SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378448543|ref|YP_005235902.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378448543|ref|YP_005235902.1|
Domain Number 1 Region: 3-195
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.15e-69
Family Ribonuclease H 0.00000818
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|378448543|ref|YP_005235902.1|
Sequence length 198
Comment ribonuclease HII [Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S]
Sequence
MIEFVYPHTHLVAGVDEVGRGPLVGAVVTAAVILDPARPIVGLNDSKKLSEKRRLSLYDE
IKEKALSWSLGRAEAHEIDELNILHATMLAMQRAVAGLHIAPEYVLIDGNRCPELPVPSM
AVVKGDSRVAEISAASILAKVTRDAEMAALDIVFPQYGFAQHKGYPTAFHLEKLAQYGAT
AHHRRSFAPVKRALGLVS
Download sequence
Identical sequences A0A0F6AX34 A0A0F7J5I9 A0A0H3N7T6 A0A0J0W9Z7 A0A0M0QDN6 A0A0R9NAJ8 A0A0T7RXY7 A0A0T9W437 A0A1R2S7L0 A0A1X2V7K0 A0A221YUP5 A0A221Z3T0 A0A249V2J3 A0A265B1Y9 A0A267SJ58 A0A271CUZ1 A0A2C6G580 A0A2D1Y932 A0A2G1P1E1 A0A2H9YFX0 A0A2I6P7N2 A0A2K2YUU4 B4SV12 B4TK58 B5BAP0 B5FJ30 B5R422 E8XI28 G5L4H3 G5N814 G5RAQ9 G5S6M6 M7SIP6 P0A2C1 P0A2C2 Q5PD71 S4IGM3 V7V3N8
gi|525827728|ref|YP_008250427.1| gi|56412503|ref|YP_149578.1| gi|525839309|ref|YP_008256590.1| gi|378987635|ref|YP_005250799.1| 209261.t0231 220341.STY0253 295319.SPA0237 423368.SNSL254_A0252 439851.SeD_A0252 454169.SeHA_C0268 550537.SEN0237 554290.SSPA0229 99287.STM0230 gi|525816103|ref|YP_008246121.1| ABAK02000001|CDS_4421511-4422107 ABAM02000001|CDS_770228-770824 ABAO01000001|CDS_315210-315806 ABEI01000003|CDS_323791-324387 ABEL01000023|CDS_14119-14715 ABFH02000001|CDS_20860-20264 AE006468|CDS_268928-269524 AE014613|CDS_265801-266397 AL513382|CDS_265810-266406 AM933172|CDS_273943-274539 CP000026|CDS_273074-273670 CP001113|CDS_271105-271701 CP001120|CDS_276662-277258 CP001144|CDS_269767-270363 CP001363|CDS_269633-270229 FM200053|CDS_273114-273710 FN424405|CDS_268920-269516 NZ_ACBF01000005|CDS_210480-211076 gi|386590122|ref|YP_006086522.1| gi|538360810|ref|YP_008504095.1| gi|378443683|ref|YP_005231315.1| gi|16763620|ref|NP_459235.1| gi|16759220|ref|NP_454837.1| gi|194447841|ref|YP_002044220.1| gi|525948313|ref|YP_008309915.1| gi|198243184|ref|YP_002214191.1| gi|197361438|ref|YP_002141074.1| gi|378448543|ref|YP_005235902.1| gi|378982772|ref|YP_005245927.1| gi|549722954|ref|YP_008643144.1| gi|207855748|ref|YP_002242399.1| gi|29140770|ref|NP_804112.1| gi|383495053|ref|YP_005395742.1| gi|194442556|ref|YP_002039470.1| gi|482902781|ref|YP_007901341.1| gi|550899651|ref|YP_008668743.1| gi|488652792|ref|YP_007924595.1| gi|378698209|ref|YP_005180166.1| gi|528817940|ref|YP_008359143.1| gi|526219178|ref|YP_008264490.1| gi|379699451|ref|YP_005241179.1| NP_454837.1.84458 NP_459235.1.58477 WP_000569412.1.100007 WP_000569412.1.100008 WP_000569412.1.100010 WP_000569412.1.100017 WP_000569412.1.100036 WP_000569412.1.100077 WP_000569412.1.100079 WP_000569412.1.100115 WP_000569412.1.100129 WP_000569412.1.100149 WP_000569412.1.100165 WP_000569412.1.100191 WP_000569412.1.100196 WP_000569412.1.1002 WP_000569412.1.100234 WP_000569412.1.100258 WP_000569412.1.100284 WP_000569412.1.100313 WP_000569412.1.100314 WP_000569412.1.100321 WP_000569412.1.100354 WP_000569412.1.100376 WP_000569412.1.100392 WP_000569412.1.100412 WP_000569412.1.100413 WP_000569412.1.100421 WP_000569412.1.100424 WP_000569412.1.100432 WP_000569412.1.100436 WP_000569412.1.100438 WP_000569412.1.100446 WP_000569412.1.100450 WP_000569412.1.100457 WP_000569412.1.100484 WP_000569412.1.100488 WP_000569412.1.100502 WP_000569412.1.100519 WP_000569412.1.100521 WP_000569412.1.100557 WP_000569412.1.100584 WP_000569412.1.100589 WP_000569412.1.100592 WP_000569412.1.100597 WP_000569412.1.100605 WP_000569412.1.100610 WP_000569412.1.10065 WP_000569412.1.100650 WP_000569412.1.100711 WP_000569412.1.100730 WP_000569412.1.100732 WP_000569412.1.100733 WP_000569412.1.100739 WP_000569412.1.10074 WP_000569412.1.10076 WP_000569412.1.100764 WP_000569412.1.100776 WP_000569412.1.100781 WP_000569412.1.100793 WP_000569412.1.100799 WP_000569412.1.10081 WP_000569412.1.100857 WP_000569412.1.100869 WP_000569412.1.100870 WP_000569412.1.100871 WP_000569412.1.100882 WP_000569412.1.100895 WP_000569412.1.100941 WP_000569412.1.100944 WP_000569412.1.100948 WP_000569412.1.100953 WP_000569412.1.101007 WP_000569412.1.101011 WP_000569412.1.101020 WP_000569412.1.101042 WP_000569412.1.101074 WP_000569412.1.101078 WP_000569412.1.10108 WP_000569412.1.101094 WP_000569412.1.101111 WP_000569412.1.101112 WP_000569412.1.101180 WP_000569412.1.101185 WP_000569412.1.101199 WP_000569412.1.101223 WP_000569412.1.101226 WP_000569412.1.101239 WP_000569412.1.10124 WP_000569412.1.101259 WP_000569412.1.101271 WP_000569412.1.101284 WP_000569412.1.101291 WP_000569412.1.1013 WP_000569412.1.101312 WP_000569412.1.101320 WP_000569412.1.101322 WP_000569412.1.101353 WP_000569412.1.101374 WP_000569412.1.101386 WP_000569412.1.101404 WP_000569412.1.101420 WP_000569412.1.101473 WP_000569412.1.101519 WP_000569412.1.101541 WP_000569412.1.101589 WP_000569412.1.101609 WP_000569412.1.101616 WP_000569412.1.101634 WP_000569412.1.101639 WP_000569412.1.101666 WP_000569412.1.101674 WP_000569412.1.101707 WP_000569412.1.101734 WP_000569412.1.101740 WP_000569412.1.101744 WP_000569412.1.101815 WP_000569412.1.101832 WP_000569412.1.101839 WP_000569412.1.101841 WP_000569412.1.101878 WP_000569412.1.101890 WP_000569412.1.101904 WP_000569412.1.10191 WP_000569412.1.101917 WP_000569412.1.101927 WP_000569412.1.101941 WP_000569412.1.101949 WP_000569412.1.101953 WP_000569412.1.102050 WP_000569412.1.102087 WP_000569412.1.102103 WP_000569412.1.102111 WP_000569412.1.10220 WP_000569412.1.10231 WP_000569412.1.10266 WP_000569412.1.10276 WP_000569412.1.10300 WP_000569412.1.10338 WP_000569412.1.1038 WP_000569412.1.104 WP_000569412.1.10401 WP_000569412.1.10428 WP_000569412.1.10429 WP_000569412.1.10439 WP_000569412.1.10459 WP_000569412.1.10463 WP_000569412.1.10465 WP_000569412.1.10475 WP_000569412.1.10498 WP_000569412.1.10511 WP_000569412.1.10514 WP_000569412.1.10521 WP_000569412.1.10530 WP_000569412.1.10532 WP_000569412.1.10547 WP_000569412.1.10566 WP_000569412.1.10595 WP_000569412.1.10631 WP_000569412.1.10642 WP_000569412.1.10654 WP_000569412.1.10675 WP_000569412.1.10677 WP_000569412.1.10678 WP_000569412.1.10753 WP_000569412.1.10755 WP_000569412.1.10857 WP_000569412.1.10868 WP_000569412.1.10873 WP_000569412.1.10898 WP_000569412.1.10926 WP_000569412.1.10936 WP_000569412.1.10992 WP_000569412.1.11000 WP_000569412.1.11012 WP_000569412.1.11024 WP_000569412.1.11031 WP_000569412.1.11055 WP_000569412.1.11098 WP_000569412.1.1110 WP_000569412.1.11119 WP_000569412.1.11126 WP_000569412.1.11142 WP_000569412.1.11156 WP_000569412.1.11168 WP_000569412.1.11190 WP_000569412.1.11213 WP_000569412.1.11239 WP_000569412.1.11253 WP_000569412.1.11295 WP_000569412.1.11304 WP_000569412.1.11314 WP_000569412.1.1135 WP_000569412.1.11362 WP_000569412.1.1137 WP_000569412.1.11385 WP_000569412.1.11405 WP_000569412.1.1142 WP_000569412.1.11426 WP_000569412.1.11429 WP_000569412.1.11455 WP_000569412.1.11458 WP_000569412.1.1150 WP_000569412.1.11518 WP_000569412.1.11526 WP_000569412.1.11528 WP_000569412.1.11532 WP_000569412.1.11544 WP_000569412.1.11557 WP_000569412.1.1156 WP_000569412.1.11567 WP_000569412.1.11588 WP_000569412.1.11638 WP_000569412.1.11677 WP_000569412.1.11687 WP_000569412.1.1169 WP_000569412.1.11735 WP_000569412.1.1174 WP_000569412.1.11763 WP_000569412.1.11772 WP_000569412.1.11810 WP_000569412.1.11824 WP_000569412.1.11834 WP_000569412.1.11841 WP_000569412.1.11865 WP_000569412.1.11883 WP_000569412.1.11897 WP_000569412.1.11900 WP_000569412.1.11908 WP_000569412.1.11914 WP_000569412.1.11936 WP_000569412.1.11978 WP_000569412.1.12017 WP_000569412.1.12025 WP_000569412.1.12027 WP_000569412.1.12040 WP_000569412.1.12047 WP_000569412.1.12061 WP_000569412.1.1207 WP_000569412.1.12106 WP_000569412.1.12114 WP_000569412.1.12141 WP_000569412.1.1215 WP_000569412.1.12159 WP_000569412.1.12160 WP_000569412.1.12168 WP_000569412.1.12172 WP_000569412.1.12192 WP_000569412.1.12210 WP_000569412.1.1224 WP_000569412.1.12244 WP_000569412.1.12308 WP_000569412.1.12340 WP_000569412.1.12351 WP_000569412.1.12364 WP_000569412.1.12370 WP_000569412.1.12374 WP_000569412.1.1239 WP_000569412.1.12396 WP_000569412.1.12398 WP_000569412.1.12441 WP_000569412.1.12472 WP_000569412.1.12484 WP_000569412.1.12485 WP_000569412.1.1250 WP_000569412.1.12546 WP_000569412.1.12568 WP_000569412.1.12569 WP_000569412.1.12581 WP_000569412.1.12584 WP_000569412.1.12585 WP_000569412.1.12620 WP_000569412.1.1264 WP_000569412.1.12648 WP_000569412.1.12683 WP_000569412.1.12696 WP_000569412.1.12718 WP_000569412.1.12726 WP_000569412.1.12727 WP_000569412.1.12728 WP_000569412.1.12741 WP_000569412.1.12834 WP_000569412.1.12864 WP_000569412.1.12865 WP_000569412.1.12879 WP_000569412.1.12936 WP_000569412.1.12995 WP_000569412.1.1300 WP_000569412.1.13027 WP_000569412.1.13076 WP_000569412.1.13102 WP_000569412.1.13106 WP_000569412.1.13108 WP_000569412.1.13130 WP_000569412.1.13161 WP_000569412.1.13207 WP_000569412.1.1321 WP_000569412.1.13247 WP_000569412.1.1326 WP_000569412.1.13262 WP_000569412.1.13268 WP_000569412.1.13274 WP_000569412.1.13291 WP_000569412.1.133 WP_000569412.1.13311 WP_000569412.1.13314 WP_000569412.1.13334 WP_000569412.1.13338 WP_000569412.1.13342 WP_000569412.1.13352 WP_000569412.1.13367 WP_000569412.1.13391 WP_000569412.1.13406 WP_000569412.1.13414 WP_000569412.1.13440 WP_000569412.1.13443 WP_000569412.1.1346 WP_000569412.1.13476 WP_000569412.1.13488 WP_000569412.1.13509 WP_000569412.1.13543 WP_000569412.1.13573 WP_000569412.1.13599 WP_000569412.1.13602 WP_000569412.1.13625 WP_000569412.1.13661 WP_000569412.1.13669 WP_000569412.1.13686 WP_000569412.1.1372 WP_000569412.1.13732 WP_000569412.1.13741 WP_000569412.1.13750 WP_000569412.1.13764 WP_000569412.1.13819 WP_000569412.1.1382 WP_000569412.1.13848 WP_000569412.1.13857 WP_000569412.1.1387 WP_000569412.1.13908 WP_000569412.1.13932 WP_000569412.1.13967 WP_000569412.1.13968 WP_000569412.1.1397 WP_000569412.1.13972 WP_000569412.1.140 WP_000569412.1.1401 WP_000569412.1.1408 WP_000569412.1.14089 WP_000569412.1.14099 WP_000569412.1.14111 WP_000569412.1.1412 WP_000569412.1.14120 WP_000569412.1.14123 WP_000569412.1.14150 WP_000569412.1.14151 WP_000569412.1.14191 WP_000569412.1.14197 WP_000569412.1.14239 WP_000569412.1.14280 WP_000569412.1.14286 WP_000569412.1.14320 WP_000569412.1.14333 WP_000569412.1.14369 WP_000569412.1.14379 WP_000569412.1.14399 WP_000569412.1.14406 WP_000569412.1.14410 WP_000569412.1.14436 WP_000569412.1.14444 WP_000569412.1.14458 WP_000569412.1.14466 WP_000569412.1.14467 WP_000569412.1.14474 WP_000569412.1.14495 WP_000569412.1.14500 WP_000569412.1.14505 WP_000569412.1.14516 WP_000569412.1.14519 WP_000569412.1.14524 WP_000569412.1.14526 WP_000569412.1.14550 WP_000569412.1.14554 WP_000569412.1.14575 WP_000569412.1.146 WP_000569412.1.14618 WP_000569412.1.14701 WP_000569412.1.14703 WP_000569412.1.14706 WP_000569412.1.14708 WP_000569412.1.14719 