 WP_000462785.1.58090 WP_000462785.1.58131 WP_000462785.1.58144 WP_000462785.1.58153 WP_000462785.1.58157 WP_000462785.1.58239 WP_000462785.1.58249 WP_000462785.1.58251 WP_000462785.1.5828 WP_000462785.1.58290 WP_000462785.1.58301 WP_000462785.1.58334 WP_000462785.1.58357 WP_000462785.1.58372 WP_000462785.1.58416 WP_000462785.1.58418 WP_000462785.1.58442 WP_000462785.1.58443 WP_000462785.1.58451 WP_000462785.1.5846 WP_000462785.1.58467 WP_000462785.1.58486 WP_000462785.1.58489 WP_000462785.1.5854 WP_000462785.1.58548 WP_000462785.1.58564 WP_000462785.1.5858 WP_000462785.1.58604 WP_000462785.1.58633 WP_000462785.1.58648 WP_000462785.1.58662 WP_000462785.1.58669 WP_000462785.1.58675 WP_000462785.1.58698 WP_000462785.1.587 WP_000462785.1.58729 WP_000462785.1.58744 WP_000462785.1.5878 WP_000462785.1.58803 WP_000462785.1.58831 WP_000462785.1.58834 WP_000462785.1.58836 WP_000462785.1.5886 WP_000462785.1.58861 WP_000462785.1.58884 WP_000462785.1.58926 WP_000462785.1.58932 WP_000462785.1.59006 WP_000462785.1.59012 WP_000462785.1.59068 WP_000462785.1.59084 WP_000462785.1.59094 WP_000462785.1.59097 WP_000462785.1.59125 WP_000462785.1.59136 WP_000462785.1.59142 WP_000462785.1.59148 WP_000462785.1.59163 WP_000462785.1.59224 WP_000462785.1.59236 WP_000462785.1.59276 WP_000462785.1.5929 WP_000462785.1.59294 WP_000462785.1.59295 WP_000462785.1.59321 WP_000462785.1.59336 WP_000462785.1.59375 WP_000462785.1.59381 WP_000462785.1.59412 WP_000462785.1.59427 WP_000462785.1.59439 WP_000462785.1.59458 WP_000462785.1.59486 WP_000462785.1.59490 WP_000462785.1.59508 WP_000462785.1.59512 WP_000462785.1.59521 WP_000462785.1.5953 WP_000462785.1.59538 WP_000462785.1.59548 WP_000462785.1.59562 WP_000462785.1.59587 WP_000462785.1.59604 WP_000462785.1.59636 WP_000462785.1.59641 WP_000462785.1.59646 WP_000462785.1.59648 WP_000462785.1.59684 WP_000462785.1.59694 WP_000462785.1.59709 WP_000462785.1.59710 WP_000462785.1.59755 WP_000462785.1.59771 WP_000462785.1.5979 WP_000462785.1.59830 WP_000462785.1.59848 WP_000462785.1.59928 WP_000462785.1.5993 WP_000462785.1.59933 WP_000462785.1.59953 WP_000462785.1.59979 WP_000462785.1.60004 WP_000462785.1.60008 WP_000462785.1.60015 WP_000462785.1.60021 WP_000462785.1.60052 WP_000462785.1.60069 WP_000462785.1.60106 WP_000462785.1.60126 WP_000462785.1.60137 WP_000462785.1.60140 WP_000462785.1.60155 WP_000462785.1.60209 WP_000462785.1.60213 WP_000462785.1.60226 WP_000462785.1.60231 WP_000462785.1.60285 WP_000462785.1.60320 WP_000462785.1.6033 WP_000462785.1.60330 WP_000462785.1.60370 WP_000462785.1.60379 WP_000462785.1.60464 WP_000462785.1.60469 WP_000462785.1.60503 WP_000462785.1.60507 WP_000462785.1.6052 WP_000462785.1.60560 WP_000462785.1.60597 WP_000462785.1.60608 WP_000462785.1.60622 WP_000462785.1.60643 WP_000462785.1.60661 WP_000462785.1.60713 WP_000462785.1.60746 WP_000462785.1.60760 WP_000462785.1.60794 WP_000462785.1.608 WP_000462785.1.60809 WP_000462785.1.60838 WP_000462785.1.60851 WP_000462785.1.60855 WP_000462785.1.60857 WP_000462785.1.6086 WP_000462785.1.60863 WP_000462785.1.60866 WP_000462785.1.60874 WP_000462785.1.60897 WP_000462785.1.6090 WP_000462785.1.60918 WP_000462785.1.60919 WP_000462785.1.60926 WP_000462785.1.60941 WP_000462785.1.60976 WP_000462785.1.60988 WP_000462785.1.60990 WP_000462785.1.61045 WP_000462785.1.61078 WP_000462785.1.6108 WP_000462785.1.61087 WP_000462785.1.61114 WP_000462785.1.6114 WP_000462785.1.61146 WP_000462785.1.61184 WP_000462785.1.61200 WP_000462785.1.61201 WP_000462785.1.61218 WP_000462785.1.61232 WP_000462785.1.61233 WP_000462785.1.6129 WP_000462785.1.61296 WP_000462785.1.61309 WP_000462785.1.61345 WP_000462785.1.61356 WP_000462785.1.61381 WP_000462785.1.61417 WP_000462785.1.6143 WP_000462785.1.61434 WP_000462785.1.61497 WP_000462785.1.61501 WP_000462785.1.61509 WP_000462785.1.61519 WP_000462785.1.61574 WP_000462785.1.61582 WP_000462785.1.61594 WP_000462785.1.61595 WP_000462785.1.61609 WP_000462785.1.6164 WP_000462785.1.61662 WP_000462785.1.61667 WP_000462785.1.61671 WP_000462785.1.61694 WP_000462785.1.61712 WP_000462785.1.61714 WP_000462785.1.61730 WP_000462785.1.61732 WP_000462785.1.61737 WP_000462785.1.61743 WP_000462785.1.61783 WP_000462785.1.61857 WP_000462785.1.6190 WP_000462785.1.61908 WP_000462785.1.61918 WP_000462785.1.61922 WP_000462785.1.61924 WP_000462785.1.61952 WP_000462785.1.61968 WP_000462785.1.62007 WP_000462785.1.62025 WP_000462785.1.62063 WP_000462785.1.62076 WP_000462785.1.6210 WP_000462785.1.62108 WP_000462785.1.62120 WP_000462785.1.62122 WP_000462785.1.62142 WP_000462785.1.62144 WP_000462785.1.62158 WP_000462785.1.62184 WP_000462785.1.62195 WP_000462785.1.62201 WP_000462785.1.62204 WP_000462785.1.62210 WP_000462785.1.62219 WP_000462785.1.62222 WP_000462785.1.62241 WP_000462785.1.62271 WP_000462785.1.62304 WP_000462785.1.62310 WP_000462785.1.62339 WP_000462785.1.62344 WP_000462785.1.62361 WP_000462785.1.62364 WP_000462785.1.62374 WP_000462785.1.62403 WP_000462785.1.62404 WP_000462785.1.62412 WP_000462785.1.62442 WP_000462785.1.62486 WP_000462785.1.62488 WP_000462785.1.62504 WP_000462785.1.62522 WP_000462785.1.6253 WP_000462785.1.62564 WP_000462785.1.62570 WP_000462785.1.62619 WP_000462785.1.62648 WP_000462785.1.62677 WP_000462785.1.62693 WP_000462785.1.627 WP_000462785.1.62725 WP_000462785.1.62745 WP_000462785.1.62757 WP_000462785.1.62798 WP_000462785.1.62828 WP_000462785.1.62853 WP_000462785.1.62903 WP_000462785.1.62910 WP_000462785.1.6292 WP_000462785.1.62955 WP_000462785.1.62976 WP_000462785.1.62983 WP_000462785.1.62988 WP_000462785.1.63043 WP_000462785.1.63045 WP_000462785.1.63063 WP_000462785.1.63102 WP_000462785.1.63118 WP_000462785.1.63129 WP_000462785.1.63135 WP_000462785.1.63150 WP_000462785.1.63155 WP_000462785.1.63181 WP_000462785.1.63186 WP_000462785.1.63229 WP_000462785.1.63234 WP_000462785.1.63243 WP_000462785.1.63250 WP_000462785.1.63256 WP_000462785.1.63290 WP_000462785.1.63358 WP_000462785.1.63382 WP_000462785.1.63422 WP_000462785.1.63432 WP_000462785.1.63455 WP_000462785.1.63461 WP_000462785.1.63479 WP_000462785.1.63497 WP_000462785.1.63499 WP_000462785.1.63509 WP_000462785.1.63513 WP_000462785.1.63525 WP_000462785.1.63529 WP_000462785.1.63532 WP_000462785.1.63568 WP_000462785.1.6357 WP_000462785.1.63577 WP_000462785.1.63585 WP_000462785.1.63603 WP_000462785.1.63633 WP_000462785.1.63664 WP_000462785.1.6367 WP_000462785.1.63677 WP_000462785.1.63690 WP_000462785.1.6370 WP_000462785.1.63718 WP_000462785.1.63731 WP_000462785.1.63748 WP_000462785.1.6375 WP_000462785.1.63757 WP_000462785.1.63766 WP_000462785.1.63781 WP_000462785.1.63782 WP_000462785.1.63824 WP_000462785.1.63831 WP_000462785.1.63834 WP_000462785.1.6384 WP_000462785.1.63851 WP_000462785.1.63860 WP_000462785.1.63863 WP_000462785.1.63864 WP_000462785.1.63866 WP_000462785.1.63903 WP_000462785.1.63912 WP_000462785.1.63934 WP_000462785.1.63958 WP_000462785.1.63977 WP_000462785.1.6399 WP_000462785.1.63992 WP_000462785.1.64007 WP_000462785.1.64010 WP_000462785.1.64034 WP_000462785.1.64046 WP_000462785.1.64072 WP_000462785.1.64085 WP_000462785.1.64109 WP_000462785.1.64157 WP_000462785.1.64176 WP_000462785.1.64208 WP_000462785.1.64217 WP_000462785.1.64229 WP_000462785.1.6423 WP_000462785.1.64242 WP_000462785.1.64244 WP_000462785.1.64266 WP_000462785.1.64294 WP_000462785.1.64350 WP_000462785.1.6437 WP_000462785.1.64374 WP_000462785.1.64385 WP_000462785.1.64389 WP_000462785.1.64403 WP_000462785.1.64412 WP_000462785.1.64462 WP_000462785.1.64500 WP_000462785.1.6451 WP_000462785.1.64569 WP_000462785.1.64597 WP_000462785.1.64645 WP_000462785.1.64649 WP_000462785.1.64667 WP_000462785.1.64674 WP_000462785.1.64690 WP_000462785.1.64702 WP_000462785.1.64711 WP_000462785.1.64721 WP_000462785.1.64757 WP_000462785.1.64758 WP_000462785.1.64771 WP_000462785.1.64781 WP_000462785.1.64798 WP_000462785.1.64831 WP_000462785.1.6489 WP_000462785.1.64919 WP_000462785.1.64920 WP_000462785.1.64944 WP_000462785.1.64972 WP_000462785.1.64977 WP_000462785.1.65011 WP_000462785.1.65016 WP_000462785.1.65018 WP_000462785.1.65022 WP_000462785.1.65027 WP_000462785.1.65028 WP_000462785.1.65052 WP_000462785.1.65163 WP_000462785.1.65168 WP_000462785.1.65171 WP_000462785.1.65185 WP_000462785.1.65238 WP_000462785.1.65248 WP_000462785.1.6525 WP_000462785.1.65295 WP_000462785.1.65348 WP_000462785.1.6535 WP_000462785.1.65357 WP_000462785.1.65363 WP_000462785.1.65394 WP_000462785.1.65437 WP_000462785.1.65471 WP_000462785.1.65474 WP_000462785.1.65475 WP_000462785.1.6550 WP_000462785.1.65508 WP_000462785.1.65538 WP_000462785.1.65558 WP_000462785.1.65572 WP_000462785.1.6560 WP_000462785.1.65601 WP_000462785.1.6561 WP_000462785.1.65620 WP_000462785.1.65633 WP_000462785.1.6565 WP_000462785.1.65687 WP_000462785.1.65696 WP_000462785.1.65698 WP_000462785.1.6572 WP_000462785.1.6575 WP_000462785.1.65771 WP_000462785.1.65782 WP_000462785.1.65790 WP_000462785.1.65795 WP_000462785.1.65818 WP_000462785.1.65838 WP_000462785.1.65849 WP_000462785.1.65876 WP_000462785.1.65881 WP_000462785.1.65883 WP_000462785.1.65901 WP_000462785.1.6594 WP_000462785.1.65945 WP_000462785.1.6595 WP_000462785.1.65968 WP_000462785.1.66074 WP_000462785.1.66082 WP_000462785.1.66085 WP_000462785.1.66167 WP_000462785.1.66171 WP_000462785.1.66235 WP_000462785.1.66250 WP_000462785.1.66270 WP_000462785.1.66272 WP_000462785.1.6630 WP_000462785.1.66314 WP_000462785.1.66315 WP_000462785.1.66358 WP_000462785.1.66362 WP_000462785.1.66365 WP_000462785.1.66368 WP_000462785.1.6638 WP_000462785.1.66385 WP_000462785.1.6640 WP_000462785.1.66400 WP_000462785.1.66428 WP_000462785.1.66446 WP_000462785.1.66462 WP_000462785.1.6647 WP_000462785.1.66492 WP_000462785.1.66534 WP_000462785.1.66539 WP_000462785.1.66600 WP_000462785.1.66630 WP_000462785.1.66698 WP_000462785.1.66702 WP_000462785.1.66733 WP_000462785.1.66779 WP_000462785.1.6680 WP_000462785.1.66800 WP_000462785.1.66807 WP_000462785.1.66820 WP_000462785.1.66824 WP_000462785.1.66825 WP_000462785.1.66834 WP_000462785.1.66876 WP_000462785.1.66901 WP_000462785.1.6692 WP_000462785.1.66959 WP_000462785.1.66962 WP_000462785.1.67 WP_000462785.1.67037 WP_000462785.1.67045 WP_000462785.1.67075 WP_000462785.1.6710 WP_000462785.1.67173 WP_000462785.1.67175 WP_000462785.1.67181 WP_000462785.1.67184 WP_000462785.1.67228 WP_000462785.1.67268 WP_000462785.1.67279 WP_000462785.1.67288 WP_000462785.1.67347 WP_000462785.1.67374 WP_000462785.1.67405 WP_000462785.1.67424 WP_000462785.1.67465 WP_000462785.1.67552 WP_000462785.1.6760 WP_000462785.1.67603 WP_000462785.1.67617 WP_000462785.1.67633 WP_000462785.1.67682 WP_000462785.1.67705 WP_000462785.1.67707 WP_000462785.1.67731 WP_000462785.1.67772 WP_000462785.1.67776 WP_000462785.1.67803 WP_000462785.1.67814 WP_000462785.1.6782 WP_000462785.1.67825 WP_000462785.1.67827 WP_000462785.1.67829 WP_000462785.1.6785 WP_000462785.1.67887 WP_000462785.1.67905 WP_000462785.1.67932 WP_000462785.1.67942 WP_000462785.1.67969 WP_000462785.1.67970 WP_000462785.1.67977 WP_000462785.1.67988 WP_000462785.1.68036 WP_000462785.1.68073 WP_000462785.1.68075 WP_000462785.1.6809 WP_000462785.1.68115 WP_000462785.1.68140 WP_000462785.1.68147 WP_000462785.1.68159 WP_000462785.1.68167 WP_000462785.1.68201 WP_000462785.1.68206 WP_000462785.1.68210 WP_000462785.1.6827 WP_000462785.1.68275 WP_000462785.1.6833 WP_000462785.1.68478 WP_000462785.1.6849 WP_000462785.1.685 WP_000462785.1.68532 WP_000462785.1.68547 WP_000462785.1.6857 WP_000462785.1.6858 WP_000462785.1.68589 WP_000462785.1.68591 WP_000462785.1.68629 WP_000462785.1.68652 WP_000462785.1.68655 WP_000462785.1.68656 WP_000462785.1.68658 WP_000462785.1.68677 WP_000462785.1.6869 WP_000462785.1.68690 WP_000462785.1.6875 WP_000462785.1.68778 WP_000462785.1.68787 WP_000462785.1.6879 WP_000462785.1.68816 WP_000462785.1.68818 WP_000462785.1.6882 WP_000462785.1.6883 WP_000462785.1.68893 