WP_000569412.1.14725 WP_000569412.1.1473 WP_000569412.1.14737 WP_000569412.1.14765 WP_000569412.1.14793 WP_000569412.1.14808 WP_000569412.1.14810 WP_000569412.1.14819 WP_000569412.1.14852 WP_000569412.1.14876 WP_000569412.1.14877 WP_000569412.1.14884 WP_000569412.1.1489 WP_000569412.1.14894 WP_000569412.1.14913 WP_000569412.1.14917 WP_000569412.1.14930 WP_000569412.1.14932 WP_000569412.1.14947 WP_000569412.1.14948 WP_000569412.1.14964 WP_000569412.1.15011 WP_000569412.1.15046 WP_000569412.1.15055 WP_000569412.1.15059 WP_000569412.1.15067 WP_000569412.1.15100 WP_000569412.1.15124 WP_000569412.1.15184 WP_000569412.1.15214 WP_000569412.1.15223 WP_000569412.1.15226 WP_000569412.1.15244 WP_000569412.1.15265 WP_000569412.1.15276 WP_000569412.1.15316 WP_000569412.1.15318 WP_000569412.1.15362 WP_000569412.1.1540 WP_000569412.1.15415 WP_000569412.1.15423 WP_000569412.1.15433 WP_000569412.1.15439 WP_000569412.1.15483 WP_000569412.1.15487 WP_000569412.1.15508 WP_000569412.1.15535 WP_000569412.1.15581 WP_000569412.1.15585 WP_000569412.1.15586 WP_000569412.1.15597 WP_000569412.1.15612 WP_000569412.1.15625 WP_000569412.1.15644 WP_000569412.1.1568 WP_000569412.1.15708 WP_000569412.1.15710 WP_000569412.1.15717 WP_000569412.1.15775 WP_000569412.1.15777 WP_000569412.1.15784 WP_000569412.1.15830 WP_000569412.1.15835 WP_000569412.1.15862 WP_000569412.1.15881 WP_000569412.1.15905 WP_000569412.1.15910 WP_000569412.1.15912 WP_000569412.1.1592 WP_000569412.1.15938 WP_000569412.1.15970 WP_000569412.1.15986 WP_000569412.1.16000 WP_000569412.1.16004 WP_000569412.1.16046 WP_000569412.1.16047 WP_000569412.1.16051 WP_000569412.1.16058 WP_000569412.1.16062 WP_000569412.1.16063 WP_000569412.1.16103 WP_000569412.1.1611 WP_000569412.1.16150 WP_000569412.1.16155 WP_000569412.1.16166 WP_000569412.1.16226 WP_000569412.1.16233 WP_000569412.1.1626 WP_000569412.1.16264 WP_000569412.1.16284 WP_000569412.1.16331 WP_000569412.1.16344 WP_000569412.1.1635 WP_000569412.1.16361 WP_000569412.1.16363 WP_000569412.1.16365 WP_000569412.1.16366 WP_000569412.1.16394 WP_000569412.1.16452 WP_000569412.1.16453 WP_000569412.1.16461 WP_000569412.1.16462 WP_000569412.1.16465 WP_000569412.1.16468 WP_000569412.1.16474 WP_000569412.1.16508 WP_000569412.1.16522 WP_000569412.1.16525 WP_000569412.1.16581 WP_000569412.1.16588 WP_000569412.1.16614 WP_000569412.1.16650 WP_000569412.1.16658 WP_000569412.1.16666 WP_000569412.1.16673 WP_000569412.1.1668 WP_000569412.1.16686 WP_000569412.1.16691 WP_000569412.1.167 WP_000569412.1.16710 WP_000569412.1.16729 WP_000569412.1.16732 WP_000569412.1.16735 WP_000569412.1.16736 WP_000569412.1.1674 WP_000569412.1.16767 WP_000569412.1.16781 WP_000569412.1.16786 WP_000569412.1.16819 WP_000569412.1.16846 WP_000569412.1.16855 WP_000569412.1.16858 WP_000569412.1.16873 WP_000569412.1.16879 WP_000569412.1.1689 WP_000569412.1.16893 WP_000569412.1.16896 WP_000569412.1.16903 WP_000569412.1.16905 WP_000569412.1.16910 WP_000569412.1.16916 WP_000569412.1.16941 WP_000569412.1.16942 WP_000569412.1.16944 WP_000569412.1.16948 WP_000569412.1.16949 WP_000569412.1.16965 WP_000569412.1.16972 WP_000569412.1.16998 WP_000569412.1.1700 WP_000569412.1.17049 WP_000569412.1.17058 WP_000569412.1.17060 WP_000569412.1.17078 WP_000569412.1.17093 WP_000569412.1.17105 WP_000569412.1.17202 WP_000569412.1.17219 WP_000569412.1.1722 WP_000569412.1.17285 WP_000569412.1.17302 WP_000569412.1.17307 WP_000569412.1.17308 WP_000569412.1.1733 WP_000569412.1.17368 WP_000569412.1.1737 WP_000569412.1.17390 WP_000569412.1.174 WP_000569412.1.17405 WP_000569412.1.17406 WP_000569412.1.17439 WP_000569412.1.17447 WP_000569412.1.17480 WP_000569412.1.17482 WP_000569412.1.1749 WP_000569412.1.17504 WP_000569412.1.17513 WP_000569412.1.17525 WP_000569412.1.17543 WP_000569412.1.17546 WP_000569412.1.17560 WP_000569412.1.17563 WP_000569412.1.17578 WP_000569412.1.17583 WP_000569412.1.17622 WP_000569412.1.17659 WP_000569412.1.17667 WP_000569412.1.17686 WP_000569412.1.17702 WP_000569412.1.17703 WP_000569412.1.17705 WP_000569412.1.17732 WP_000569412.1.17741 WP_000569412.1.17743 WP_000569412.1.17747 WP_000569412.1.17755 WP_000569412.1.17840 WP_000569412.1.17886 WP_000569412.1.17891 WP_000569412.1.17901 WP_000569412.1.17914 WP_000569412.1.17936 WP_000569412.1.17956 WP_000569412.1.1798 WP_000569412.1.17991 WP_000569412.1.18005 WP_000569412.1.1801 WP_000569412.1.18019 WP_000569412.1.18021 WP_000569412.1.18056 WP_000569412.1.18061 WP_000569412.1.1807 WP_000569412.1.18092 WP_000569412.1.18099 WP_000569412.1.18109 WP_000569412.1.18111 WP_000569412.1.18122 WP_000569412.1.18124 WP_000569412.1.18144 WP_000569412.1.18149 WP_000569412.1.18163 WP_000569412.1.18173 WP_000569412.1.18177 WP_000569412.1.1818 WP_000569412.1.18192 WP_000569412.1.18249 WP_000569412.1.18254 WP_000569412.1.18265 WP_000569412.1.18267 WP_000569412.1.18270 WP_000569412.1.18280 WP_000569412.1.18281 WP_000569412.1.18282 WP_000569412.1.18328 WP_000569412.1.18355 WP_000569412.1.18358 WP_000569412.1.18370 WP_000569412.1.18384 WP_000569412.1.18406 WP_000569412.1.18468 WP_000569412.1.18474 WP_000569412.1.18485 WP_000569412.1.18513 WP_000569412.1.18607 WP_000569412.1.18610 WP_000569412.1.18641 WP_000569412.1.18678 WP_000569412.1.18686 WP_000569412.1.18692 WP_000569412.1.18705 WP_000569412.1.18715 WP_000569412.1.18722 WP_000569412.1.18737 WP_000569412.1.18766 WP_000569412.1.18776 WP_000569412.1.1880 WP_000569412.1.18822 WP_000569412.1.18847 WP_000569412.1.1885 WP_000569412.1.18860 WP_000569412.1.18881 WP_000569412.1.18886 WP_000569412.1.18922 WP_000569412.1.18940 WP_000569412.1.18949 WP_000569412.1.1895 WP_000569412.1.18959 WP_000569412.1.1897 WP_000569412.1.18972 WP_000569412.1.19001 WP_000569412.1.19006 WP_000569412.1.19030 WP_000569412.1.19038 WP_000569412.1.19044 WP_000569412.1.19053 WP_000569412.1.19055 WP_000569412.1.19064 WP_000569412.1.19084 WP_000569412.1.19093 WP_000569412.1.19187 WP_000569412.1.19228 WP_000569412.1.19240 WP_000569412.1.19273 WP_000569412.1.19288 WP_000569412.1.19291 WP_000569412.1.19300 WP_000569412.1.19320 WP_000569412.1.19357 WP_000569412.1.19373 WP_000569412.1.1939 WP_000569412.1.19422 WP_000569412.1.19433 WP_000569412.1.19454 WP_000569412.1.19456 WP_000569412.1.19458 WP_000569412.1.19460 WP_000569412.1.19461 WP_000569412.1.19496 WP_000569412.1.19535 WP_000569412.1.19538 WP_000569412.1.1955 WP_000569412.1.19588 WP_000569412.1.19589 WP_000569412.1.19614 WP_000569412.1.19616 WP_000569412.1.19642 WP_000569412.1.19656 WP_000569412.1.19663 WP_000569412.1.19683 WP_000569412.1.19686 WP_000569412.1.19702 WP_000569412.1.19706 WP_000569412.1.19723 WP_000569412.1.19724 WP_000569412.1.19731 WP_000569412.1.19749 WP_000569412.1.19784 WP_000569412.1.19793 WP_000569412.1.19794 WP_000569412.1.19802 WP_000569412.1.19809 WP_000569412.1.19823 WP_000569412.1.19834 WP_000569412.1.19867 WP_000569412.1.19882 WP_000569412.1.1992 WP_000569412.1.19975 WP_000569412.1.1998 WP_000569412.1.19999 WP_000569412.1.20 WP_000569412.1.20023 WP_000569412.1.20034 WP_000569412.1.20086 WP_000569412.1.2010 WP_000569412.1.20119 WP_000569412.1.20212 WP_000569412.1.20218 WP_000569412.1.20254 WP_000569412.1.20255 WP_000569412.1.20261 WP_000569412.1.20266 WP_000569412.1.20271 WP_000569412.1.20296 WP_000569412.1.20330 WP_000569412.1.20339 WP_000569412.1.2036 WP_000569412.1.20362 WP_000569412.1.20391 WP_000569412.1.2041 WP_000569412.1.20418 WP_000569412.1.20419 WP_000569412.1.20425 WP_000569412.1.20437 WP_000569412.1.20443 WP_000569412.1.20446 WP_000569412.1.20465 WP_000569412.1.20492 WP_000569412.1.2053 WP_000569412.1.2054 WP_000569412.1.20564 WP_000569412.1.20573 WP_000569412.1.20614 WP_000569412.1.20626 WP_000569412.1.20631 WP_000569412.1.20635 WP_000569412.1.20646 WP_000569412.1.20695 WP_000569412.1.20718 WP_000569412.1.20721 WP_000569412.1.2073 WP_000569412.1.20740 WP_000569412.1.20767 WP_000569412.1.20789 WP_000569412.1.20828 WP_000569412.1.2087 WP_000569412.1.20883 WP_000569412.1.20886 WP_000569412.1.20908 WP_000569412.1.2091 WP_000569412.1.20947 WP_000569412.1.20953 WP_000569412.1.2101 WP_000569412.1.21010 WP_000569412.1.21049 WP_000569412.1.2106 WP_000569412.1.21062 WP_000569412.1.2107 WP_000569412.1.21079 WP_000569412.1.21086 WP_000569412.1.21089 WP_000569412.1.21103 WP_000569412.1.21136 WP_000569412.1.21144 WP_000569412.1.21146 WP_000569412.1.2116 WP_000569412.1.21162 WP_000569412.1.21165 WP_000569412.1.21184 WP_000569412.1.21185 WP_000569412.1.21194 WP_000569412.1.21202 WP_000569412.1.21241 WP_000569412.1.21245 WP_000569412.1.21246 WP_000569412.1.21269 WP_000569412.1.21286 WP_000569412.1.21309 WP_000569412.1.21326 WP_000569412.1.21332 WP_000569412.1.21351 WP_000569412.1.21366 WP_000569412.1.2139 WP_000569412.1.21399 WP_000569412.1.21400 WP_000569412.1.21443 WP_000569412.1.21453 WP_000569412.1.21492 WP_000569412.1.21497 WP_000569412.1.21499 WP_000569412.1.21534 WP_000569412.1.21548 WP_000569412.1.21603 WP_000569412.1.21616 WP_000569412.1.2166 WP_000569412.1.21674 WP_000569412.1.21681 WP_000569412.1.21692 WP_000569412.1.21715 WP_000569412.1.21750 WP_000569412.1.21751 WP_000569412.1.21757 WP_000569412.1.21792 WP_000569412.1.21886 WP_000569412.1.21909 WP_000569412.1.21910 WP_000569412.1.21940 WP_000569412.1.21946 WP_000569412.1.21950 WP_000569412.1.21966 WP_000569412.1.21981 WP_000569412.1.21991 WP_000569412.1.22024 WP_000569412.1.2205 WP_000569412.1.22051 WP_000569412.1.22062 WP_000569412.1.22064 WP_000569412.1.22067 WP_000569412.1.22096 WP_000569412.1.22118 WP_000569412.1.22126 WP_000569412.1.22136 WP_000569412.1.22158 WP_000569412.1.2216 WP_000569412.1.22162 WP_000569412.1.22169 WP_000569412.1.22205 WP_000569412.1.22208 WP_000569412.1.2221 WP_000569412.1.22235 WP_000569412.1.2224 WP_000569412.1.2227 WP_000569412.1.22296 WP_000569412.1.22315 WP_000569412.1.22323 WP_000569412.1.22337 WP_000569412.1.22346 WP_000569412.1.2235 WP_000569412.1.22373 WP_000569412.1.22379 WP_000569412.1.22427 WP_000569412.1.22449 WP_000569412.1.22453 WP_000569412.1.22454 WP_000569412.1.2246 WP_000569412.1.22460 WP_000569412.1.22476 WP_000569412.1.22485 WP_000569412.1.22514 WP_000569412.1.22537 WP_000569412.1.22565 WP_000569412.1.22566 WP_000569412.1.22575 WP_000569412.1.22582 WP_000569412.1.22590 WP_000569412.1.22595 WP_000569412.1.22604 WP_000569412.1.22605 WP_000569412.1.22614 WP_000569412.1.22620 WP_000569412.1.22652 WP_000569412.1.22676 WP_000569412.1.22683 WP_000569412.1.22692 WP_000569412.1.22758 WP_000569412.1.22760 WP_000569412.1.2284 WP_000569412.1.22857 WP_000569412.1.22864 WP_000569412.1.22870 WP_000569412.1.22880 WP_000569412.1.22895 WP_000569412.1.22902 WP_000569412.1.22926 WP_000569412.1.22943 WP_000569412.1.22947 WP_000569412.1.22967 WP_000569412.1.22979 WP_000569412.1.23010 WP_000569412.1.23040 WP_000569412.1.23058 WP_000569412.1.23102 WP_000569412.1.23114 WP_000569412.1.2314 WP_000569412.1.23155 WP_000569412.1.23172 WP_000569412.1.23175 WP_000569412.1.23192 WP_000569412.1.23218 WP_000569412.1.2324 WP_000569412.1.23246 WP_000569412.1.23259 WP_000569412.1.23274 