WP_000462785.1.68894 WP_000462785.1.68895 WP_000462785.1.68928 WP_000462785.1.68958 WP_000462785.1.68966 WP_000462785.1.68975 WP_000462785.1.68999 WP_000462785.1.69006 WP_000462785.1.69011 WP_000462785.1.69029 WP_000462785.1.69042 WP_000462785.1.6905 WP_000462785.1.69058 WP_000462785.1.6907 WP_000462785.1.69080 WP_000462785.1.69086 WP_000462785.1.6913 WP_000462785.1.69131 WP_000462785.1.69139 WP_000462785.1.69146 WP_000462785.1.69236 WP_000462785.1.69255 WP_000462785.1.69273 WP_000462785.1.69288 WP_000462785.1.69296 WP_000462785.1.69320 WP_000462785.1.69346 WP_000462785.1.69357 WP_000462785.1.69371 WP_000462785.1.69385 WP_000462785.1.69397 WP_000462785.1.69433 WP_000462785.1.69465 WP_000462785.1.69485 WP_000462785.1.69515 WP_000462785.1.69554 WP_000462785.1.69564 WP_000462785.1.69575 WP_000462785.1.69588 WP_000462785.1.69592 WP_000462785.1.69597 WP_000462785.1.69616 WP_000462785.1.69636 WP_000462785.1.69644 WP_000462785.1.69696 WP_000462785.1.69704 WP_000462785.1.69710 WP_000462785.1.69754 WP_000462785.1.69760 WP_000462785.1.69767 WP_000462785.1.69785 WP_000462785.1.69787 WP_000462785.1.69790 WP_000462785.1.69807 WP_000462785.1.69808 WP_000462785.1.69817 WP_000462785.1.69839 WP_000462785.1.69848 WP_000462785.1.69890 WP_000462785.1.69965 WP_000462785.1.69975 WP_000462785.1.69977 WP_000462785.1.70003 WP_000462785.1.70028 WP_000462785.1.70047 WP_000462785.1.70087 WP_000462785.1.70088 WP_000462785.1.7010 WP_000462785.1.7014 WP_000462785.1.7016 WP_000462785.1.70169 WP_000462785.1.70183 WP_000462785.1.7021 WP_000462785.1.70241 WP_000462785.1.70248 WP_000462785.1.70269 WP_000462785.1.70272 WP_000462785.1.70281 WP_000462785.1.70289 WP_000462785.1.70290 WP_000462785.1.70321 WP_000462785.1.70326 WP_000462785.1.70327 WP_000462785.1.70355 WP_000462785.1.7044 WP_000462785.1.70440 WP_000462785.1.70447 WP_000462785.1.70485 WP_000462785.1.70488 WP_000462785.1.70491 WP_000462785.1.70523 WP_000462785.1.70531 WP_000462785.1.70547 WP_000462785.1.7055 WP_000462785.1.70580 WP_000462785.1.70596 WP_000462785.1.7060 WP_000462785.1.70643 WP_000462785.1.70644 WP_000462785.1.70662 WP_000462785.1.70678 WP_000462785.1.70683 WP_000462785.1.70685 WP_000462785.1.70712 WP_000462785.1.70732 WP_000462785.1.70733 WP_000462785.1.70761 WP_000462785.1.70785 WP_000462785.1.70792 WP_000462785.1.70797 WP_000462785.1.70837 WP_000462785.1.70869 WP_000462785.1.70883 WP_000462785.1.70899 WP_000462785.1.70914 WP_000462785.1.70922 WP_000462785.1.7093 WP_000462785.1.70948 WP_000462785.1.70969 WP_000462785.1.70971 WP_000462785.1.70986 WP_000462785.1.71007 WP_000462785.1.71010 WP_000462785.1.71069 WP_000462785.1.71088 WP_000462785.1.7110 WP_000462785.1.71116 WP_000462785.1.71120 WP_000462785.1.71146 WP_000462785.1.71150 WP_000462785.1.71165 WP_000462785.1.71171 WP_000462785.1.71172 WP_000462785.1.71184 WP_000462785.1.71188 WP_000462785.1.71201 WP_000462785.1.71202 WP_000462785.1.71243 WP_000462785.1.71245 WP_000462785.1.71248 WP_000462785.1.71268 WP_000462785.1.71299 WP_000462785.1.71305 WP_000462785.1.71306 WP_000462785.1.71337 WP_000462785.1.7134 WP_000462785.1.71368 WP_000462785.1.71378 WP_000462785.1.714 WP_000462785.1.71401 WP_000462785.1.7142 WP_000462785.1.71446 WP_000462785.1.71450 WP_000462785.1.71452 WP_000462785.1.71481 WP_000462785.1.71500 WP_000462785.1.71583 WP_000462785.1.71626 WP_000462785.1.71649 WP_000462785.1.71656 WP_000462785.1.71658 WP_000462785.1.71667 WP_000462785.1.71691 WP_000462785.1.71702 WP_000462785.1.7174 WP_000462785.1.71746 WP_000462785.1.71750 WP_000462785.1.71756 WP_000462785.1.71793 WP_000462785.1.71845 WP_000462785.1.71848 WP_000462785.1.71881 WP_000462785.1.71908 WP_000462785.1.71923 WP_000462785.1.71929 WP_000462785.1.71941 WP_000462785.1.71952 WP_000462785.1.71973 WP_000462785.1.71979 WP_000462785.1.71984 WP_000462785.1.720 WP_000462785.1.72065 WP_000462785.1.72068 WP_000462785.1.72100 WP_000462785.1.72105 WP_000462785.1.72107 WP_000462785.1.72119 WP_000462785.1.72121 WP_000462785.1.72188 WP_000462785.1.72190 WP_000462785.1.72203 WP_000462785.1.72220 WP_000462785.1.72221 WP_000462785.1.72226 WP_000462785.1.72234 WP_000462785.1.72243 WP_000462785.1.72254 WP_000462785.1.72277 WP_000462785.1.72281 WP_000462785.1.72283 WP_000462785.1.72300 WP_000462785.1.72307 WP_000462785.1.72325 WP_000462785.1.72339 WP_000462785.1.72351 WP_000462785.1.72372 WP_000462785.1.72376 WP_000462785.1.72382 WP_000462785.1.72399 WP_000462785.1.72412 WP_000462785.1.7243 WP_000462785.1.72438 WP_000462785.1.72532 WP_000462785.1.72594 WP_000462785.1.72602 WP_000462785.1.72629 WP_000462785.1.72642 WP_000462785.1.72671 WP_000462785.1.72689 WP_000462785.1.72716 WP_000462785.1.72718 WP_000462785.1.72793 WP_000462785.1.72797 WP_000462785.1.72827 WP_000462785.1.72843 WP_000462785.1.72850 WP_000462785.1.72865 WP_000462785.1.72871 WP_000462785.1.72887 WP_000462785.1.72892 WP_000462785.1.72894 WP_000462785.1.72897 WP_000462785.1.72944 WP_000462785.1.72946 WP_000462785.1.7295 WP_000462785.1.72968 WP_000462785.1.72975 WP_000462785.1.7304 WP_000462785.1.73062 WP_000462785.1.73068 WP_000462785.1.73102 WP_000462785.1.73144 WP_000462785.1.7315 WP_000462785.1.7316 WP_000462785.1.73164 WP_000462785.1.73200 WP_000462785.1.73270 WP_000462785.1.73328 WP_000462785.1.73338 WP_000462785.1.7334 WP_000462785.1.73362 WP_000462785.1.73377 WP_000462785.1.73379 WP_000462785.1.7341 WP_000462785.1.73481 WP_000462785.1.73512 WP_000462785.1.73535 WP_000462785.1.7356 WP_000462785.1.73561 WP_000462785.1.73581 WP_000462785.1.73596 WP_000462785.1.73617 WP_000462785.1.73667 WP_000462785.1.73669 WP_000462785.1.73701 WP_000462785.1.73708 WP_000462785.1.7374 WP_000462785.1.73753 WP_000462785.1.73758 WP_000462785.1.73794 WP_000462785.1.73804 WP_000462785.1.73831 WP_000462785.1.7386 WP_000462785.1.7387 WP_000462785.1.73901 WP_000462785.1.73924 WP_000462785.1.73926 WP_000462785.1.7394 WP_000462785.1.73945 WP_000462785.1.73956 WP_000462785.1.73958 WP_000462785.1.73965 WP_000462785.1.74028 WP_000462785.1.74029 WP_000462785.1.74040 WP_000462785.1.74049 WP_000462785.1.7405 WP_000462785.1.74089 WP_000462785.1.74117 WP_000462785.1.74163 WP_000462785.1.74174 WP_000462785.1.74181 WP_000462785.1.74191 WP_000462785.1.74207 WP_000462785.1.74228 WP_000462785.1.743 WP_000462785.1.74300 WP_000462785.1.7433 WP_000462785.1.74379 WP_000462785.1.74402 WP_000462785.1.74410 WP_000462785.1.74414 WP_000462785.1.74418 WP_000462785.1.74422 WP_000462785.1.74428 WP_000462785.1.7444 WP_000462785.1.74454 WP_000462785.1.74466 WP_000462785.1.74469 WP_000462785.1.74481 WP_000462785.1.74500 WP_000462785.1.74529 WP_000462785.1.74545 WP_000462785.1.74570 WP_000462785.1.74578 WP_000462785.1.7458 WP_000462785.1.74620 WP_000462785.1.74632 WP_000462785.1.74639 WP_000462785.1.74644 WP_000462785.1.74661 WP_000462785.1.74702 WP_000462785.1.74741 WP_000462785.1.74745 WP_000462785.1.74757 WP_000462785.1.74806 WP_000462785.1.74807 WP_000462785.1.74826 WP_000462785.1.74876 WP_000462785.1.74884 WP_000462785.1.74946 WP_000462785.1.74972 WP_000462785.1.74992 WP_000462785.1.74996 WP_000462785.1.75009 WP_000462785.1.75051 WP_000462785.1.75056 WP_000462785.1.75058 WP_000462785.1.75114 WP_000462785.1.75129 WP_000462785.1.75134 WP_000462785.1.75148 WP_000462785.1.75159 WP_000462785.1.75168 WP_000462785.1.75177 WP_000462785.1.75180 WP_000462785.1.75187 WP_000462785.1.75288 WP_000462785.1.75301 WP_000462785.1.7531 WP_000462785.1.75334 WP_000462785.1.75362 WP_000462785.1.75371 WP_000462785.1.75385 WP_000462785.1.75392 WP_000462785.1.75400 WP_000462785.1.75402 WP_000462785.1.7543 WP_000462785.1.75450 WP_000462785.1.75494 WP_000462785.1.7558 WP_000462785.1.75585 WP_000462785.1.75607 WP_000462785.1.75609 WP_000462785.1.75626 WP_000462785.1.75664 WP_000462785.1.75703 WP_000462785.1.75716 WP_000462785.1.75740 WP_000462785.1.75751 WP_000462785.1.75760 WP_000462785.1.75764 WP_000462785.1.75793 WP_000462785.1.75794 WP_000462785.1.75810 WP_000462785.1.75828 WP_000462785.1.75837 WP_000462785.1.75863 WP_000462785.1.75873 WP_000462785.1.75874 WP_000462785.1.75884 WP_000462785.1.75902 WP_000462785.1.75932 WP_000462785.1.75945 WP_000462785.1.75957 WP_000462785.1.75997 WP_000462785.1.76 WP_000462785.1.76020 WP_000462785.1.76024 WP_000462785.1.76055 WP_000462785.1.76097 WP_000462785.1.76102 WP_000462785.1.76108 WP_000462785.1.76115 WP_000462785.1.76137 WP_000462785.1.76156 WP_000462785.1.76164 WP_000462785.1.76170 WP_000462785.1.76186 WP_000462785.1.76197 WP_000462785.1.76208 WP_000462785.1.76252 WP_000462785.1.7629 WP_000462785.1.76301 WP_000462785.1.7633 WP_000462785.1.7634 WP_000462785.1.76345 WP_000462785.1.76346 WP_000462785.1.76364 WP_000462785.1.76434 WP_000462785.1.76445 WP_000462785.1.76451 WP_000462785.1.76471 WP_000462785.1.76495 WP_000462785.1.76529 WP_000462785.1.76532 WP_000462785.1.76548 WP_000462785.1.7655 WP_000462785.1.7657 WP_000462785.1.76576 WP_000462785.1.7660 WP_000462785.1.76611 WP_000462785.1.76673 WP_000462785.1.76706 WP_000462785.1.7672 WP_000462785.1.76721 WP_000462785.1.76724 WP_000462785.1.76738 WP_000462785.1.76756 WP_000462785.1.76760 WP_000462785.1.76776 WP_000462785.1.76799 WP_000462785.1.76806 WP_000462785.1.7684 WP_000462785.1.76866 WP_000462785.1.76875 WP_000462785.1.76880 WP_000462785.1.76899 WP_000462785.1.76913 WP_000462785.1.76968 WP_000462785.1.77017 WP_000462785.1.77033 WP_000462785.1.77038 WP_000462785.1.77047 WP_000462785.1.77080 WP_000462785.1.7712 WP_000462785.1.77180 WP_000462785.1.77184 WP_000462785.1.77241 WP_000462785.1.77244 WP_000462785.1.77271 WP_000462785.1.77292 WP_000462785.1.77306 WP_000462785.1.77313 WP_000462785.1.77349 WP_000462785.1.77356 WP_000462785.1.77390 WP_000462785.1.77414 WP_000462785.1.77431 WP_000462785.1.77436 WP_000462785.1.77440 WP_000462785.1.77475 WP_000462785.1.77496 WP_000462785.1.77514 WP_000462785.1.77529 WP_000462785.1.77543 WP_000462785.1.77549 WP_000462785.1.77555 WP_000462785.1.77575 WP_000462785.1.77596 WP_000462785.1.77629 WP_000462785.1.77646 WP_000462785.1.77653 WP_000462785.1.77692 WP_000462785.1.77729 WP_000462785.1.77754 WP_000462785.1.77761 WP_000462785.1.7782 WP_000462785.1.7784 WP_000462785.1.77846 WP_000462785.1.77851 WP_000462785.1.77871 WP_000462785.1.77898 WP_000462785.1.77918 WP_000462785.1.7792 WP_000462785.1.7793 WP_000462785.1.77951 WP_000462785.1.77971 WP_000462785.1.77983 WP_000462785.1.77987 WP_000462785.1.77989 WP_000462785.1.78 WP_000462785.1.78016 WP_000462785.1.7802 WP_000462785.1.78026 WP_000462785.1.78033 WP_000462785.1.78051 WP_000462785.1.78053 WP_000462785.1.78076 WP_000462785.1.78096 WP_000462785.1.78100 WP_000462785.1.78110 WP_000462785.1.78120 WP_000462785.1.7814 WP_000462785.1.78168 WP_000462785.1.78170 WP_000462785.1.78180 WP_000462785.1.78201 WP_000462785.1.78245 WP_000462785.1.78259 WP_000462785.1.78301 WP_000462785.1.78339 WP_000462785.1.78352 WP_000462785.1.78366 WP_000462785.1.78383 WP_000462785.1.78407 WP_000462785.1.78443 WP_000462785.1.78495 WP_000462785.1.78496 WP_000462785.1.78501 WP_000462785.1.78502 WP_000462785.1.78602 WP_000462785.1.78603 WP_000462785.1.7861 WP_000462785.1.78618 WP_000462785.1.78632 WP_000462785.1.78658 WP_000462785.1.78673 WP_000462785.1.78697 WP_000462785.1.78715 WP_000462785.1.78734 WP_000462785.1.78735 WP_000462785.1.78738 WP_000462785.1.7877 WP_000462785.1.78771 WP_000462785.1.78789 WP_000462785.1.78802 WP_000462785.1.78815 WP_000462785.1.78830 WP_000462785.1.78835 WP_000462785.1.78862 WP_000462785.1.78871 WP_000462785.1.78874 WP_000462785.1.78877 WP_000462785.1.78881 WP_000462785.1.78896 WP_000462785.1.7891 WP_000462785.1.78913 WP_000462785.1.78918 WP_000462785.1.78928 WP_000462785.1.7893 WP_000462785.1.78930 WP_000462785.1.78951 WP_000462785.1.78959 WP_000462785.1.79011 WP_000462785.1.79032 WP_000462785.1.79081 WP_000462785.1.79099 WP_000462785.1.79140 WP_000462785.1.79151 WP_000462785.1.79167 WP_000462785.1.79189 