WP_000569412.1.23279 WP_000569412.1.23309 WP_000569412.1.2331 WP_000569412.1.23311 WP_000569412.1.2332 WP_000569412.1.23329 WP_000569412.1.23340 WP_000569412.1.23343 WP_000569412.1.2336 WP_000569412.1.23365 WP_000569412.1.23379 WP_000569412.1.23412 WP_000569412.1.2342 WP_000569412.1.23426 WP_000569412.1.23442 WP_000569412.1.23460 WP_000569412.1.23466 WP_000569412.1.23472 WP_000569412.1.23482 WP_000569412.1.23485 WP_000569412.1.23492 WP_000569412.1.23500 WP_000569412.1.23509 WP_000569412.1.23515 WP_000569412.1.23529 WP_000569412.1.23548 WP_000569412.1.23571 WP_000569412.1.2358 WP_000569412.1.23587 WP_000569412.1.23604 WP_000569412.1.23621 WP_000569412.1.23629 WP_000569412.1.23631 WP_000569412.1.23634 WP_000569412.1.23639 WP_000569412.1.2364 WP_000569412.1.23643 WP_000569412.1.23670 WP_000569412.1.23679 WP_000569412.1.237 WP_000569412.1.23707 WP_000569412.1.23720 WP_000569412.1.23728 WP_000569412.1.23736 WP_000569412.1.23746 WP_000569412.1.2375 WP_000569412.1.23783 WP_000569412.1.23786 WP_000569412.1.23787 WP_000569412.1.2380 WP_000569412.1.23801 WP_000569412.1.23959 WP_000569412.1.24017 WP_000569412.1.24028 WP_000569412.1.24061 WP_000569412.1.24082 WP_000569412.1.24083 WP_000569412.1.24117 WP_000569412.1.24125 WP_000569412.1.24138 WP_000569412.1.24145 WP_000569412.1.2415 WP_000569412.1.24153 WP_000569412.1.24158 WP_000569412.1.24206 WP_000569412.1.24214 WP_000569412.1.24250 WP_000569412.1.24259 WP_000569412.1.24291 WP_000569412.1.24297 WP_000569412.1.24308 WP_000569412.1.24322 WP_000569412.1.24325 WP_000569412.1.24355 WP_000569412.1.24361 WP_000569412.1.24375 WP_000569412.1.24376 WP_000569412.1.24394 WP_000569412.1.24400 WP_000569412.1.24408 WP_000569412.1.24409 WP_000569412.1.24419 WP_000569412.1.24420 WP_000569412.1.24444 WP_000569412.1.24494 WP_000569412.1.24555 WP_000569412.1.24567 WP_000569412.1.24578 WP_000569412.1.24619 WP_000569412.1.24643 WP_000569412.1.2467 WP_000569412.1.24673 WP_000569412.1.24686 WP_000569412.1.24688 WP_000569412.1.24689 WP_000569412.1.24716 WP_000569412.1.24737 WP_000569412.1.24779 WP_000569412.1.24803 WP_000569412.1.2481 WP_000569412.1.24832 WP_000569412.1.24839 WP_000569412.1.24873 WP_000569412.1.24901 WP_000569412.1.24944 WP_000569412.1.24964 WP_000569412.1.25008 WP_000569412.1.25015 WP_000569412.1.25017 WP_000569412.1.25032 WP_000569412.1.25036 WP_000569412.1.25041 WP_000569412.1.25053 WP_000569412.1.25064 WP_000569412.1.25072 WP_000569412.1.25119 WP_000569412.1.25130 WP_000569412.1.25140 WP_000569412.1.25159 WP_000569412.1.25175 WP_000569412.1.25185 WP_000569412.1.25196 WP_000569412.1.25206 WP_000569412.1.25210 WP_000569412.1.25219 WP_000569412.1.25304 WP_000569412.1.25354 WP_000569412.1.25374 WP_000569412.1.25405 WP_000569412.1.25421 WP_000569412.1.25426 WP_000569412.1.25454 WP_000569412.1.25475 WP_000569412.1.25490 WP_000569412.1.25493 WP_000569412.1.25508 WP_000569412.1.25512 WP_000569412.1.25603 WP_000569412.1.25618 WP_000569412.1.2562 WP_000569412.1.25666 WP_000569412.1.25668 WP_000569412.1.2568 WP_000569412.1.25690 WP_000569412.1.2570 WP_000569412.1.25700 WP_000569412.1.25709 WP_000569412.1.25740 WP_000569412.1.25780 WP_000569412.1.25807 WP_000569412.1.25821 WP_000569412.1.25825 WP_000569412.1.25833 WP_000569412.1.25835 WP_000569412.1.25846 WP_000569412.1.25882 WP_000569412.1.25911 WP_000569412.1.25951 WP_000569412.1.25962 WP_000569412.1.25963 WP_000569412.1.25988 WP_000569412.1.26027 WP_000569412.1.26030 WP_000569412.1.26083 WP_000569412.1.26093 WP_000569412.1.26107 WP_000569412.1.26122 WP_000569412.1.26129 WP_000569412.1.2615 WP_000569412.1.26194 WP_000569412.1.26199 WP_000569412.1.26217 WP_000569412.1.26224 WP_000569412.1.26230 WP_000569412.1.26232 WP_000569412.1.26269 WP_000569412.1.26272 WP_000569412.1.26282 WP_000569412.1.26286 WP_000569412.1.26288 WP_000569412.1.26311 WP_000569412.1.26319 WP_000569412.1.2634 WP_000569412.1.26363 WP_000569412.1.26394 WP_000569412.1.26426 WP_000569412.1.26429 WP_000569412.1.26440 WP_000569412.1.26441 WP_000569412.1.26491 WP_000569412.1.26493 WP_000569412.1.26512 WP_000569412.1.26532 WP_000569412.1.2654 WP_000569412.1.26551 WP_000569412.1.26554 WP_000569412.1.26567 WP_000569412.1.26582 WP_000569412.1.26587 WP_000569412.1.2660 WP_000569412.1.26636 WP_000569412.1.26646 WP_000569412.1.26687 WP_000569412.1.26689 WP_000569412.1.26709 WP_000569412.1.2672 WP_000569412.1.26741 WP_000569412.1.26750 WP_000569412.1.26787 WP_000569412.1.2679 WP_000569412.1.26794 WP_000569412.1.26892 WP_000569412.1.26908 WP_000569412.1.26919 WP_000569412.1.2692 WP_000569412.1.26924 WP_000569412.1.26928 WP_000569412.1.26936 WP_000569412.1.270 WP_000569412.1.27008 WP_000569412.1.27010 WP_000569412.1.27027 WP_000569412.1.27051 WP_000569412.1.27070 WP_000569412.1.27077 WP_000569412.1.27084 WP_000569412.1.27086 WP_000569412.1.27087 WP_000569412.1.27111 WP_000569412.1.27115 WP_000569412.1.2713 WP_000569412.1.2717 WP_000569412.1.27173 WP_000569412.1.27206 WP_000569412.1.27223 WP_000569412.1.27228 WP_000569412.1.27272 WP_000569412.1.27279 WP_000569412.1.27282 WP_000569412.1.27285 WP_000569412.1.27309 WP_000569412.1.27314 WP_000569412.1.27329 WP_000569412.1.27361 WP_000569412.1.27383 WP_000569412.1.27419 WP_000569412.1.27423 WP_000569412.1.27452 WP_000569412.1.27535 WP_000569412.1.27544 WP_000569412.1.27547 WP_000569412.1.27556 WP_000569412.1.27561 WP_000569412.1.27565 WP_000569412.1.27595 WP_000569412.1.27598 WP_000569412.1.2763 WP_000569412.1.27632 WP_000569412.1.27638 WP_000569412.1.27658 WP_000569412.1.27665 WP_000569412.1.27679 WP_000569412.1.27706 WP_000569412.1.27707 WP_000569412.1.27755 WP_000569412.1.27761 WP_000569412.1.2777 WP_000569412.1.27775 WP_000569412.1.27776 WP_000569412.1.27785 WP_000569412.1.27798 WP_000569412.1.27800 WP_000569412.1.27833 WP_000569412.1.27857 WP_000569412.1.27883 WP_000569412.1.27900 WP_000569412.1.27928 WP_000569412.1.27945 WP_000569412.1.27969 WP_000569412.1.27977 WP_000569412.1.27995 WP_000569412.1.28004 WP_000569412.1.28032 WP_000569412.1.28037 WP_000569412.1.28056 WP_000569412.1.28073 WP_000569412.1.2809 WP_000569412.1.28094 WP_000569412.1.28126 WP_000569412.1.28139 WP_000569412.1.28155 WP_000569412.1.28170 WP_000569412.1.28198 WP_000569412.1.28200 WP_000569412.1.2822 WP_000569412.1.28229 WP_000569412.1.28232 WP_000569412.1.28233 WP_000569412.1.28302 WP_000569412.1.28303 WP_000569412.1.2835 WP_000569412.1.28370 WP_000569412.1.28384 WP_000569412.1.28386 WP_000569412.1.28393 WP_000569412.1.28395 WP_000569412.1.284 WP_000569412.1.2845 WP_000569412.1.28462 WP_000569412.1.28479 WP_000569412.1.28514 WP_000569412.1.2853 WP_000569412.1.28538 WP_000569412.1.28570 WP_000569412.1.28575 WP_000569412.1.28612 WP_000569412.1.28620 WP_000569412.1.28625 WP_000569412.1.28627 WP_000569412.1.28655 WP_000569412.1.28673 WP_000569412.1.28692 WP_000569412.1.28694 WP_000569412.1.2873 WP_000569412.1.28773 WP_000569412.1.28775 WP_000569412.1.2879 WP_000569412.1.2890 WP_000569412.1.28902 WP_000569412.1.28917 WP_000569412.1.28938 WP_000569412.1.28946 WP_000569412.1.28962 WP_000569412.1.29006 WP_000569412.1.29010 WP_000569412.1.29023 WP_000569412.1.29042 WP_000569412.1.2905 WP_000569412.1.2907 WP_000569412.1.29081 WP_000569412.1.29089 WP_000569412.1.2910 WP_000569412.1.29113 WP_000569412.1.29153 WP_000569412.1.29168 WP_000569412.1.29190 WP_000569412.1.29203 WP_000569412.1.29218 WP_000569412.1.29237 WP_000569412.1.2924 WP_000569412.1.29248 WP_000569412.1.29274 WP_000569412.1.29288 WP_000569412.1.2932 WP_000569412.1.29379 WP_000569412.1.29389 WP_000569412.1.29422 WP_000569412.1.29436 WP_000569412.1.29439 WP_000569412.1.2946 WP_000569412.1.29462 WP_000569412.1.29509 WP_000569412.1.29530 WP_000569412.1.29563 WP_000569412.1.29576 WP_000569412.1.29588 WP_000569412.1.29601 WP_000569412.1.29606 WP_000569412.1.29615 WP_000569412.1.29619 WP_000569412.1.29682 WP_000569412.1.29704 WP_000569412.1.29727 WP_000569412.1.29743 WP_000569412.1.29768 WP_000569412.1.29775 WP_000569412.1.29782 WP_000569412.1.29827 WP_000569412.1.29833 WP_000569412.1.2984 WP_000569412.1.29845 WP_000569412.1.29851 WP_000569412.1.29865 WP_000569412.1.29886 WP_000569412.1.29898 WP_000569412.1.29919 WP_000569412.1.29924 WP_000569412.1.2994 WP_000569412.1.29964 WP_000569412.1.29969 WP_000569412.1.29983 WP_000569412.1.29990 WP_000569412.1.30006 WP_000569412.1.30009 WP_000569412.1.30013 WP_000569412.1.30018 WP_000569412.1.3002 WP_000569412.1.30022 WP_000569412.1.30027 WP_000569412.1.30034 WP_000569412.1.30049 WP_000569412.1.3005 WP_000569412.1.30058 WP_000569412.1.30059 WP_000569412.1.30086 WP_000569412.1.30093 WP_000569412.1.30165 WP_000569412.1.30170 WP_000569412.1.30172 WP_000569412.1.30180 WP_000569412.1.30185 WP_000569412.1.30202 WP_000569412.1.30210 WP_000569412.1.30238 WP_000569412.1.30278 WP_000569412.1.30354 WP_000569412.1.30357 WP_000569412.1.30362 WP_000569412.1.30386 WP_000569412.1.30389 WP_000569412.1.3042 WP_000569412.1.30421 WP_000569412.1.30425 WP_000569412.1.30437 WP_000569412.1.30440 WP_000569412.1.30448 WP_000569412.1.30469 WP_000569412.1.30489 WP_000569412.1.30492 WP_000569412.1.30505 WP_000569412.1.30507 WP_000569412.1.30517 WP_000569412.1.30535 WP_000569412.1.30542 WP_000569412.1.30544 WP_000569412.1.30547 WP_000569412.1.30548 WP_000569412.1.30555 WP_000569412.1.30556 WP_000569412.1.30572 WP_000569412.1.30573 WP_000569412.1.30585 WP_000569412.1.30589 WP_000569412.1.30618 WP_000569412.1.30619 WP_000569412.1.30627 WP_000569412.1.3066 WP_000569412.1.30664 WP_000569412.1.3067 WP_000569412.1.30688 WP_000569412.1.30752 WP_000569412.1.3076 WP_000569412.1.30794 WP_000569412.1.30803 WP_000569412.1.30806 WP_000569412.1.30819 WP_000569412.1.30823 WP_000569412.1.30833 WP_000569412.1.30835 WP_000569412.1.30909 WP_000569412.1.30967 WP_000569412.1.30968 WP_000569412.1.30972 WP_000569412.1.31 WP_000569412.1.31001 WP_000569412.1.31011 WP_000569412.1.31046 WP_000569412.1.31066 WP_000569412.1.31069 WP_000569412.1.31078 WP_000569412.1.31086 WP_000569412.1.31092 WP_000569412.1.31107 WP_000569412.1.31111 WP_000569412.1.31122 WP_000569412.1.3113 WP_000569412.1.31139 WP_000569412.1.31145 WP_000569412.1.31156 WP_000569412.1.31167 WP_000569412.1.31171 WP_000569412.1.31182 WP_000569412.1.31185 WP_000569412.1.3119 WP_000569412.1.31190 WP_000569412.1.31195 WP_000569412.1.31196 WP_000569412.1.31198 WP_000569412.1.31205 WP_000569412.1.3121 WP_000569412.1.31210 WP_000569412.1.31219 WP_000569412.1.31223 WP_000569412.1.31251 WP_000569412.1.3127 WP_000569412.1.31272 WP_000569412.1.31281 WP_000569412.1.31303 WP_000569412.1.3131 WP_000569412.1.31335 WP_000569412.1.31352 WP_000569412.1.31362 WP_000569412.1.31389 WP_000569412.1.31413 WP_000569412.1.31435 WP_000569412.1.31446 WP_000569412.1.31451 WP_000569412.1.31476 WP_000569412.1.31504 WP_000569412.1.31515 WP_000569412.1.31533 WP_000569412.1.31546 WP_000569412.1.31578 WP_000569412.1.31585 WP_000569412.1.31658 WP_000569412.1.3167 WP_000569412.1.3170 WP_000569412.1.31762 WP_000569412.1.31782 WP_000569412.1.31799 WP_000569412.1.31836 WP_000569412.1.31854 