WP_000462785.1.79203 WP_000462785.1.79235 WP_000462785.1.79289 WP_000462785.1.79297 WP_000462785.1.79302 WP_000462785.1.79335 WP_000462785.1.79370 WP_000462785.1.794 WP_000462785.1.79427 WP_000462785.1.79462 WP_000462785.1.79466 WP_000462785.1.79468 WP_000462785.1.79472 WP_000462785.1.79490 WP_000462785.1.79495 WP_000462785.1.79529 WP_000462785.1.79531 WP_000462785.1.7956 WP_000462785.1.79570 WP_000462785.1.79580 WP_000462785.1.79586 WP_000462785.1.79635 WP_000462785.1.7964 WP_000462785.1.79642 WP_000462785.1.79645 WP_000462785.1.79659 WP_000462785.1.79668 WP_000462785.1.79708 WP_000462785.1.7972 WP_000462785.1.79738 WP_000462785.1.79778 WP_000462785.1.7979 WP_000462785.1.7982 WP_000462785.1.79832 WP_000462785.1.79845 WP_000462785.1.79867 WP_000462785.1.79892 WP_000462785.1.7991 WP_000462785.1.79910 WP_000462785.1.79914 WP_000462785.1.79934 WP_000462785.1.7994 WP_000462785.1.79942 WP_000462785.1.79945 WP_000462785.1.79951 WP_000462785.1.79966 WP_000462785.1.79974 WP_000462785.1.79977 WP_000462785.1.79996 WP_000462785.1.80045 WP_000462785.1.80077 WP_000462785.1.80137 WP_000462785.1.80149 WP_000462785.1.80182 WP_000462785.1.80229 WP_000462785.1.80236 WP_000462785.1.8024 WP_000462785.1.80249 WP_000462785.1.80250 WP_000462785.1.80254 WP_000462785.1.80293 WP_000462785.1.80296 WP_000462785.1.80307 WP_000462785.1.80333 WP_000462785.1.80366 WP_000462785.1.80380 WP_000462785.1.80441 WP_000462785.1.80443 WP_000462785.1.80448 WP_000462785.1.80473 WP_000462785.1.80479 WP_000462785.1.80480 WP_000462785.1.80496 WP_000462785.1.80529 WP_000462785.1.80542 WP_000462785.1.80586 WP_000462785.1.80629 WP_000462785.1.80638 WP_000462785.1.80651 WP_000462785.1.80667 WP_000462785.1.80674 WP_000462785.1.80707 WP_000462785.1.80723 WP_000462785.1.80725 WP_000462785.1.80750 WP_000462785.1.80757 WP_000462785.1.80760 WP_000462785.1.80780 WP_000462785.1.80803 WP_000462785.1.80819 WP_000462785.1.80827 WP_000462785.1.80831 WP_000462785.1.80840 WP_000462785.1.80850 WP_000462785.1.80857 WP_000462785.1.80868 WP_000462785.1.80874 WP_000462785.1.80876 WP_000462785.1.80881 WP_000462785.1.80913 WP_000462785.1.80927 WP_000462785.1.80939 WP_000462785.1.80941 WP_000462785.1.80959 WP_000462785.1.8096 WP_000462785.1.80973 WP_000462785.1.81037 WP_000462785.1.81041 WP_000462785.1.8106 WP_000462785.1.81062 WP_000462785.1.81067 WP_000462785.1.81069 WP_000462785.1.81084 WP_000462785.1.81107 WP_000462785.1.81109 WP_000462785.1.81110 WP_000462785.1.81118 WP_000462785.1.81149 WP_000462785.1.81175 WP_000462785.1.8119 WP_000462785.1.81193 WP_000462785.1.81197 WP_000462785.1.81225 WP_000462785.1.81231 WP_000462785.1.8127 WP_000462785.1.81275 WP_000462785.1.8130 WP_000462785.1.81302 WP_000462785.1.81321 WP_000462785.1.8134 WP_000462785.1.81354 WP_000462785.1.81388 WP_000462785.1.81404 WP_000462785.1.81409 WP_000462785.1.81410 WP_000462785.1.81425 WP_000462785.1.81472 WP_000462785.1.81504 WP_000462785.1.81548 WP_000462785.1.81568 WP_000462785.1.81667 WP_000462785.1.81668 WP_000462785.1.8168 WP_000462785.1.81727 WP_000462785.1.81736 WP_000462785.1.81743 WP_000462785.1.81746 WP_000462785.1.81750 WP_000462785.1.81768 WP_000462785.1.81785 WP_000462785.1.81795 WP_000462785.1.81798 WP_000462785.1.81902 WP_000462785.1.81941 WP_000462785.1.8196 WP_000462785.1.81965 WP_000462785.1.81974 WP_000462785.1.81977 WP_000462785.1.81995 WP_000462785.1.82037 WP_000462785.1.82099 WP_000462785.1.82141 WP_000462785.1.82144 WP_000462785.1.82149 WP_000462785.1.82258 WP_000462785.1.82269 WP_000462785.1.82337 WP_000462785.1.82347 WP_000462785.1.82352 WP_000462785.1.8236 WP_000462785.1.82369 WP_000462785.1.82395 WP_000462785.1.82401 WP_000462785.1.82420 WP_000462785.1.82434 WP_000462785.1.8247 WP_000462785.1.82474 WP_000462785.1.82479 WP_000462785.1.82503 WP_000462785.1.82515 WP_000462785.1.82529 WP_000462785.1.82530 WP_000462785.1.82562 WP_000462785.1.82569 WP_000462785.1.82570 WP_000462785.1.82584 WP_000462785.1.82636 WP_000462785.1.82637 WP_000462785.1.82648 WP_000462785.1.82676 WP_000462785.1.82692 WP_000462785.1.82761 WP_000462785.1.82763 WP_000462785.1.8282 WP_000462785.1.82841 WP_000462785.1.82843 WP_000462785.1.82865 WP_000462785.1.82867 WP_000462785.1.82886 WP_000462785.1.82895 WP_000462785.1.82899 WP_000462785.1.82908 WP_000462785.1.82937 WP_000462785.1.82944 WP_000462785.1.82946 WP_000462785.1.82956 WP_000462785.1.82964 WP_000462785.1.82992 WP_000462785.1.83005 WP_000462785.1.83006 WP_000462785.1.83061 WP_000462785.1.83092 WP_000462785.1.83119 WP_000462785.1.83128 WP_000462785.1.83139 WP_000462785.1.83163 WP_000462785.1.83204 WP_000462785.1.8322 WP_000462785.1.83221 WP_000462785.1.83247 WP_000462785.1.83252 WP_000462785.1.83258 WP_000462785.1.83280 WP_000462785.1.83301 WP_000462785.1.83305 WP_000462785.1.83331 WP_000462785.1.83354 WP_000462785.1.83356 WP_000462785.1.83360 WP_000462785.1.83365 WP_000462785.1.83378 WP_000462785.1.83382 WP_000462785.1.83388 WP_000462785.1.83407 WP_000462785.1.83413 WP_000462785.1.83491 WP_000462785.1.83510 WP_000462785.1.83516 WP_000462785.1.83523 WP_000462785.1.8354 WP_000462785.1.83558 WP_000462785.1.83572 WP_000462785.1.83598 WP_000462785.1.83650 WP_000462785.1.83651 WP_000462785.1.83710 WP_000462785.1.83721 WP_000462785.1.83739 WP_000462785.1.83759 WP_000462785.1.83760 WP_000462785.1.83806 WP_000462785.1.83854 WP_000462785.1.83897 WP_000462785.1.83960 WP_000462785.1.83979 WP_000462785.1.8399 WP_000462785.1.83995 WP_000462785.1.84000 WP_000462785.1.84001 WP_000462785.1.84011 WP_000462785.1.84031 WP_000462785.1.84075 WP_000462785.1.84077 WP_000462785.1.84083 WP_000462785.1.84086 WP_000462785.1.84100 WP_000462785.1.84103 WP_000462785.1.84106 WP_000462785.1.84115 WP_000462785.1.84154 WP_000462785.1.84168 WP_000462785.1.84179 WP_000462785.1.84198 WP_000462785.1.84205 WP_000462785.1.84209 WP_000462785.1.84229 WP_000462785.1.84283 WP_000462785.1.84300 WP_000462785.1.84325 WP_000462785.1.84355 WP_000462785.1.84359 WP_000462785.1.84373 WP_000462785.1.84392 WP_000462785.1.84403 WP_000462785.1.8441 WP_000462785.1.84459 WP_000462785.1.84461 WP_000462785.1.84475 WP_000462785.1.84497 WP_000462785.1.84515 WP_000462785.1.84523 WP_000462785.1.84532 WP_000462785.1.84551 WP_000462785.1.84554 WP_000462785.1.84572 WP_000462785.1.84598 WP_000462785.1.84644 WP_000462785.1.84659 WP_000462785.1.84683 WP_000462785.1.84693 WP_000462785.1.84711 WP_000462785.1.84721 WP_000462785.1.84745 WP_000462785.1.84814 WP_000462785.1.84860 WP_000462785.1.84872 WP_000462785.1.84876 WP_000462785.1.84879 WP_000462785.1.84899 WP_000462785.1.849 WP_000462785.1.8497 WP_000462785.1.84983 WP_000462785.1.850 WP_000462785.1.85014 WP_000462785.1.85031 WP_000462785.1.85040 WP_000462785.1.85079 WP_000462785.1.85094 WP_000462785.1.85120 WP_000462785.1.85126 WP_000462785.1.85134 WP_000462785.1.85147 WP_000462785.1.85178 WP_000462785.1.85180 WP_000462785.1.85190 WP_000462785.1.85192 WP_000462785.1.85217 WP_000462785.1.8526 WP_000462785.1.85271 WP_000462785.1.85301 WP_000462785.1.8533 WP_000462785.1.8537 WP_000462785.1.85408 WP_000462785.1.85433 WP_000462785.1.8545 WP_000462785.1.85456 WP_000462785.1.85469 WP_000462785.1.85481 WP_000462785.1.85483 WP_000462785.1.8552 WP_000462785.1.85541 WP_000462785.1.8556 WP_000462785.1.85615 WP_000462785.1.85617 WP_000462785.1.85654 WP_000462785.1.85663 WP_000462785.1.85671 WP_000462785.1.85672 WP_000462785.1.85675 WP_000462785.1.85723 WP_000462785.1.85742 WP_000462785.1.85759 WP_000462785.1.85777 WP_000462785.1.85780 WP_000462785.1.85784 WP_000462785.1.85791 WP_000462785.1.85797 WP_000462785.1.85854 WP_000462785.1.85855 WP_000462785.1.85864 WP_000462785.1.85886 WP_000462785.1.85900 WP_000462785.1.85904 WP_000462785.1.8591 WP_000462785.1.85943 WP_000462785.1.85982 WP_000462785.1.86007 WP_000462785.1.86010 WP_000462785.1.86017 WP_000462785.1.86092 WP_000462785.1.86120 WP_000462785.1.86126 WP_000462785.1.86138 WP_000462785.1.86157 WP_000462785.1.8616 WP_000462785.1.86206 WP_000462785.1.86224 WP_000462785.1.86259 WP_000462785.1.86284 WP_000462785.1.86285 WP_000462785.1.86306 WP_000462785.1.86310 WP_000462785.1.86316 WP_000462785.1.86335 WP_000462785.1.86347 WP_000462785.1.86356 WP_000462785.1.86380 WP_000462785.1.86389 WP_000462785.1.86442 WP_000462785.1.86450 WP_000462785.1.86453 WP_000462785.1.86466 WP_000462785.1.86469 WP_000462785.1.8647 WP_000462785.1.86514 WP_000462785.1.86580 WP_000462785.1.86588 WP_000462785.1.86593 WP_000462785.1.86601 WP_000462785.1.86610 WP_000462785.1.86634 WP_000462785.1.86656 WP_000462785.1.86658 WP_000462785.1.86661 WP_000462785.1.86676 WP_000462785.1.86699 WP_000462785.1.8672 WP_000462785.1.86735 WP_000462785.1.86744 WP_000462785.1.8678 WP_000462785.1.86807 WP_000462785.1.86810 WP_000462785.1.8684 WP_000462785.1.86859 WP_000462785.1.86860 WP_000462785.1.86895 WP_000462785.1.86902 WP_000462785.1.86906 WP_000462785.1.8691 WP_000462785.1.86915 WP_000462785.1.86921 WP_000462785.1.86982 WP_000462785.1.87038 WP_000462785.1.87051 WP_000462785.1.87095 WP_000462785.1.87143 WP_000462785.1.87148 WP_000462785.1.87187 WP_000462785.1.87219 WP_000462785.1.8722 WP_000462785.1.87220 WP_000462785.1.87265 WP_000462785.1.87276 WP_000462785.1.87282 WP_000462785.1.87283 WP_000462785.1.87323 WP_000462785.1.87346 WP_000462785.1.8736 WP_000462785.1.87365 WP_000462785.1.87370 WP_000462785.1.87376 WP_000462785.1.87460 WP_000462785.1.87484 WP_000462785.1.87493 WP_000462785.1.87500 WP_000462785.1.87552 WP_000462785.1.87583 WP_000462785.1.87584 WP_000462785.1.87618 WP_000462785.1.87626 WP_000462785.1.87651 WP_000462785.1.8767 WP_000462785.1.87687 WP_000462785.1.87712 WP_000462785.1.87779 WP_000462785.1.87813 WP_000462785.1.87875 WP_000462785.1.87891 WP_000462785.1.87905 WP_000462785.1.87933 WP_000462785.1.87945 WP_000462785.1.87999 WP_000462785.1.8800 WP_000462785.1.88014 WP_000462785.1.88019 WP_000462785.1.88052 WP_000462785.1.88073 WP_000462785.1.8809 WP_000462785.1.88136 WP_000462785.1.88165 WP_000462785.1.88174 WP_000462785.1.88185 WP_000462785.1.88214 WP_000462785.1.88222 WP_000462785.1.88244 WP_000462785.1.88264 WP_000462785.1.88275 WP_000462785.1.88291 WP_000462785.1.88293 WP_000462785.1.88303 WP_000462785.1.88356 WP_000462785.1.8837 WP_000462785.1.88393 WP_000462785.1.88423 WP_000462785.1.88474 WP_000462785.1.88483 WP_000462785.1.8849 WP_000462785.1.88508 WP_000462785.1.88597 WP_000462785.1.88609 WP_000462785.1.88620 WP_000462785.1.88624 WP_000462785.1.88651 WP_000462785.1.88675 WP_000462785.1.88683 WP_000462785.1.88698 WP_000462785.1.88703 WP_000462785.1.88731 WP_000462785.1.88762 WP_000462785.1.88776 WP_000462785.1.88792 WP_000462785.1.88817 WP_000462785.1.88845 WP_000462785.1.88854 WP_000462785.1.88902 WP_000462785.1.8891 WP_000462785.1.88942 WP_000462785.1.88966 WP_000462785.1.88967 WP_000462785.1.88968 WP_000462785.1.88970 WP_000462785.1.88981 WP_000462785.1.88995 WP_000462785.1.88998 WP_000462785.1.89008 WP_000462785.1.89054 WP_000462785.1.89116 WP_000462785.1.89120 WP_000462785.1.89138 WP_000462785.1.89169 WP_000462785.1.89174 WP_000462785.1.89177 WP_000462785.1.89188 WP_000462785.1.89215 WP_000462785.1.89221 WP_000462785.1.89291 WP_000462785.1.89304 WP_000462785.1.89311 WP_000462785.1.89355 WP_000462785.1.89362 WP_000462785.1.89408 WP_000462785.1.89425 WP_000462785.1.89452 WP_000462785.1.89462 WP_000462785.1.89512 WP_000462785.1.89527 WP_000462785.1.89570 WP_000462785.1.8958 WP_000462785.1.89580 WP_000462785.1.89604 WP_000462785.1.89606 WP_000462785.1.8961 WP_000462785.1.89622 WP_000462785.1.89632 WP_000462785.1.89634 WP_000462785.1.89636 WP_000462785.1.89647 WP_000462785.1.89659 WP_000462785.1.89680 WP_000462785.1.89746 WP_000462785.1.89764 WP_000462785.1.89777 WP_000462785.1.89789 WP_000462785.1.89815 WP_000462785.1.89832 WP_000462785.1.89854 WP_000462785.1.89870 WP_000462785.1.89902 WP_000462785.1.89914 WP_000462785.1.89940 WP_000462785.1.8996 WP_000462785.1.89965 