WP_000569412.1.31895 WP_000569412.1.31901 WP_000569412.1.31927 WP_000569412.1.31940 WP_000569412.1.31951 WP_000569412.1.31967 WP_000569412.1.31972 WP_000569412.1.31983 WP_000569412.1.32006 WP_000569412.1.32041 WP_000569412.1.32042 WP_000569412.1.32056 WP_000569412.1.3207 WP_000569412.1.32109 WP_000569412.1.32116 WP_000569412.1.32170 WP_000569412.1.32189 WP_000569412.1.32192 WP_000569412.1.32202 WP_000569412.1.32206 WP_000569412.1.32252 WP_000569412.1.32260 WP_000569412.1.32263 WP_000569412.1.32274 WP_000569412.1.32275 WP_000569412.1.32293 WP_000569412.1.32299 WP_000569412.1.32309 WP_000569412.1.32368 WP_000569412.1.32408 WP_000569412.1.32422 WP_000569412.1.32424 WP_000569412.1.32425 WP_000569412.1.32438 WP_000569412.1.32458 WP_000569412.1.32460 WP_000569412.1.32515 WP_000569412.1.32519 WP_000569412.1.32527 WP_000569412.1.32529 WP_000569412.1.32545 WP_000569412.1.32563 WP_000569412.1.32578 WP_000569412.1.32617 WP_000569412.1.32629 WP_000569412.1.32660 WP_000569412.1.32668 WP_000569412.1.3270 WP_000569412.1.32702 WP_000569412.1.32714 WP_000569412.1.32725 WP_000569412.1.32740 WP_000569412.1.32747 WP_000569412.1.32750 WP_000569412.1.32786 WP_000569412.1.32804 WP_000569412.1.32832 WP_000569412.1.32838 WP_000569412.1.32848 WP_000569412.1.32860 WP_000569412.1.32868 WP_000569412.1.32881 WP_000569412.1.32899 WP_000569412.1.329 WP_000569412.1.3290 WP_000569412.1.32900 WP_000569412.1.32907 WP_000569412.1.32930 WP_000569412.1.32940 WP_000569412.1.32941 WP_000569412.1.3296 WP_000569412.1.32966 WP_000569412.1.32977 WP_000569412.1.32985 WP_000569412.1.33010 WP_000569412.1.33030 WP_000569412.1.33037 WP_000569412.1.3305 WP_000569412.1.33051 WP_000569412.1.33078 WP_000569412.1.33122 WP_000569412.1.33127 WP_000569412.1.33143 WP_000569412.1.3315 WP_000569412.1.33160 WP_000569412.1.33208 WP_000569412.1.33214 WP_000569412.1.33247 WP_000569412.1.33248 WP_000569412.1.33253 WP_000569412.1.33261 WP_000569412.1.33270 WP_000569412.1.33280 WP_000569412.1.33283 WP_000569412.1.333 WP_000569412.1.33313 WP_000569412.1.33339 WP_000569412.1.33382 WP_000569412.1.33392 WP_000569412.1.33409 WP_000569412.1.33420 WP_000569412.1.33486 WP_000569412.1.33490 WP_000569412.1.33492 WP_000569412.1.335 WP_000569412.1.33501 WP_000569412.1.33504 WP_000569412.1.33529 WP_000569412.1.33553 WP_000569412.1.3356 WP_000569412.1.33586 WP_000569412.1.33592 WP_000569412.1.33609 WP_000569412.1.3364 WP_000569412.1.33689 WP_000569412.1.33693 WP_000569412.1.3370 WP_000569412.1.33730 WP_000569412.1.33741 WP_000569412.1.33817 WP_000569412.1.33840 WP_000569412.1.33865 WP_000569412.1.33870 WP_000569412.1.33894 WP_000569412.1.3392 WP_000569412.1.33926 WP_000569412.1.3394 WP_000569412.1.3395 WP_000569412.1.33957 WP_000569412.1.3396 WP_000569412.1.33969 WP_000569412.1.34001 WP_000569412.1.34043 WP_000569412.1.34059 WP_000569412.1.34075 WP_000569412.1.34081 WP_000569412.1.34091 WP_000569412.1.34118 WP_000569412.1.34185 WP_000569412.1.34211 WP_000569412.1.34214 WP_000569412.1.34234 WP_000569412.1.34257 WP_000569412.1.34279 WP_000569412.1.34284 WP_000569412.1.34292 WP_000569412.1.34304 WP_000569412.1.34319 WP_000569412.1.34330 WP_000569412.1.34376 WP_000569412.1.3438 WP_000569412.1.34382 WP_000569412.1.34417 WP_000569412.1.34424 WP_000569412.1.34431 WP_000569412.1.34453 WP_000569412.1.34454 WP_000569412.1.34484 WP_000569412.1.34517 WP_000569412.1.34530 WP_000569412.1.34610 WP_000569412.1.34614 WP_000569412.1.34659 WP_000569412.1.34665 WP_000569412.1.34667 WP_000569412.1.34684 WP_000569412.1.34694 WP_000569412.1.34703 WP_000569412.1.34707 WP_000569412.1.34711 WP_000569412.1.34751 WP_000569412.1.3476 WP_000569412.1.34801 WP_000569412.1.34808 WP_000569412.1.34820 WP_000569412.1.34824 WP_000569412.1.34834 WP_000569412.1.34856 WP_000569412.1.34932 WP_000569412.1.34962 WP_000569412.1.34975 WP_000569412.1.34977 WP_000569412.1.35001 WP_000569412.1.35040 WP_000569412.1.35045 WP_000569412.1.35074 WP_000569412.1.35129 WP_000569412.1.35175 WP_000569412.1.35184 WP_000569412.1.35193 WP_000569412.1.35240 WP_000569412.1.35274 WP_000569412.1.35298 WP_000569412.1.35321 WP_000569412.1.35331 WP_000569412.1.35332 WP_000569412.1.35404 WP_000569412.1.35408 WP_000569412.1.3541 WP_000569412.1.35425 WP_000569412.1.35429 WP_000569412.1.35446 WP_000569412.1.35460 WP_000569412.1.35463 WP_000569412.1.35503 WP_000569412.1.35507 WP_000569412.1.35509 WP_000569412.1.35532 WP_000569412.1.3556 WP_000569412.1.35560 WP_000569412.1.35563 WP_000569412.1.3557 WP_000569412.1.35590 WP_000569412.1.35594 WP_000569412.1.35619 WP_000569412.1.35624 WP_000569412.1.35628 WP_000569412.1.3570 WP_000569412.1.35712 WP_000569412.1.35713 WP_000569412.1.3572 WP_000569412.1.35736 WP_000569412.1.35791 WP_000569412.1.35795 WP_000569412.1.35868 WP_000569412.1.35870 WP_000569412.1.35887 WP_000569412.1.35892 WP_000569412.1.35916 WP_000569412.1.35936 WP_000569412.1.35938 WP_000569412.1.35940 WP_000569412.1.35961 WP_000569412.1.35966 WP_000569412.1.36000 WP_000569412.1.36003 WP_000569412.1.3601 WP_000569412.1.36017 WP_000569412.1.36034 WP_000569412.1.36036 WP_000569412.1.36037 WP_000569412.1.36057 WP_000569412.1.36063 WP_000569412.1.36069 WP_000569412.1.36157 WP_000569412.1.36172 WP_000569412.1.36232 WP_000569412.1.36286 WP_000569412.1.36291 WP_000569412.1.36298 WP_000569412.1.36308 WP_000569412.1.36323 WP_000569412.1.36343 WP_000569412.1.36409 WP_000569412.1.36445 WP_000569412.1.36460 WP_000569412.1.3649 WP_000569412.1.36495 WP_000569412.1.36526 WP_000569412.1.36547 WP_000569412.1.36564 WP_000569412.1.36567 WP_000569412.1.36579 WP_000569412.1.36584 WP_000569412.1.36586 WP_000569412.1.36592 WP_000569412.1.36609 WP_000569412.1.36617 WP_000569412.1.36618 WP_000569412.1.36643 WP_000569412.1.36663 WP_000569412.1.36685 WP_000569412.1.36690 WP_000569412.1.3670 WP_000569412.1.36701 WP_000569412.1.36705 WP_000569412.1.36721 WP_000569412.1.36725 WP_000569412.1.36764 WP_000569412.1.36779 WP_000569412.1.36798 WP_000569412.1.36802 WP_000569412.1.36821 WP_000569412.1.36839 WP_000569412.1.36853 WP_000569412.1.36875 WP_000569412.1.36889 WP_000569412.1.36899 WP_000569412.1.36918 WP_000569412.1.36931 WP_000569412.1.36950 WP_000569412.1.37014 WP_000569412.1.37029 WP_000569412.1.37073 WP_000569412.1.37111 WP_000569412.1.37112 WP_000569412.1.37114 WP_000569412.1.37133 WP_000569412.1.37176 WP_000569412.1.37190 WP_000569412.1.37191 WP_000569412.1.37199 WP_000569412.1.37200 WP_000569412.1.37256 WP_000569412.1.37258 WP_000569412.1.3726 WP_000569412.1.37267 WP_000569412.1.37293 WP_000569412.1.37297 WP_000569412.1.37303 WP_000569412.1.37370 WP_000569412.1.37376 WP_000569412.1.37405 WP_000569412.1.3744 WP_000569412.1.3748 WP_000569412.1.37498 WP_000569412.1.37504 WP_000569412.1.3751 WP_000569412.1.37513 WP_000569412.1.37558 WP_000569412.1.3756 WP_000569412.1.37584 WP_000569412.1.37590 WP_000569412.1.37593 WP_000569412.1.37600 WP_000569412.1.37613 WP_000569412.1.37618 WP_000569412.1.37659 WP_000569412.1.37662 WP_000569412.1.37675 WP_000569412.1.37687 WP_000569412.1.37691 WP_000569412.1.3771 WP_000569412.1.37761 WP_000569412.1.37775 WP_000569412.1.37777 WP_000569412.1.3778 WP_000569412.1.378 WP_000569412.1.37848 WP_000569412.1.37864 WP_000569412.1.379 WP_000569412.1.3790 WP_000569412.1.37911 WP_000569412.1.37941 WP_000569412.1.37968 WP_000569412.1.37978 WP_000569412.1.37985 WP_000569412.1.38001 WP_000569412.1.38026 WP_000569412.1.38037 WP_000569412.1.38047 WP_000569412.1.38061 WP_000569412.1.38064 WP_000569412.1.38108 WP_000569412.1.38125 WP_000569412.1.38145 WP_000569412.1.3816 WP_000569412.1.38199 WP_000569412.1.38207 WP_000569412.1.38261 WP_000569412.1.38266 WP_000569412.1.383 WP_000569412.1.38310 WP_000569412.1.38322 WP_000569412.1.3834 WP_000569412.1.38341 WP_000569412.1.38344 WP_000569412.1.38349 WP_000569412.1.38351 WP_000569412.1.3838 WP_000569412.1.38381 WP_000569412.1.38393 WP_000569412.1.38408 WP_000569412.1.38440 WP_000569412.1.38452 WP_000569412.1.3848 WP_000569412.1.38486 WP_000569412.1.38512 WP_000569412.1.38515 WP_000569412.1.38569 WP_000569412.1.38595 WP_000569412.1.3860 WP_000569412.1.38613 WP_000569412.1.38620 WP_000569412.1.38622 WP_000569412.1.38642 WP_000569412.1.38673 WP_000569412.1.3869 WP_000569412.1.38693 WP_000569412.1.38734 WP_000569412.1.38773 WP_000569412.1.38781 WP_000569412.1.38830 WP_000569412.1.38877 WP_000569412.1.38882 WP_000569412.1.3891 WP_000569412.1.38913 WP_000569412.1.38942 WP_000569412.1.38983 WP_000569412.1.38996 WP_000569412.1.39003 WP_000569412.1.39048 WP_000569412.1.39055 WP_000569412.1.39056 WP_000569412.1.39065 WP_000569412.1.3907 WP_000569412.1.39105 WP_000569412.1.39112 WP_000569412.1.39128 WP_000569412.1.39136 WP_000569412.1.3914 WP_000569412.1.39140 WP_000569412.1.39147 WP_000569412.1.39161 WP_000569412.1.39197 WP_000569412.1.39210 WP_000569412.1.39229 WP_000569412.1.39235 WP_000569412.1.39265 WP_000569412.1.39275 WP_000569412.1.3931 WP_000569412.1.39312 WP_000569412.1.39385 WP_000569412.1.39395 WP_000569412.1.39405 WP_000569412.1.39414 WP_000569412.1.39420 WP_000569412.1.39435 WP_000569412.1.39449 WP_000569412.1.39466 WP_000569412.1.39502 WP_000569412.1.39512 WP_000569412.1.39530 WP_000569412.1.39553 WP_000569412.1.39556 WP_000569412.1.39584 WP_000569412.1.39614 WP_000569412.1.39619 WP_000569412.1.39620 WP_000569412.1.39624 WP_000569412.1.39629 WP_000569412.1.39632 WP_000569412.1.39659 WP_000569412.1.39667 WP_000569412.1.39722 WP_000569412.1.39724 WP_000569412.1.39763 WP_000569412.1.39775 WP_000569412.1.39808 WP_000569412.1.39862 WP_000569412.1.39879 WP_000569412.1.39890 WP_000569412.1.39921 WP_000569412.1.39923 WP_000569412.1.39941 WP_000569412.1.39945 WP_000569412.1.39947 WP_000569412.1.39953 WP_000569412.1.40017 WP_000569412.1.40025 WP_000569412.1.40031 WP_000569412.1.40072 WP_000569412.1.40073 WP_000569412.1.40081 WP_000569412.1.40095 WP_000569412.1.40097 WP_000569412.1.401 WP_000569412.1.4011 WP_000569412.1.40155 WP_000569412.1.40158 WP_000569412.1.40160 WP_000569412.1.40167 WP_000569412.1.40170 WP_000569412.1.40171 WP_000569412.1.40208 WP_000569412.1.40224 WP_000569412.1.40240 WP_000569412.1.40254 WP_000569412.1.40257 WP_000569412.1.40279 WP_000569412.1.40284 WP_000569412.1.40292 WP_000569412.1.40305 WP_000569412.1.40307 WP_000569412.1.40311 WP_000569412.1.40341 WP_000569412.1.40361 WP_000569412.1.40374 WP_000569412.1.40380 WP_000569412.1.40395 WP_000569412.1.4042 WP_000569412.1.40465 WP_000569412.1.40467 WP_000569412.1.40492 WP_000569412.1.40493 WP_000569412.1.40496 WP_000569412.1.40517 WP_000569412.1.40528 WP_000569412.1.40533 WP_000569412.1.40577 WP_000569412.1.40622 WP_000569412.1.40688 WP_000569412.1.40695 WP_000569412.1.40698 WP_000569412.1.40710 WP_000569412.1.40722 WP_000569412.1.40745 WP_000569412.1.4075 WP_000569412.1.40750 WP_000569412.1.40763 WP_000569412.1.40771 WP_000569412.1.40849 WP_000569412.1.40854 WP_000569412.1.4087 WP_000569412.1.40877 WP_000569412.1.4089 WP_000569412.1.40924 WP_000569412.1.40930 WP_000569412.1.40932 WP_000569412.1.40935 WP_000569412.1.40946 WP_000569412.1.40973 