WP_000462785.1.89975 WP_000462785.1.9002 WP_000462785.1.9003 WP_000462785.1.90033 WP_000462785.1.90084 WP_000462785.1.90097 WP_000462785.1.90108 WP_000462785.1.90193 WP_000462785.1.90211 WP_000462785.1.90220 WP_000462785.1.90248 WP_000462785.1.90252 WP_000462785.1.90293 WP_000462785.1.90311 WP_000462785.1.90348 WP_000462785.1.90363 WP_000462785.1.90409 WP_000462785.1.90417 WP_000462785.1.90421 WP_000462785.1.90440 WP_000462785.1.90453 WP_000462785.1.90458 WP_000462785.1.90472 WP_000462785.1.90521 WP_000462785.1.90522 WP_000462785.1.90540 WP_000462785.1.90557 WP_000462785.1.90563 WP_000462785.1.90566 WP_000462785.1.90585 WP_000462785.1.90620 WP_000462785.1.9064 WP_000462785.1.90641 WP_000462785.1.90686 WP_000462785.1.90701 WP_000462785.1.90734 WP_000462785.1.90748 WP_000462785.1.90759 WP_000462785.1.90792 WP_000462785.1.90814 WP_000462785.1.90859 WP_000462785.1.90866 WP_000462785.1.90876 WP_000462785.1.90878 WP_000462785.1.9089 WP_000462785.1.9093 WP_000462785.1.90959 WP_000462785.1.90973 WP_000462785.1.90983 WP_000462785.1.90984 WP_000462785.1.90991 WP_000462785.1.91003 WP_000462785.1.91023 WP_000462785.1.91042 WP_000462785.1.91049 WP_000462785.1.91069 WP_000462785.1.91107 WP_000462785.1.91156 WP_000462785.1.91189 WP_000462785.1.91215 WP_000462785.1.91278 WP_000462785.1.91282 WP_000462785.1.9131 WP_000462785.1.91312 WP_000462785.1.91331 WP_000462785.1.91334 WP_000462785.1.9137 WP_000462785.1.91372 WP_000462785.1.91381 WP_000462785.1.91405 WP_000462785.1.91424 WP_000462785.1.91453 WP_000462785.1.91459 WP_000462785.1.91470 WP_000462785.1.91473 WP_000462785.1.91474 WP_000462785.1.91493 WP_000462785.1.91505 WP_000462785.1.91512 WP_000462785.1.91524 WP_000462785.1.91528 WP_000462785.1.91536 WP_000462785.1.91564 WP_000462785.1.91579 WP_000462785.1.91580 WP_000462785.1.91625 WP_000462785.1.91628 WP_000462785.1.91655 WP_000462785.1.9166 WP_000462785.1.91702 WP_000462785.1.91724 WP_000462785.1.91732 WP_000462785.1.91736 WP_000462785.1.91742 WP_000462785.1.91772 WP_000462785.1.91776 WP_000462785.1.91788 WP_000462785.1.91795 WP_000462785.1.91806 WP_000462785.1.91864 WP_000462785.1.91880 WP_000462785.1.91898 WP_000462785.1.91903 WP_000462785.1.91904 WP_000462785.1.91914 WP_000462785.1.91974 WP_000462785.1.91984 WP_000462785.1.92013 WP_000462785.1.92039 WP_000462785.1.92047 WP_000462785.1.92060 WP_000462785.1.92067 WP_000462785.1.92068 WP_000462785.1.92082 WP_000462785.1.92093 WP_000462785.1.92099 WP_000462785.1.92108 WP_000462785.1.92122 WP_000462785.1.92129 WP_000462785.1.92149 WP_000462785.1.92171 WP_000462785.1.92183 WP_000462785.1.92208 WP_000462785.1.92213 WP_000462785.1.9222 WP_000462785.1.92268 WP_000462785.1.92270 WP_000462785.1.92299 WP_000462785.1.92310 WP_000462785.1.92318 WP_000462785.1.92375 WP_000462785.1.92394 WP_000462785.1.92396 WP_000462785.1.92399 WP_000462785.1.92408 WP_000462785.1.92411 WP_000462785.1.92439 WP_000462785.1.92443 WP_000462785.1.92452 WP_000462785.1.92482 WP_000462785.1.92529 WP_000462785.1.9253 WP_000462785.1.92531 WP_000462785.1.92557 WP_000462785.1.92562 WP_000462785.1.92575 WP_000462785.1.92628 WP_000462785.1.92646 WP_000462785.1.92659 WP_000462785.1.92669 WP_000462785.1.92671 WP_000462785.1.92729 WP_000462785.1.92738 WP_000462785.1.92758 WP_000462785.1.92786 WP_000462785.1.92806 WP_000462785.1.92827 WP_000462785.1.92832 WP_000462785.1.92836 WP_000462785.1.92842 WP_000462785.1.92843 WP_000462785.1.92875 WP_000462785.1.92879 WP_000462785.1.92890 WP_000462785.1.92895 WP_000462785.1.92926 WP_000462785.1.92929 WP_000462785.1.92936 WP_000462785.1.92939 WP_000462785.1.92947 WP_000462785.1.92975 WP_000462785.1.92988 WP_000462785.1.93061 WP_000462785.1.93076 WP_000462785.1.93086 WP_000462785.1.93101 WP_000462785.1.93118 WP_000462785.1.93136 WP_000462785.1.93155 WP_000462785.1.93213 WP_000462785.1.93215 WP_000462785.1.93275 WP_000462785.1.93322 WP_000462785.1.93350 WP_000462785.1.93365 WP_000462785.1.93376 WP_000462785.1.93524 WP_000462785.1.93543 WP_000462785.1.93577 WP_000462785.1.93596 WP_000462785.1.93604 WP_000462785.1.93648 WP_000462785.1.93650 WP_000462785.1.93656 WP_000462785.1.93662 WP_000462785.1.93671 WP_000462785.1.93691 WP_000462785.1.937 WP_000462785.1.93705 WP_000462785.1.93741 WP_000462785.1.93761 WP_000462785.1.93767 WP_000462785.1.9380 WP_000462785.1.93803 WP_000462785.1.93804 WP_000462785.1.93809 WP_000462785.1.93837 WP_000462785.1.9389 WP_000462785.1.9394 WP_000462785.1.93956 WP_000462785.1.93986 WP_000462785.1.93994 WP_000462785.1.94039 WP_000462785.1.94056 WP_000462785.1.94064 WP_000462785.1.94070 WP_000462785.1.94071 WP_000462785.1.94072 WP_000462785.1.94132 WP_000462785.1.94162 WP_000462785.1.94167 WP_000462785.1.94168 WP_000462785.1.94181 WP_000462785.1.94198 WP_000462785.1.9432 WP_000462785.1.94352 WP_000462785.1.94354 WP_000462785.1.94379 WP_000462785.1.94380 WP_000462785.1.94383 WP_000462785.1.9440 WP_000462785.1.94458 WP_000462785.1.94473 WP_000462785.1.94557 WP_000462785.1.94562 WP_000462785.1.94565 WP_000462785.1.94584 WP_000462785.1.94588 WP_000462785.1.94598 WP_000462785.1.94622 WP_000462785.1.9463 WP_000462785.1.94649 WP_000462785.1.94669 WP_000462785.1.94670 WP_000462785.1.94674 WP_000462785.1.94717 WP_000462785.1.94722 WP_000462785.1.94785 WP_000462785.1.94796 WP_000462785.1.94798 WP_000462785.1.9481 WP_000462785.1.94817 WP_000462785.1.94835 WP_000462785.1.94849 WP_000462785.1.94862 WP_000462785.1.94921 WP_000462785.1.94947 WP_000462785.1.94959 WP_000462785.1.94967 WP_000462785.1.94971 WP_000462785.1.94982 WP_000462785.1.94986 WP_000462785.1.94987 WP_000462785.1.9503 WP_000462785.1.95051 WP_000462785.1.95085 WP_000462785.1.95094 WP_000462785.1.95121 WP_000462785.1.95133 WP_000462785.1.95136 WP_000462785.1.95152 WP_000462785.1.9516 WP_000462785.1.95171 WP_000462785.1.95235 WP_000462785.1.95249 WP_000462785.1.9527 WP_000462785.1.95282 WP_000462785.1.95289 WP_000462785.1.95298 WP_000462785.1.9530 WP_000462785.1.95320 WP_000462785.1.95404 WP_000462785.1.95434 WP_000462785.1.95447 WP_000462785.1.95456 WP_000462785.1.95465 WP_000462785.1.95546 WP_000462785.1.95579 WP_000462785.1.95607 WP_000462785.1.95623 WP_000462785.1.95630 WP_000462785.1.95641 WP_000462785.1.95656 WP_000462785.1.95701 WP_000462785.1.95703 WP_000462785.1.95729 WP_000462785.1.9574 WP_000462785.1.95744 WP_000462785.1.95757 WP_000462785.1.95803 WP_000462785.1.95805 WP_000462785.1.95826 WP_000462785.1.95840 WP_000462785.1.9586 WP_000462785.1.95866 WP_000462785.1.95901 WP_000462785.1.95911 WP_000462785.1.95940 WP_000462785.1.95963 WP_000462785.1.96042 WP_000462785.1.96045 WP_000462785.1.9609 WP_000462785.1.96107 WP_000462785.1.96139 WP_000462785.1.96141 WP_000462785.1.96190 WP_000462785.1.96203 WP_000462785.1.96206 WP_000462785.1.9624 WP_000462785.1.96260 WP_000462785.1.9627 WP_000462785.1.96317 WP_000462785.1.96335 WP_000462785.1.96340 WP_000462785.1.96343 WP_000462785.1.96348 WP_000462785.1.96349 WP_000462785.1.96380 WP_000462785.1.96404 WP_000462785.1.96429 WP_000462785.1.9644 WP_000462785.1.96469 WP_000462785.1.96497 WP_000462785.1.96500 WP_000462785.1.96521 WP_000462785.1.96533 WP_000462785.1.96537 WP_000462785.1.96555 WP_000462785.1.96563 WP_000462785.1.96588 WP_000462785.1.96590 WP_000462785.1.96600 WP_000462785.1.96640 WP_000462785.1.96642 WP_000462785.1.96662 WP_000462785.1.96721 WP_000462785.1.96731 WP_000462785.1.96732 WP_000462785.1.96735 WP_000462785.1.96758 WP_000462785.1.96761 WP_000462785.1.96771 WP_000462785.1.96798 WP_000462785.1.96810 WP_000462785.1.9686 WP_000462785.1.96876 WP_000462785.1.96890 WP_000462785.1.96902 WP_000462785.1.96917 WP_000462785.1.97005 WP_000462785.1.97015 WP_000462785.1.97043 WP_000462785.1.97089 WP_000462785.1.97103 WP_000462785.1.97109 WP_000462785.1.97145 WP_000462785.1.97185 WP_000462785.1.97190 WP_000462785.1.97224 WP_000462785.1.97260 WP_000462785.1.97318 WP_000462785.1.97322 WP_000462785.1.97328 WP_000462785.1.97337 WP_000462785.1.97368 WP_000462785.1.97369 WP_000462785.1.97386 WP_000462785.1.97413 WP_000462785.1.97480 WP_000462785.1.97496 WP_000462785.1.97534 WP_000462785.1.97547 WP_000462785.1.97594 WP_000462785.1.97597 WP_000462785.1.97613 WP_000462785.1.97620 WP_000462785.1.97626 WP_000462785.1.97628 WP_000462785.1.97640 WP_000462785.1.97648 WP_000462785.1.97656 WP_000462785.1.97691 WP_000462785.1.97693 WP_000462785.1.97704 WP_000462785.1.97725 WP_000462785.1.97726 WP_000462785.1.97727 WP_000462785.1.97732 WP_000462785.1.97736 WP_000462785.1.9774 WP_000462785.1.9775 WP_000462785.1.97768 WP_000462785.1.97772 WP_000462785.1.97800 WP_000462785.1.97846 WP_000462785.1.97873 WP_000462785.1.9793 WP_000462785.1.97981 WP_000462785.1.97983 WP_000462785.1.97991 WP_000462785.1.98006 WP_000462785.1.98019 WP_000462785.1.98022 WP_000462785.1.9805 WP_000462785.1.98107 WP_000462785.1.9811 WP_000462785.1.98110 WP_000462785.1.98119 WP_000462785.1.98124 WP_000462785.1.98146 WP_000462785.1.98201 WP_000462785.1.98219 WP_000462785.1.98236 WP_000462785.1.98250 WP_000462785.1.98314 WP_000462785.1.98338 WP_000462785.1.98392 WP_000462785.1.98402 WP_000462785.1.98403 WP_000462785.1.9841 WP_000462785.1.98438 WP_000462785.1.98440 WP_000462785.1.98446 WP_000462785.1.98472 WP_000462785.1.98483 WP_000462785.1.98495 WP_000462785.1.98513 WP_000462785.1.98531 WP_000462785.1.98551 WP_000462785.1.98570 WP_000462785.1.98577 WP_000462785.1.98608 WP_000462785.1.98627 WP_000462785.1.9863 WP_000462785.1.98634 WP_000462785.1.98676 WP_000462785.1.98677 WP_000462785.1.98726 WP_000462785.1.98760 WP_000462785.1.98763 WP_000462785.1.98779 WP_000462785.1.98843 WP_000462785.1.9887 WP_000462785.1.98899 WP_000462785.1.98931 WP_000462785.1.98947 WP_000462785.1.9898 WP_000462785.1.9899 WP_000462785.1.99040 WP_000462785.1.99057 WP_000462785.1.99071 WP_000462785.1.99072 WP_000462785.1.99073 WP_000462785.1.99083 WP_000462785.1.99097 WP_000462785.1.99098 WP_000462785.1.99107 WP_000462785.1.99164 WP_000462785.1.99184 WP_000462785.1.9919 WP_000462785.1.99197 WP_000462785.1.99198 WP_000462785.1.99215 WP_000462785.1.99219 WP_000462785.1.99255 WP_000462785.1.99267 WP_000462785.1.99276 WP_000462785.1.99278 WP_000462785.1.99320 WP_000462785.1.99327 WP_000462785.1.99339 WP_000462785.1.99370 WP_000462785.1.99456 WP_000462785.1.99469 WP_000462785.1.99490 WP_000462785.1.99493 WP_000462785.1.99531 WP_000462785.1.9954 WP_000462785.1.99561 WP_000462785.1.99613 WP_000462785.1.99630 WP_000462785.1.99637 WP_000462785.1.99646 WP_000462785.1.99657 WP_000462785.1.99660 WP_000462785.1.99712 WP_000462785.1.99725 WP_000462785.1.99747 WP_000462785.1.99783 WP_000462785.1.99813 WP_000462785.1.99824 WP_000462785.1.99858 WP_000462785.1.99889 WP_000462785.1.99924 WP_000462785.1.99958 WP_000462785.1.99961 gi|409248548|ref|YP_006884389.1| gi|378698113|ref|YP_005180070.1| gi|16763523|ref|NP_459138.1| gi|224581976|ref|YP_002635774.1| gi|550899558|ref|YP_008668650.1| 272994.SPAB_00167 295319.SPA0135 423368.SNSL254_A0145 439843.SeSA_A0149 454166.SeAg_B0150 476213.SPC_0142 550538.SG0134 554290.SSPA0131 99287.STM0133 gi|161612477|ref|YP_001586442.1| gi|482902682|ref|YP_007901242.1| gi|378448433|ref|YP_005235792.1| ABAK02000001|CDS_4293995-4295146 ABAM02000001|CDS_656977-658128 ABAN01000006|CDS_100662-99511 ABAO01000001|CDS_201973-203124 ABEH02000001|CDS_550869-552020 ABEI01000003|CDS_196274-197425 ABEJ01000001|CDS_333586-334737 ABEW01000003|CDS_133649-132498 ABFF01000009|CDS_101165-100014 ABFH02000001|CDS_143450-142299 AE006468|CDS_155683-156834 AM933173|CDS_155520-156671 CP000026|CDS_157187-158338 CP000857|CDS_150020-151171 CP000886|CDS_149792-150943 CP001113|CDS_157465-158616 CP001127|CDS_155576-156727 CP001138|CDS_157258-158409 CP001363|CDS_156395-157546 FM200053|CDS_157227-158378 FN424405|CDS_155684-156835 NZ_ACBF01000005|CDS_89583-90734 gi|537435502|ref|YP_008479879.1| gi|56412405|ref|YP_149480.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]