WP_000569412.1.40996 WP_000569412.1.41004 WP_000569412.1.41017 WP_000569412.1.41018 WP_000569412.1.41048 WP_000569412.1.41050 WP_000569412.1.4106 WP_000569412.1.41070 WP_000569412.1.41074 WP_000569412.1.41075 WP_000569412.1.41086 WP_000569412.1.41091 WP_000569412.1.41097 WP_000569412.1.41116 WP_000569412.1.41128 WP_000569412.1.41132 WP_000569412.1.41176 WP_000569412.1.41192 WP_000569412.1.41225 WP_000569412.1.41226 WP_000569412.1.41251 WP_000569412.1.41258 WP_000569412.1.41277 WP_000569412.1.41279 WP_000569412.1.41299 WP_000569412.1.41305 WP_000569412.1.41321 WP_000569412.1.41333 WP_000569412.1.41335 WP_000569412.1.4136 WP_000569412.1.41375 WP_000569412.1.4141 WP_000569412.1.41415 WP_000569412.1.41427 WP_000569412.1.41434 WP_000569412.1.41459 WP_000569412.1.41498 WP_000569412.1.41516 WP_000569412.1.41519 WP_000569412.1.41524 WP_000569412.1.41528 WP_000569412.1.41554 WP_000569412.1.41572 WP_000569412.1.41591 WP_000569412.1.41610 WP_000569412.1.41631 WP_000569412.1.41658 WP_000569412.1.41659 WP_000569412.1.41662 WP_000569412.1.41688 WP_000569412.1.41690 WP_000569412.1.41708 WP_000569412.1.41716 WP_000569412.1.41746 WP_000569412.1.41761 WP_000569412.1.41799 WP_000569412.1.41824 WP_000569412.1.41825 WP_000569412.1.41836 WP_000569412.1.41859 WP_000569412.1.41882 WP_000569412.1.41894 WP_000569412.1.41904 WP_000569412.1.41911 WP_000569412.1.41919 WP_000569412.1.41929 WP_000569412.1.41938 WP_000569412.1.4194 WP_000569412.1.41949 WP_000569412.1.41978 WP_000569412.1.41979 WP_000569412.1.41985 WP_000569412.1.42069 WP_000569412.1.42081 WP_000569412.1.42090 WP_000569412.1.42098 WP_000569412.1.42104 WP_000569412.1.42109 WP_000569412.1.42111 WP_000569412.1.42136 WP_000569412.1.42156 WP_000569412.1.42187 WP_000569412.1.422 WP_000569412.1.42200 WP_000569412.1.42219 WP_000569412.1.4222 WP_000569412.1.42243 WP_000569412.1.42244 WP_000569412.1.42257 WP_000569412.1.42261 WP_000569412.1.42262 WP_000569412.1.42263 WP_000569412.1.42276 WP_000569412.1.4229 WP_000569412.1.42320 WP_000569412.1.42322 WP_000569412.1.42328 WP_000569412.1.42342 WP_000569412.1.42349 WP_000569412.1.42364 WP_000569412.1.42371 WP_000569412.1.42372 WP_000569412.1.42379 WP_000569412.1.42391 WP_000569412.1.42392 WP_000569412.1.42399 WP_000569412.1.42404 WP_000569412.1.42422 WP_000569412.1.42433 WP_000569412.1.42444 WP_000569412.1.42489 WP_000569412.1.42491 WP_000569412.1.42539 WP_000569412.1.42603 WP_000569412.1.42650 WP_000569412.1.42655 WP_000569412.1.42666 WP_000569412.1.4267 WP_000569412.1.42675 WP_000569412.1.42676 WP_000569412.1.42683 WP_000569412.1.42701 WP_000569412.1.42734 WP_000569412.1.4276 WP_000569412.1.42794 WP_000569412.1.42797 WP_000569412.1.42805 WP_000569412.1.42815 WP_000569412.1.42829 WP_000569412.1.42859 WP_000569412.1.42864 WP_000569412.1.4288 WP_000569412.1.42887 WP_000569412.1.42892 WP_000569412.1.42932 WP_000569412.1.42957 WP_000569412.1.4298 WP_000569412.1.42981 WP_000569412.1.43008 WP_000569412.1.43016 WP_000569412.1.43018 WP_000569412.1.43019 WP_000569412.1.43041 WP_000569412.1.43065 WP_000569412.1.43068 WP_000569412.1.43069 WP_000569412.1.43070 WP_000569412.1.43077 WP_000569412.1.43086 WP_000569412.1.43128 WP_000569412.1.43141 WP_000569412.1.43157 WP_000569412.1.43160 WP_000569412.1.43161 WP_000569412.1.43190 WP_000569412.1.43198 WP_000569412.1.43201 WP_000569412.1.43244 WP_000569412.1.4326 WP_000569412.1.43290 WP_000569412.1.43292 WP_000569412.1.43299 WP_000569412.1.43307 WP_000569412.1.43312 WP_000569412.1.43334 WP_000569412.1.43339 WP_000569412.1.43351 WP_000569412.1.43371 WP_000569412.1.43437 WP_000569412.1.4344 WP_000569412.1.43476 WP_000569412.1.43508 WP_000569412.1.43513 WP_000569412.1.43520 WP_000569412.1.43522 WP_000569412.1.43528 WP_000569412.1.43606 WP_000569412.1.43613 WP_000569412.1.43633 WP_000569412.1.43637 WP_000569412.1.43651 WP_000569412.1.43668 WP_000569412.1.43711 WP_000569412.1.43722 WP_000569412.1.4373 WP_000569412.1.43778 WP_000569412.1.43782 WP_000569412.1.43785 WP_000569412.1.43801 WP_000569412.1.43812 WP_000569412.1.43839 WP_000569412.1.43873 WP_000569412.1.43875 WP_000569412.1.43878 WP_000569412.1.43886 WP_000569412.1.43888 WP_000569412.1.43919 WP_000569412.1.43951 WP_000569412.1.43974 WP_000569412.1.44005 WP_000569412.1.44010 WP_000569412.1.4404 WP_000569412.1.44043 WP_000569412.1.44049 WP_000569412.1.4405 WP_000569412.1.44099 WP_000569412.1.44113 WP_000569412.1.44121 WP_000569412.1.44132 WP_000569412.1.44144 WP_000569412.1.44160 WP_000569412.1.44180 WP_000569412.1.44196 WP_000569412.1.44248 WP_000569412.1.44262 WP_000569412.1.44268 WP_000569412.1.4427 WP_000569412.1.44291 WP_000569412.1.44296 WP_000569412.1.44300 WP_000569412.1.44310 WP_000569412.1.44337 WP_000569412.1.44343 WP_000569412.1.44351 WP_000569412.1.44360 WP_000569412.1.44397 WP_000569412.1.44416 WP_000569412.1.44431 WP_000569412.1.44433 WP_000569412.1.44437 WP_000569412.1.44440 WP_000569412.1.44474 WP_000569412.1.44479 WP_000569412.1.44546 WP_000569412.1.44640 WP_000569412.1.4467 WP_000569412.1.4468 WP_000569412.1.44687 WP_000569412.1.44705 WP_000569412.1.44747 WP_000569412.1.44762 WP_000569412.1.44781 WP_000569412.1.44791 WP_000569412.1.44815 WP_000569412.1.44828 WP_000569412.1.44831 WP_000569412.1.4485 WP_000569412.1.44877 WP_000569412.1.44879 WP_000569412.1.44917 WP_000569412.1.44927 WP_000569412.1.44933 WP_000569412.1.44966 WP_000569412.1.44971 WP_000569412.1.44978 WP_000569412.1.44996 WP_000569412.1.44997 WP_000569412.1.44998 WP_000569412.1.4500 WP_000569412.1.4501 WP_000569412.1.45045 WP_000569412.1.4505 WP_000569412.1.45067 WP_000569412.1.45072 WP_000569412.1.45074 WP_000569412.1.45079 WP_000569412.1.45093 WP_000569412.1.45098 WP_000569412.1.45136 WP_000569412.1.45138 WP_000569412.1.45145 WP_000569412.1.45173 WP_000569412.1.45177 WP_000569412.1.45184 WP_000569412.1.45229 WP_000569412.1.45241 WP_000569412.1.45259 WP_000569412.1.45302 WP_000569412.1.4531 WP_000569412.1.45322 WP_000569412.1.45344 WP_000569412.1.45349 WP_000569412.1.45351 WP_000569412.1.45365 WP_000569412.1.45432 WP_000569412.1.45434 WP_000569412.1.45435 WP_000569412.1.45462 WP_000569412.1.45522 WP_000569412.1.45523 WP_000569412.1.45535 WP_000569412.1.45544 WP_000569412.1.45549 WP_000569412.1.45550 WP_000569412.1.45569 WP_000569412.1.45571 WP_000569412.1.45582 WP_000569412.1.45583 WP_000569412.1.45585 WP_000569412.1.45596 WP_000569412.1.45622 WP_000569412.1.45648 WP_000569412.1.45660 WP_000569412.1.45690 WP_000569412.1.45797 WP_000569412.1.458 WP_000569412.1.45829 WP_000569412.1.45844 WP_000569412.1.45848 WP_000569412.1.45871 WP_000569412.1.45906 WP_000569412.1.45918 WP_000569412.1.4592 WP_000569412.1.46011 WP_000569412.1.46028 WP_000569412.1.46030 WP_000569412.1.46069 WP_000569412.1.46077 WP_000569412.1.46091 WP_000569412.1.46112 WP_000569412.1.46124 WP_000569412.1.46169 WP_000569412.1.46173 WP_000569412.1.46174 WP_000569412.1.46187 WP_000569412.1.46203 WP_000569412.1.46215 WP_000569412.1.46225 WP_000569412.1.46241 WP_000569412.1.46243 WP_000569412.1.46278 WP_000569412.1.46286 WP_000569412.1.46299 WP_000569412.1.46303 WP_000569412.1.46307 WP_000569412.1.46322 WP_000569412.1.46345 WP_000569412.1.46355 WP_000569412.1.464 WP_000569412.1.46434 WP_000569412.1.46454 WP_000569412.1.46461 WP_000569412.1.46504 WP_000569412.1.46505 WP_000569412.1.46551 WP_000569412.1.46559 WP_000569412.1.46574 WP_000569412.1.46578 WP_000569412.1.46595 WP_000569412.1.46620 WP_000569412.1.46666 WP_000569412.1.46675 WP_000569412.1.46689 WP_000569412.1.46693 WP_000569412.1.46701 WP_000569412.1.46726 WP_000569412.1.46730 WP_000569412.1.4674 WP_000569412.1.46749 WP_000569412.1.46781 WP_000569412.1.46816 WP_000569412.1.46842 WP_000569412.1.4686 WP_000569412.1.4690 WP_000569412.1.46920 WP_000569412.1.46930 WP_000569412.1.46945 WP_000569412.1.46961 WP_000569412.1.46967 WP_000569412.1.46976 WP_000569412.1.47008 WP_000569412.1.47023 WP_000569412.1.47036 WP_000569412.1.47037 WP_000569412.1.47042 WP_000569412.1.47057 WP_000569412.1.47059 WP_000569412.1.47061 WP_000569412.1.47067 WP_000569412.1.47085 WP_000569412.1.47110 WP_000569412.1.47123 WP_000569412.1.47214 WP_000569412.1.47215 WP_000569412.1.47243 WP_000569412.1.47245 WP_000569412.1.47429 WP_000569412.1.47442 WP_000569412.1.47448 WP_000569412.1.4747 WP_000569412.1.47472 WP_000569412.1.47478 WP_000569412.1.47492 WP_000569412.1.47507 WP_000569412.1.47523 WP_000569412.1.47531 WP_000569412.1.47532 WP_000569412.1.47542 WP_000569412.1.47567 WP_000569412.1.47576 WP_000569412.1.47579 WP_000569412.1.4758 WP_000569412.1.47587 WP_000569412.1.47605 WP_000569412.1.47621 WP_000569412.1.47630 WP_000569412.1.47660 WP_000569412.1.4769 WP_000569412.1.4774 WP_000569412.1.47756 WP_000569412.1.47799 WP_000569412.1.4781 WP_000569412.1.47814 WP_000569412.1.47829 WP_000569412.1.47850 WP_000569412.1.47875 WP_000569412.1.47886 WP_000569412.1.47898 WP_000569412.1.47911 WP_000569412.1.4795 WP_000569412.1.47988 WP_000569412.1.48019 WP_000569412.1.48100 WP_000569412.1.48114 WP_000569412.1.48132 WP_000569412.1.48134 WP_000569412.1.48139 WP_000569412.1.48190 WP_000569412.1.48209 WP_000569412.1.48218 WP_000569412.1.48242 WP_000569412.1.48244 WP_000569412.1.48253 WP_000569412.1.48268 WP_000569412.1.48292 WP_000569412.1.483 WP_000569412.1.48324 WP_000569412.1.48367 WP_000569412.1.48377 WP_000569412.1.4839 WP_000569412.1.48399 WP_000569412.1.48426 WP_000569412.1.48430 WP_000569412.1.48436 WP_000569412.1.48493 WP_000569412.1.48510 WP_000569412.1.4853 WP_000569412.1.48570 WP_000569412.1.48586 WP_000569412.1.4859 WP_000569412.1.48591 WP_000569412.1.48610 WP_000569412.1.48631 WP_000569412.1.48651 WP_000569412.1.48663 WP_000569412.1.48690 WP_000569412.1.48734 WP_000569412.1.48756 WP_000569412.1.48768 WP_000569412.1.48774 WP_000569412.1.48778 WP_000569412.1.48788 WP_000569412.1.48797 WP_000569412.1.48841 WP_000569412.1.48849 WP_000569412.1.4885 WP_000569412.1.48876 WP_000569412.1.48886 WP_000569412.1.48894 WP_000569412.1.48896 WP_000569412.1.48918 WP_000569412.1.48919 WP_000569412.1.48931 WP_000569412.1.48955 WP_000569412.1.48963 WP_000569412.1.48973 WP_000569412.1.48985 WP_000569412.1.49004 WP_000569412.1.49084 WP_000569412.1.49102 WP_000569412.1.49106 WP_000569412.1.49113 WP_000569412.1.49117 WP_000569412.1.49121 WP_000569412.1.4914 WP_000569412.1.49140 WP_000569412.1.49153 WP_000569412.1.49155 WP_000569412.1.49166 WP_000569412.1.49175 WP_000569412.1.49204 WP_000569412.1.49226 WP_000569412.1.49239 WP_000569412.1.49256 WP_000569412.1.49262 WP_000569412.1.49290 WP_000569412.1.49304 WP_000569412.1.49309 WP_000569412.1.49311 WP_000569412.1.49334 WP_000569412.1.49340 WP_000569412.1.49355 WP_000569412.1.49366 WP_000569412.1.49429 WP_000569412.1.49430 WP_000569412.1.49434 WP_000569412.1.49450 WP_000569412.1.49472 WP_000569412.1.49490 WP_000569412.1.49494 WP_000569412.1.495 WP_000569412.1.49515 WP_000569412.1.49545 WP_000569412.1.49550 WP_000569412.1.49572 WP_000569412.1.49574 WP_000569412.1.49590 WP_000569412.1.49595 WP_000569412.1.49602 WP_000569412.1.49630 WP_000569412.1.49647 WP_000569412.1.49686 WP_000569412.1.49703 WP_000569412.1.49769 WP_000569412.1.49770 WP_000569412.1.49780 WP_000569412.1.4979 WP_000569412.1.49790 WP_000569412.1.49803 WP_000569412.1.49805 WP_000569412.1.49827 WP_000569412.1.49846 WP_000569412.1.49848 WP_000569412.1.4991 WP_000569412.1.49929 WP_000569412.1.49931 WP_000569412.1.49947 WP_000569412.1.49959 WP_000569412.1.49997 WP_000569412.1.50 WP_000569412.1.50007 WP_000569412.1.50014 WP_000569412.1.50030 WP_000569412.1.50043 WP_000569412.1.50080 WP_000569412.1.5009 WP_000569412.1.50103 WP_000569412.1.50128 WP_000569412.1.50153 WP_000569412.1.50158 WP_000569412.1.50161 WP_000569412.1.50198 WP_000569412.1.50211 WP_000569412.1.50247 WP_000569412.1.50285 WP_000569412.1.50308 WP_000569412.1.50309 WP_000569412.1.50332 WP_000569412.1.50374 WP_000569412.1.50376 WP_000569412.1.50386 WP_000569412.1.50387 WP_000569412.1.50389 WP_000569412.1.50404 WP_000569412.1.50406 WP_000569412.1.50449 WP_000569412.1.50468 WP_000569412.1.50469 WP_000569412.1.50478 WP_000569412.1.5051 WP_000569412.1.50517 WP_000569412.1.50529 WP_000569412.1.50563 WP_000569412.1.50565 WP_000569412.1.50566 WP_000569412.1.50570 WP_000569412.1.50576 WP_000569412.1.50593 WP_000569412.1.50626 WP_000569412.1.50652 WP_000569412.1.50676 WP_000569412.1.50684 WP_000569412.1.50726 WP_000569412.1.50750 WP_000569412.1.50771 WP_000569412.1.50774 WP_000569412.1.50782 WP_000569412.1.50804 WP_000569412.1.50808 WP_000569412.1.50811 WP_000569412.1.50875 WP_000569412.1.5088 WP_000569412.1.50882 WP_000569412.1.50885 WP_000569412.1.509 WP_000569412.1.50905 WP_000569412.1.50908 WP_000569412.1.50918 WP_000569412.1.50929 WP_000569412.1.50941 WP_000569412.1.50954 WP_000569412.1.50960 WP_000569412.1.50970 WP_000569412.1.50999 WP_000569412.1.51014 WP_000569412.1.51022 WP_000569412.1.51025 WP_000569412.1.51040 WP_000569412.1.51048 WP_000569412.1.51066 WP_000569412.1.51100 WP_000569412.1.51134 WP_000569412.1.51139 WP_000569412.1.51179 WP_000569412.1.51182 WP_000569412.1.51186 WP_000569412.1.51224 WP_000569412.1.51227 WP_000569412.1.5127 WP_000569412.1.51305 WP_000569412.1.51315 WP_000569412.1.51331 WP_000569412.1.51338 WP_000569412.1.51356 WP_000569412.1.5136 WP_000569412.1.5138 WP_000569412.1.51412 WP_000569412.1.51414 WP_000569412.1.51419 WP_000569412.1.51451 WP_000569412.1.51464 WP_000569412.1.51474 WP_000569412.1.51487 WP_000569412.1.51488 WP_000569412.1.51502 WP_000569412.1.51519 WP_000569412.1.51555 WP_000569412.1.51594 WP_000569412.1.51598 WP_000569412.1.51611 WP_000569412.1.51634 WP_000569412.1.51642 WP_000569412.1.51644 WP_000569412.1.51649 WP_000569412.1.51686 WP_000569412.1.51700 WP_000569412.1.51724 WP_000569412.1.51734 WP_000569412.1.51756 WP_000569412.1.51764 WP_000569412.1.51810 WP_000569412.1.51831 WP_000569412.1.51838 WP_000569412.1.51841 WP_000569412.1.5185 WP_000569412.1.51863 WP_000569412.1.51868 WP_000569412.1.51911 WP_000569412.1.51914 WP_000569412.1.51930 WP_000569412.1.51932 WP_000569412.1.51935 WP_000569412.1.51989 WP_000569412.1.51994 WP_000569412.1.520 WP_000569412.1.52047 WP_000569412.1.52057 WP_000569412.1.52101 WP_000569412.1.5211 WP_000569412.1.52114 WP_000569412.1.52121 WP_000569412.1.52123 WP_000569412.1.52129 WP_000569412.1.52148 WP_000569412.1.52170 WP_000569412.1.52191 WP_000569412.1.52202 WP_000569412.1.52209 WP_000569412.1.52255 WP_000569412.1.52301 WP_000569412.1.52321 WP_000569412.1.52336 WP_000569412.1.52339 WP_000569412.1.52346 WP_000569412.1.52353 WP_000569412.1.52356 WP_000569412.1.52361 WP_000569412.1.52438 WP_000569412.1.52446 WP_000569412.1.52469 WP_000569412.1.52571 WP_000569412.1.52582 WP_000569412.1.52586 WP_000569412.1.526 WP_000569412.1.52637 WP_000569412.1.52647 WP_000569412.1.52653 WP_000569412.1.52656 WP_000569412.1.52692 WP_000569412.1.52738 WP_000569412.1.52742 WP_000569412.1.52743 WP_000569412.1.52748 WP_000569412.1.52773 WP_000569412.1.52795 WP_000569412.1.52807 WP_000569412.1.52833 WP_000569412.1.52857 WP_000569412.1.52866 WP_000569412.1.52887 WP_000569412.1.52898 WP_000569412.1.52915 WP_000569412.1.52949 WP_000569412.1.52985 WP_000569412.1.53016 WP_000569412.1.53092 WP_000569412.1.53100 WP_000569412.1.53107 WP_000569412.1.53119 WP_000569412.1.5313 WP_000569412.1.53141 WP_000569412.1.53151 WP_000569412.1.53154 WP_000569412.1.53158 WP_000569412.1.53159 WP_000569412.1.5316 WP_000569412.1.53190 WP_000569412.1.53198 WP_000569412.1.53203 WP_000569412.1.53210 WP_000569412.1.53233 WP_000569412.1.53234 WP_000569412.1.53286 WP_000569412.1.53307 WP_000569412.1.53321 WP_000569412.1.53362 WP_000569412.1.53368 WP_000569412.1.53375 WP_000569412.1.53385 WP_000569412.1.53406 WP_000569412.1.53436 WP_000569412.1.53450 WP_000569412.1.53466 WP_000569412.1.5349 WP_000569412.1.53529 WP_000569412.1.53540 WP_000569412.1.53543 WP_000569412.1.53555 WP_000569412.1.53559 WP_000569412.1.5356 WP_000569412.1.53567 WP_000569412.1.53571 WP_000569412.1.5358 WP_000569412.1.53664 WP_000569412.1.53688 WP_000569412.1.53692 WP_000569412.1.53694 WP_000569412.1.53723 WP_000569412.1.5374 WP_000569412.1.53750 WP_000569412.1.53757 WP_000569412.1.53778 WP_000569412.1.53781 WP_000569412.1.53790 WP_000569412.1.53800 WP_000569412.1.53812 WP_000569412.1.53815 WP_000569412.1.53839 WP_000569412.1.53892 WP_000569412.1.53896 WP_000569412.1.53898 WP_000569412.1.53902 WP_000569412.1.53905 WP_000569412.1.53958 WP_000569412.1.53961 WP_000569412.1.53981 WP_000569412.1.53984 WP_000569412.1.54033 WP_000569412.1.54061 WP_000569412.1.54075 WP_000569412.1.54082 WP_000569412.1.54085 WP_000569412.1.54132 WP_000569412.1.54136 WP_000569412.1.54159 WP_000569412.1.54170 WP_000569412.1.54175 WP_000569412.1.54196 WP_000569412.1.542 WP_000569412.1.54203 WP_000569412.1.54209 WP_000569412.1.54259 WP_000569412.1.54271 WP_000569412.1.54273 WP_000569412.1.54274 WP_000569412.1.54283 WP_000569412.1.5430 WP_000569412.1.54319 WP_000569412.1.54333 WP_000569412.1.54340 WP_000569412.1.54364 WP_000569412.1.54366 WP_000569412.1.54371 WP_000569412.1.54400 WP_000569412.1.54431 WP_000569412.1.54442 WP_000569412.1.54469 WP_000569412.1.54482 WP_000569412.1.54526 WP_000569412.1.54558 WP_000569412.1.54569 WP_000569412.1.54589 WP_000569412.1.54607 WP_000569412.1.54615 WP_000569412.1.5462 WP_000569412.1.54644 WP_000569412.1.54662 WP_000569412.1.54667 WP_000569412.1.54678 WP_000569412.1.54681 WP_000569412.1.54722 WP_000569412.1.54748 WP_000569412.1.54749 WP_000569412.1.54764 WP_000569412.1.5481 WP_000569412.1.54822 WP_000569412.1.54827 WP_000569412.1.54833 WP_000569412.1.54865 WP_000569412.1.54877 WP_000569412.1.54935 WP_000569412.1.54936 WP_000569412.1.54979 WP_000569412.1.54984 WP_000569412.1.55008 WP_000569412.1.55010 WP_000569412.1.55034 WP_000569412.1.55152 WP_000569412.1.55156 WP_000569412.1.55163 WP_000569412.1.55165 WP_000569412.1.5517 WP_000569412.1.55178 WP_000569412.1.55200 WP_000569412.1.55215 WP_000569412.1.55223 WP_000569412.1.55285 WP_000569412.1.55290 WP_000569412.1.55310 WP_000569412.1.55317 WP_000569412.1.55325 WP_000569412.1.55379 WP_000569412.1.5539 WP_000569412.1.55418 WP_000569412.1.55430 WP_000569412.1.55461 WP_000569412.1.55468 WP_000569412.1.55475 WP_000569412.1.55477 WP_000569412.1.55496 WP_000569412.1.55506 WP_000569412.1.5552 WP_000569412.1.55528 WP_000569412.1.5555 WP_000569412.1.55554 WP_000569412.1.55559 WP_000569412.1.5560 WP_000569412.1.55604 WP_000569412.1.55614 WP_000569412.1.55639 WP_000569412.1.55640 WP_000569412.1.55647 WP_000569412.1.55672 WP_000569412.1.55699 WP_000569412.1.55706 WP_000569412.1.55718 WP_000569412.1.5572 WP_000569412.1.55725 WP_000569412.1.55743 WP_000569412.1.55768 WP_000569412.1.5577 WP_000569412.1.55780 WP_000569412.1.55782 WP_000569412.1.55796 WP_000569412.1.55853 WP_000569412.1.55923 WP_000569412.1.55948 WP_000569412.1.55967 WP_000569412.1.55973 WP_000569412.1.55993 WP_000569412.1.55995 WP_000569412.1.56002 WP_000569412.1.56012 WP_000569412.1.56070 WP_000569412.1.56082 WP_000569412.1.56105 WP_000569412.1.56144 WP_000569412.1.56172 WP_000569412.1.5621 WP_000569412.1.56222 WP_000569412.1.56226 WP_000569412.1.56235 WP_000569412.1.56238 WP_000569412.1.56244 WP_000569412.1.56247 WP_000569412.1.56263 WP_000569412.1.56286 WP_000569412.1.56304 WP_000569412.1.56311 WP_000569412.1.5633 WP_000569412.1.56374 WP_000569412.1.56393 WP_000569412.1.56396 WP_000569412.1.56414 WP_000569412.1.56419 WP_000569412.1.56423 WP_000569412.1.56438 WP_000569412.1.56514 WP_000569412.1.56535 WP_000569412.1.56559 WP_000569412.1.56560 WP_000569412.1.56585 WP_000569412.1.56597 WP_000569412.1.56601 WP_000569412.1.56614 WP_000569412.1.56640 WP_000569412.1.56660 WP_000569412.1.56671 WP_000569412.1.5668 WP_000569412.1.56682 WP_000569412.1.56724 WP_000569412.1.56791 WP_000569412.1.56824 WP_000569412.1.56825 WP_000569412.1.56851 WP_000569412.1.56861 WP_000569412.1.56875 WP_000569412.1.56877 WP_000569412.1.56887 WP_000569412.1.56889 WP_000569412.1.56893 WP_000569412.1.56898 WP_000569412.1.56942 WP_000569412.1.56950 WP_000569412.1.56981 WP_000569412.1.57026 WP_000569412.1.57039 WP_000569412.1.57056 WP_000569412.1.57101 WP_000569412.1.5711 WP_000569412.1.57125 WP_000569412.1.57137 WP_000569412.1.57143 WP_000569412.1.57147 WP_000569412.1.57149 WP_000569412.1.57168 WP_000569412.1.57179 WP_000569412.1.57186 WP_000569412.1.57187 WP_000569412.1.57232 WP_000569412.1.57233 WP_000569412.1.57244 WP_000569412.1.57246 WP_000569412.1.57296 WP_000569412.1.57307 WP_000569412.1.57342 WP_000569412.1.57356 WP_000569412.1.57357 WP_000569412.1.57362 WP_000569412.1.57377 WP_000569412.1.57399 WP_000569412.1.57433 WP_000569412.1.57494 WP_000569412.1.57510 WP_000569412.1.57515 WP_000569412.1.57529 WP_000569412.1.57559 WP_000569412.1.57576 WP_000569412.1.57601 WP_000569412.1.57607 WP_000569412.1.5761 WP_000569412.1.57631 WP_000569412.1.57684 WP_000569412.1.57699 WP_000569412.1.57709 WP_000569412.1.5774 WP_000569412.1.57763 WP_000569412.1.57781 WP_000569412.1.57785 WP_000569412.1.57800 WP_000569412.1.5781 WP_000569412.1.57835 WP_000569412.1.57862 WP_000569412.1.57873 WP_000569412.1.57890 WP_000569412.1.57891 WP_000569412.1.57893 WP_000569412.1.57965 WP_000569412.1.57972 WP_000569412.1.57978 WP_000569412.1.58008 WP_000569412.1.5801 WP_000569412.1.58040 WP_000569412.1.58041 WP_000569412.1.58044 WP_000569412.1.58081 WP_000569412.1.5809 WP_000569412.1.58090 WP_000569412.1.58132 WP_000569412.1.58144 WP_000569412.1.58153 WP_000569412.1.58173 WP_000569412.1.58191 WP_000569412.1.58194 WP_000569412.1.58249 WP_000569412.1.58252 WP_000569412.1.58261 WP_000569412.1.58274 WP_000569412.1.5828 WP_000569412.1.58282 WP_000569412.1.58290 WP_000569412.1.58301 WP_000569412.1.58324 WP_000569412.1.58326 WP_000569412.1.58357 WP_000569412.1.58358 WP_000569412.1.5836 WP_000569412.1.58372 WP_000569412.1.58407 WP_000569412.1.58418 WP_000569412.1.58443 WP_000569412.1.5846 WP_000569412.1.58467 WP_000569412.1.58485 WP_000569412.1.58486 WP_000569412.1.58489 WP_000569412.1.58537 WP_000569412.1.5854 WP_000569412.1.58548 WP_000569412.1.58564 WP_000569412.1.58568 WP_000569412.1.5858 WP_000569412.1.58583 WP_000569412.1.58652 WP_000569412.1.58662 WP_000569412.1.58663 WP_000569412.1.58669 WP_000569412.1.58675 WP_000569412.1.587 WP_000569412.1.58724 WP_000569412.1.58729 WP_000569412.1.58744 WP_000569412.1.58745 WP_000569412.1.58749 WP_000569412.1.5875 WP_000569412.1.5878 WP_000569412.1.58796 WP_000569412.1.58803 WP_000569412.1.58807 WP_000569412.1.58831 WP_000569412.1.58834 WP_000569412.1.58836 WP_000569412.1.58847 WP_000569412.1.5886 WP_000569412.1.58883 WP_000569412.1.58884 WP_000569412.1.58898 WP_000569412.1.58926 WP_000569412.1.58949 WP_000569412.1.58963 WP_000569412.1.58970 WP_000569412.1.58974 WP_000569412.1.59020 WP_000569412.1.59043 WP_000569412.1.59056 WP_000569412.1.59061 WP_000569412.1.59064 WP_000569412.1.59068 WP_000569412.1.59084 WP_000569412.1.59094 WP_000569412.1.59142 WP_000569412.1.59148 WP_000569412.1.59163 WP_000569412.1.59224 WP_000569412.1.59236 WP_000569412.1.59276 WP_000569412.1.59282 WP_000569412.1.59299 WP_000569412.1.59313 WP_000569412.1.59321 WP_000569412.1.59335 WP_000569412.1.59336 WP_000569412.1.59375 WP_000569412.1.59381 WP_000569412.1.59412 WP_000569412.1.59420 WP_000569412.1.59427 WP_000569412.1.59439 WP_000569412.1.59458 WP_000569412.1.5949 WP_000569412.1.59490 WP_000569412.1.59501 WP_000569412.1.59508 WP_000569412.1.59510 WP_000569412.1.5953 WP_000569412.1.59538 WP_000569412.1.59548 WP_000569412.1.59641 WP_000569412.1.59646 WP_000569412.1.59648 WP_000569412.1.59684 WP_000569412.1.5969 WP_000569412.1.59694 WP_000569412.1.59751 WP_000569412.1.59771 WP_000569412.1.5979 WP_000569412.1.59827 WP_000569412.1.59829 WP_000569412.1.59830 WP_000569412.1.59847 WP_000569412.1.59848 WP_000569412.1.59863 WP_000569412.1.59928 WP_000569412.1.59953 WP_000569412.1.59969 WP_000569412.1.59994 WP_000569412.1.60008 WP_000569412.1.60021 WP_000569412.1.60045 WP_000569412.1.60069 WP_000569412.1.60076 WP_000569412.1.60106 WP_000569412.1.60114 WP_000569412.1.60126 WP_000569412.1.60137 WP_000569412.1.60140 WP_000569412.1.60154 WP_000569412.1.60155 WP_000569412.1.60168 WP_000569412.1.60192 WP_000569412.1.60199 WP_000569412.1.60212 WP_000569412.1.60213 WP_000569412.1.60231 WP_000569412.1.60285 WP_000569412.1.60320 WP_000569412.1.60322 WP_000569412.1.60324 WP_000569412.1.6033 WP_000569412.1.60330 WP_000569412.1.60356 WP_000569412.1.60379 WP_000569412.1.6038 WP_000569412.1.60380 WP_000569412.1.6041 WP_000569412.1.60424 WP_000569412.1.60425 WP_000569412.1.60464 WP_000569412.1.60481 WP_000569412.1.605 WP_000569412.1.60507 WP_000569412.1.6052 WP_000569412.1.60545 WP_000569412.1.60560 WP_000569412.1.60561 WP_000569412.1.6058 WP_000569412.1.60584 WP_000569412.1.6060 WP_000569412.1.60661 WP_000569412.1.60676 WP_000569412.1.60708 WP_000569412.1.60713 WP_000569412.1.60725 WP_000569412.1.60746 WP_000569412.1.60772 WP_000569412.1.60783 WP_000569412.1.60792 WP_000569412.1.60794 WP_000569412.1.608 WP_000569412.1.60807 WP_000569412.1.60809 WP_000569412.1.60838 WP_000569412.1.60855 WP_000569412.1.6086 WP_000569412.1.60866 WP_000569412.1.60874 WP_000569412.1.60882 WP_000569412.1.60889 WP_000569412.1.60897 WP_000569412.1.60919 WP_000569412.1.60926 WP_000569412.1.60941 WP_000569412.1.60950 WP_000569412.1.60976 WP_000569412.1.60990 WP_000569412.1.6104 WP_000569412.1.61044 WP_000569412.1.61076 WP_000569412.1.61078 WP_000569412.1.61087 WP_000569412.1.61114 WP_000569412.1.61123 WP_000569412.1.6114 WP_000569412.1.61146 WP_000569412.1.61147 WP_000569412.1.61168 WP_000569412.1.61184 WP_000569412.1.61201 WP_000569412.1.61210 WP_000569412.1.61232 WP_000569412.1.61233 WP_000569412.1.6129 WP_000569412.1.61296 WP_000569412.1.61309 WP_000569412.1.61345 WP_000569412.1.61356 WP_000569412.1.61357 WP_000569412.1.61381 WP_000569412.1.61417 WP_000569412.1.6143 WP_000569412.1.61434 WP_000569412.1.61497 WP_000569412.1.61501 WP_000569412.1.61511 WP_000569412.1.61519 WP_000569412.1.61539 WP_000569412.1.61542 WP_000569412.1.61553 WP_000569412.1.61574 WP_000569412.1.61582 WP_000569412.1.61594 WP_000569412.1.61595 WP_000569412.1.61609 WP_000569412.1.6164 WP_000569412.1.61649 WP_000569412.1.61652 WP_000569412.1.61671 WP_000569412.1.61694 WP_000569412.1.61697 WP_000569412.1.61712 WP_000569412.1.61714 WP_000569412.1.61730 WP_000569412.1.61743 WP_000569412.1.61809 WP_000569412.1.61857 WP_000569412.1.61877 WP_000569412.1.61908 WP_000569412.1.61918 WP_000569412.1.61920 WP_000569412.1.61924 WP_000569412.1.61952 WP_000569412.1.61968 WP_000569412.1.62007 WP_000569412.1.62020 WP_000569412.1.62025 WP_000569412.1.62063 WP_000569412.1.62076 WP_000569412.1.6209 WP_000569412.1.6210 WP_000569412.1.62120 WP_000569412.1.62122 WP_000569412.1.62124 WP_000569412.1.62158 WP_000569412.1.62199 WP_000569412.1.62201 WP_000569412.1.62204 WP_000569412.1.62210 WP_000569412.1.62223 WP_000569412.1.62245 WP_000569412.1.62257 WP_000569412.1.62302 WP_000569412.1.62304 WP_000569412.1.62314 WP_000569412.1.62323 WP_000569412.1.62333 WP_000569412.1.62338 WP_000569412.1.62344 WP_000569412.1.62361 WP_000569412.1.62364 WP_000569412.1.62380 WP_000569412.1.62403 WP_000569412.1.62411 WP_000569412.1.62412 WP_000569412.1.62436 WP_000569412.1.62475 WP_000569412.1.62504 WP_000569412.1.62522 WP_000569412.1.6253 WP_000569412.1.62536 WP_000569412.1.62570 WP_000569412.1.62619 WP_000569412.1.62640 WP_000569412.1.62677 WP_000569412.1.62686 WP_000569412.1.627 WP_000569412.1.62745 WP_000569412.1.62751 WP_000569412.1.62757 WP_000569412.1.62825 WP_000569412.1.62853 WP_000569412.1.62903 WP_000569412.1.62910 WP_000569412.1.62913 WP_000569412.1.6292 WP_000569412.1.62932 WP_000569412.1.62955 WP_000569412.1.62960 WP_000569412.1.62976 WP_000569412.1.62983 WP_000569412.1.62988 WP_000569412.1.63016 WP_000569412.1.63025 WP_000569412.1.63043 WP_000569412.1.63045 WP_000569412.1.63063 WP_000569412.1.63069 WP_000569412.1.63087 WP_000569412.1.63102 WP_000569412.1.63169 WP_000569412.1.63181 WP_000569412.1.63203 WP_000569412.1.63229 WP_000569412.1.63234 WP_000569412.1.63250 WP_000569412.1.63256 WP_000569412.1.63290 WP_000569412.1.63297 WP_000569412.1.63358 WP_000569412.1.63382 WP_000569412.1.63422 WP_000569412.1.63432 WP_000569412.1.63448 WP_000569412.1.63455 WP_000569412.1.63461 WP_000569412.1.63479 WP_000569412.1.63497 WP_000569412.1.63509 WP_000569412.1.63514 WP_000569412.1.63529 WP_000569412.1.63568 WP_000569412.1.6357 WP_000569412.1.63577 WP_000569412.1.63583 WP_000569412.1.63585 WP_000569412.1.63592 WP_000569412.1.63603 WP_000569412.1.63663 WP_000569412.1.63664 WP_000569412.1.6367 WP_000569412.1.6370 WP_000569412.1.63718 WP_000569412.1.63731 WP_000569412.1.63736 WP_000569412.1.63748 WP_000569412.1.6375 WP_000569412.1.63757 WP_000569412.1.63781 WP_000569412.1.63797 WP_000569412.1.63816 WP_000569412.1.63824 WP_000569412.1.63834 WP_000569412.1.63851 WP_000569412.1.63863 WP_000569412.1.63864 WP_000569412.1.63876 WP_000569412.1.6389 WP_000569412.1.63901 WP_000569412.1.63903 WP_000569412.1.63934 WP_000569412.1.63955 WP_000569412.1.63963 WP_000569412.1.63992 WP_000569412.1.64007 WP_000569412.1.64010 WP_000569412.1.64018 WP_000569412.1.64032 WP_000569412.1.64046 WP_000569412.1.64072 WP_000569412.1.64085 WP_000569412.1.64087 WP_000569412.1.64109 WP_000569412.1.64121 WP_000569412.1.6415 WP_000569412.1.64157 WP_000569412.1.64229 WP_000569412.1.6423 WP_000569412.1.64242 WP_000569412.1.64244 WP_000569412.1.64293 WP_000569412.1.64332 WP_000569412.1.64350 WP_000569412.1.64376 WP_000569412.1.64385 WP_000569412.1.64387 WP_000569412.1.644 WP_000569412.1.64403 WP_000569412.1.64462 WP_000569412.1.64471 WP_000569412.1.64500 WP_000569412.1.64501 WP_000569412.1.64538 WP_000569412.1.64569 WP_000569412.1.64597 WP_000569412.1.64632 WP_000569412.1.64648 WP_000569412.1.64649 WP_000569412.1.64654 WP_000569412.1.64662 WP_000569412.1.64663 WP_000569412.1.64674 WP_000569412.1.64702 WP_000569412.1.64710 WP_000569412.1.64711 WP_000569412.1.64744 WP_000569412.1.64757 WP_000569412.1.64758 WP_000569412.1.64763 WP_000569412.1.64781 WP_000569412.1.64798 WP_000569412.1.64817 WP_000569412.1.64831 WP_000569412.1.64847 WP_000569412.1.6487 WP_000569412.1.6489 WP_000569412.1.64891 WP_000569412.1.64894 WP_000569412.1.64920 WP_000569412.1.64972 WP_000569412.1.64974 WP_000569412.1.65011 WP_000569412.1.65016 WP_000569412.1.65018 WP_000569412.1.65022 WP_000569412.1.65027 WP_000569412.1.65028 WP_000569412.1.65054 WP_000569412.1.65075 WP_000569412.1.6514 WP_000569412.1.65171 WP_000569412.1.65172 WP_000569412.1.65185 WP_000569412.1.65191 WP_000569412.1.65200 WP_000569412.1.65211 WP_000569412.1.65218 WP_000569412.1.65226 WP_000569412.1.65248 WP_000569412.1.65249 WP_000569412.1.65266 WP_000569412.1.65269 WP_000569412.1.65348 WP_000569412.1.6535 WP_000569412.1.65357 WP_000569412.1.65394 WP_000569412.1.65395 WP_000569412.1.65437 WP_000569412.1.65459 WP_000569412.1.65463 WP_000569412.1.65474 WP_000569412.1.65475 WP_000569412.1.65487 WP_000569412.1.6549 WP_000569412.1.65499 WP_000569412.1.65508 WP_000569412.1.6554 WP_000569412.1.65558 WP_000569412.1.65572 WP_000569412.1.6560 WP_000569412.1.65601 WP_000569412.1.6561 WP_000569412.1.65633 WP_000569412.1.6565 WP_000569412.1.65650 WP_000569412.1.65696 WP_000569412.1.65697 WP_000569412.1.65698 WP_000569412.1.65737 WP_000569412.1.6575 WP_000569412.1.65755 WP_000569412.1.65771 WP_000569412.1.65782 WP_000569412.1.65790 WP_000569412.1.65812 WP_000569412.1.65818 WP_000569412.1.65838 WP_000569412.1.65846 WP_000569412.1.65849 WP_000569412.1.65863 WP_000569412.1.65876 WP_000569412.1.65881 WP_000569412.1.65883 WP_000569412.1.65901 WP_000569412.1.65940 WP_000569412.1.65945 WP_000569412.1.6595 WP_000569412.1.65956 WP_000569412.1.65968 WP_000569412.1.65985 WP_000569412.1.66021 WP_000569412.1.66031 WP_000569412.1.66049 WP_000569412.1.66052 WP_000569412.1.66064 WP_000569412.1.66109 WP_000569412.1.66122 WP_000569412.1.66145 WP_000569412.1.66167 WP_000569412.1.66183 WP_000569412.1.6620 WP_000569412.1.66216 WP_000569412.1.66234 WP_000569412.1.66273 WP_000569412.1.66289 WP_000569412.1.6630 WP_000569412.1.66314 WP_000569412.1.66315 WP_000569412.1.66324 WP_000569412.1.66330 WP_000569412.1.6634 WP_000569412.1.66358 WP_000569412.1.66361 WP_000569412.1.66362 WP_000569412.1.66368 WP_000569412.1.6638 WP_000569412.1.66385 WP_000569412.1.6640 WP_000569412.1.66400 WP_000569412.1.66428 WP_000569412.1.66446 WP_000569412.1.66462 WP_000569412.1.6647 WP_000569412.1.66480 WP_000569412.1.66506 WP_000569412.1.66534 WP_000569412.1.66539 WP_000569412.1.66630 WP_000569412.1.66665 WP_000569412.1.66678 WP_000569412.1.66681 WP_000569412.1.66684 WP_000569412.1.66698 WP_000569412.1.66733 WP_000569412.1.66755 WP_000569412.1.66759 WP_000569412.1.6680 WP_000569412.1.66801 WP_000569412.1.66807 WP_000569412.1.66824 WP_000569412.1.66825 WP_000569412.1.66834 WP_000569412.1.66860 WP_000569412.1.66901 WP_000569412.1.66937 WP_000569412.1.66953 WP_000569412.1.66955 WP_000569412.1.66959 WP_000569412.1.66962 WP_000569412.1.66981 WP_000569412.1.67 WP_000569412.1.67024 WP_000569412.1.67037 WP_000569412.1.67042 WP_000569412.1.67045 WP_000569412.1.67075 WP_000569412.1.6710 WP_000569412.1.67100 WP_000569412.1.67101 WP_000569412.1.67143 WP_000569412.1.67173 WP_000569412.1.67181 WP_000569412.1.67184 WP_000569412.1.67201 WP_000569412.1.67211 WP_000569412.1.67228 WP_000569412.1.67235 WP_000569412.1.67237 WP_000569412.1.67268 WP_000569412.1.67279 WP_000569412.1.67288 WP_000569412.1.67336 WP_000569412.1.67339 WP_000569412.1.67347 WP_000569412.1.67374 WP_000569412.1.67387 WP_000569412.1.6739 WP_000569412.1.67394 WP_000569412.1.67397 WP_000569412.1.67405 WP_000569412.1.67424 WP_000569412.1.67430 WP_000569412.1.67442 WP_000569412.1.67465 WP_000569412.1.67539 WP_000569412.1.67552 WP_000569412.1.67556 WP_000569412.1.67576 WP_000569412.1.6760 WP_000569412.1.67604 WP_000569412.1.67617 WP_000569412.1.67619 WP_000569412.1.67625 WP_000569412.1.67627 WP_000569412.1.67633 WP_000569412.1.67641 WP_000569412.1.67657 WP_000569412.1.67673 WP_000569412.1.67682 WP_000569412.1.67700 WP_000569412.1.67718 WP_000569412.1.67729 WP_000569412.1.67772 WP_000569412.1.67774 WP_000569412.1.6782 WP_000569412.1.67820 WP_000569412.1.67825 WP_000569412.1.67829 WP_000569412.1.67887 WP_000569412.1.67905 WP_000569412.1.67910 WP_000569412.1.67932 WP_000569412.1.67942 WP_000569412.1.67954 WP_000569412.1.68 WP_000569412.1.68043 WP_000569412.1.68073 WP_000569412.1.68105 WP_000569412.1.68113 WP_000569412.1.68115 WP_000569412.1.68131 WP_000569412.1.68140 WP_000569412.1.68147 WP_000569412.1.68159 WP_000569412.1.68182 WP_000569412.1.6819 WP_000569412.1.68201 WP_000569412.1.68206 WP_000569412.1.6827 WP_000569412.1.68275 WP_000569412.1.68285 WP_000569412.1.6833 WP_000569412.1.68359 WP_000569412.1.68401 WP_000569412.1.68420 WP_000569412.1.68477 WP_000569412.1.68478 WP_000569412.1.6849 WP_000569412.1.685 WP_000569412.1.68514 WP_000569412.1.68532 WP_000569412.1.68547 WP_000569412.1.68564 WP_000569412.1.6857 WP_000569412.1.68589 WP_000569412.1.68591 WP_000569412.1.68652 WP_000569412.1.68655 WP_000569412.1.68656 WP_000569412.1.68658 WP_000569412.1.68677 WP_000569412.1.68688 WP_000569412.1.6869 WP_000569412.1.68742 WP_000569412.1.68770 WP_000569412.1.68778 WP_000569412.1.68787 WP_000569412.1.68809 WP_000569412.1.68816 WP_000569412.1.68818 WP_000569412.1.68893 WP_000569412.1.68894 WP_000569412.1.68895 WP_000569412.1.68914 WP_000569412.1.68928 WP_000569412.1.68966 WP_000569412.1.68975 WP_000569412.1.68999 WP_000569412.1.69001 WP_000569412.1.69006 WP_000569412.1.69011 WP_000569412.1.69029 WP_000569412.1.6904 WP_000569412.1.69053 WP_000569412.1.6907 WP_000569412.1.69080 WP_000569412.1.69086 WP_000569412.1.6913 WP_000569412.1.69131 WP_000569412.1.69146 WP_000569412.1.69151 WP_000569412.1.69170 WP_000569412.1.69210 WP_000569412.1.69236 WP_000569412.1.69255 WP_000569412.1.69270 WP_000569412.1.69273 WP_000569412.1.69282 WP_000569412.1.69288 WP_000569412.1.69357 WP_000569412.1.69359 WP_000569412.1.69376 WP_000569412.1.69396 WP_000569412.1.69397 WP_000569412.1.69433 WP_000569412.1.69466 WP_000569412.1.69485 WP_000569412.1.6954 WP_000569412.1.69564 WP_000569412.1.69575 WP_000569412.1.69588 WP_000569412.1.69592 WP_000569412.1.69597 WP_000569412.1.69611 WP_000569412.1.69616 WP_000569412.1.69636 WP_000569412.1.69642 WP_000569412.1.69644 WP_000569412.1.69656 WP_000569412.1.69657 WP_000569412.1.69690 WP_000569412.1.69704 WP_000569412.1.69710 WP_000569412.1.69758 WP_000569412.1.69760 WP_000569412.1.69767 WP_000569412.1.69787 WP_000569412.1.69839 WP_000569412.1.69923 WP_000569412.1.69948 WP_000569412.1.69953 WP_000569412.1.69965 WP_000569412.1.69977 WP_000569412.1.69982 WP_000569412.1.70010 WP_000569412.1.70028 WP_000569412.1.70047 WP_000569412.1.70049 WP_000569412.1.70058 WP_000569412.1.70061 WP_000569412.1.70088 WP_000569412.1.7014 WP_000569412.1.7016 WP_000569412.1.70205 WP_000569412.1.7021 WP_000569412.1.70240 WP_000569412.1.70241 WP_000569412.1.70248 WP_000569412.1.70249 WP_000569412.1.70261 WP_000569412.1.70269 WP_000569412.1.70272 WP_000569412.1.70289 WP_000569412.1.70303 WP_000569412.1.70314 WP_000569412.1.70321 WP_000569412.1.70326 WP_000569412.1.7033 WP_000569412.1.70427 WP_000569412.1.70433 WP_000569412.1.70440 WP_000569412.1.70447 WP_000569412.1.70485 WP_000569412.1.70488 WP_000569412.1.70491 WP_000569412.1.70523 WP_000569412.1.70531 WP_000569412.1.70545 WP_000569412.1.70547 WP_000569412.1.70580 WP_000569412.1.70596 WP_000569412.1.7060 WP_000569412.1.70623 WP_000569412.1.70643 WP_000569412.1.70644 WP_000569412.1.70662 WP_000569412.1.70671 WP_000569412.1.70678 WP_000569412.1.70679 WP_000569412.1.70683 WP_000569412.1.70708 WP_000569412.1.70717 WP_000569412.1.70731 WP_000569412.1.70772 WP_000569412.1.70785 WP_000569412.1.70792 WP_000569412.1.70837 WP_000569412.1.70845 WP_000569412.1.70846 WP_000569412.1.70869 WP_000569412.1.70883 WP_000569412.1.70922 WP_000569412.1.70929 WP_000569412.1.70948 WP_000569412.1.70959 WP_000569412.1.70969 WP_000569412.1.70977 WP_000569412.1.70981 WP_000569412.1.70985 WP_000569412.1.70995 WP_000569412.1.71007 WP_000569412.1.71010 WP_000569412.1.71023 WP_000569412.1.71039 WP_000569412.1.71057 WP_000569412.1.71069 WP_000569412.1.71081 WP_000569412.1.7110 WP_000569412.1.71116 WP_000569412.1.71117 WP_000569412.1.71120 WP_000569412.1.71146 WP_000569412.1.71165 WP_000569412.1.71172 WP_000569412.1.71184 WP_000569412.1.71186 WP_000569412.1.71188 WP_000569412.1.71201 WP_000569412.1.71202 WP_000569412.1.71243 WP_000569412.1.71299 WP_000569412.1.71305 WP_000569412.1.71306 WP_000569412.1.71337 WP_000569412.1.71363 WP_000569412.1.71368 WP_000569412.1.71378 WP_000569412.1.71401 WP_000569412.1.7142 WP_000569412.1.71446 WP_000569412.1.71452 WP_000569412.1.71455 WP_000569412.1.71456 WP_000569412.1.71487 WP_000569412.1.71500 WP_000569412.1.71523 WP_000569412.1.71542 WP_000569412.1.71566 WP_000569412.1.71600 WP_000569412.1.71626 WP_000569412.1.71636 WP_000569412.1.71640 WP_000569412.1.71649 WP_000569412.1.71651 WP_000569412.1.71653 WP_000569412.1.71656 WP_000569412.1.71691 WP_000569412.1.71702 WP_000569412.1.71716 WP_000569412.1.7174 WP_000569412.1.71746 WP_000569412.1.71750 WP_000569412.1.71756 WP_000569412.1.71798 WP_000569412.1.71845 WP_000569412.1.71848 WP_000569412.1.71872 WP_000569412.1.71881 WP_000569412.1.71908 WP_000569412.1.71923 WP_000569412.1.71941 WP_000569412.1.71950 WP_000569412.1.71952 WP_000569412.1.71954 WP_000569412.1.71973 WP_000569412.1.71979 WP_000569412.1.71984 WP_000569412.1.71985 WP_000569412.1.720 WP_000569412.1.72003 WP_000569412.1.72065 WP_000569412.1.72073 WP_000569412.1.72100 WP_000569412.1.72105 WP_000569412.1.72119 WP_000569412.1.72121 WP_000569412.1.72182 WP_000569412.1.72188 WP_000569412.1.72190 WP_000569412.1.72203 WP_000569412.1.72220 WP_000569412.1.72221 WP_000569412.1.72226 WP_000569412.1.72234 WP_000569412.1.72254 WP_000569412.1.72269 WP_000569412.1.72281 WP_000569412.1.72283 WP_000569412.1.72300 WP_000569412.1.72307 WP_000569412.1.72325 WP_000569412.1.72339 WP_000569412.1.72350 WP_000569412.1.72372 WP_000569412.1.72376 WP_000569412.1.72383 WP_000569412.1.72403 WP_000569412.1.72412 WP_000569412.1.7243 WP_000569412.1.72461 WP_000569412.1.72470 WP_000569412.1.72527 WP_000569412.1.72532 WP_000569412.1.7255 WP_000569412.1.72594 WP_000569412.1.72602 WP_000569412.1.72625 WP_000569412.1.72629 WP_000569412.1.72631 WP_000569412.1.72638 WP_000569412.1.72667 WP_000569412.1.72674 WP_000569412.1.72689 WP_000569412.1.72716 WP_000569412.1.72718 WP_000569412.1.72724 WP_000569412.1.72728 WP_000569412.1.72789 WP_000569412.1.72797 WP_000569412.1.72828 WP_000569412.1.72843 WP_000569412.1.72850 WP_000569412.1.72865 WP_000569412.1.72871 WP_000569412.1.72872 WP_000569412.1.72896 WP_000569412.1.72897 WP_000569412.1.72944 WP_000569412.1.72946 WP_000569412.1.7295 WP_000569412.1.72968 WP_000569412.1.72969 WP_000569412.1.72975 WP_000569412.1.72987 WP_000569412.1.7304 WP_000569412.1.73052 WP_000569412.1.73062 WP_000569412.1.73068 WP_000569412.1.73102 WP_000569412.1.7311 WP_000569412.1.73114 WP_000569412.1.73125 WP_000569412.1.73144 WP_000569412.1.7315 WP_000569412.1.73164 WP_000569412.1.73177 WP_000569412.1.73180 WP_000569412.1.73200 WP_000569412.1.73258 WP_000569412.1.73270 WP_000569412.1.73285 WP_000569412.1.7332 WP_000569412.1.73328 WP_000569412.1.7333 WP_000569412.1.7334 WP_000569412.1.73352 WP_000569412.1.73362 WP_000569412.1.73379 WP_000569412.1.73389 WP_000569412.1.73425 WP_000569412.1.73461 WP_000569412.1.73481 WP_000569412.1.73488 WP_000569412.1.73504 WP_000569412.1.73512 WP_000569412.1.7353 WP_000569412.1.73544 WP_000569412.1.7356 WP_000569412.1.73561 WP_000569412.1.73581 WP_000569412.1.73596 WP_000569412.1.73598 WP_000569412.1.7361 WP_000569412.1.73617 WP_000569412.1.73648 WP_000569412.1.73667 WP_000569412.1.73669 WP_000569412.1.73708 WP_000569412.1.7374 WP_000569412.1.73753 WP_000569412.1.73758 WP_000569412.1.73764 WP_000569412.1.73768 WP_000569412.1.73794 WP_000569412.1.73804 WP_000569412.1.73831 WP_000569412.1.73847 WP_000569412.1.73849 WP_000569412.1.7387 WP_000569412.1.73901 WP_000569412.1.73924 WP_000569412.1.73926 WP_000569412.1.7394 WP_000569412.1.73945 WP_000569412.1.73948 WP_000569412.1.73956 WP_000569412.1.73958 WP_000569412.1.73999 WP_000569412.1.74024 WP_000569412.1.74028 WP_000569412.1.74029 WP_000569412.1.74030 WP_000569412.1.74038 WP_000569412.1.74040 WP_000569412.1.74043 WP_000569412.1.74049 WP_000569412.1.74058 WP_000569412.1.74070 WP_000569412.1.74077 WP_000569412.1.74135 WP_000569412.1.74174 WP_000569412.1.74181 WP_000569412.1.74191 WP_000569412.1.74207 WP_000569412.1.74214 WP_000569412.1.74241 WP_000569412.1.74248 WP_000569412.1.74285 WP_000569412.1.743 WP_000569412.1.7430 WP_000569412.1.74300 WP_000569412.1.74317 WP_000569412.1.7433 WP_000569412.1.74379 WP_000569412.1.74410 WP_000569412.1.74414 WP_000569412.1.74415 WP_000569412.1.74481 WP_000569412.1.745 WP_000569412.1.74500 WP_000569412.1.74529 WP_000569412.1.74570 WP_000569412.1.74578 WP_000569412.1.7458 WP_000569412.1.74616 WP_000569412.1.74620 WP_000569412.1.74621 WP_000569412.1.74647 WP_000569412.1.74677 WP_000569412.1.74699 WP_000569412.1.74741 WP_000569412.1.74745 WP_000569412.1.74806 WP_000569412.1.74807 WP_000569412.1.74831 WP_000569412.1.74894 WP_000569412.1.74929 WP_000569412.1.74939 WP_000569412.1.74946 WP_000569412.1.74972 WP_000569412.1.74973 WP_000569412.1.74996 WP_000569412.1.75051 WP_000569412.1.75056 WP_000569412.1.7507 WP_000569412.1.75089 WP_000569412.1.75114 WP_000569412.1.75116 WP_000569412.1.75129 WP_000569412.1.75148 WP_000569412.1.75159 WP_000569412.1.75177 WP_000569412.1.75187 WP_000569412.1.75237 WP_000569412.1.75273 WP_000569412.1.75288 WP_000569412.1.75296 WP_000569412.1.75334 WP_000569412.1.75362 WP_000569412.1.75371 WP_000569412.1.75385 WP_000569412.1.75392 WP_000569412.1.75400 WP_000569412.1.75402 WP_000569412.1.75413 WP_000569412.1.7543 WP_000569412.1.75433 WP_000569412.1.75450 WP_000569412.1.75494 WP_000569412.1.75532 WP_000569412.1.75565 WP_000569412.1.7558 WP_000569412.1.75585 WP_000569412.1.75593 WP_000569412.1.75607 WP_000569412.1.75610 WP_000569412.1.75633 WP_000569412.1.75664 WP_000569412.1.75716 WP_000569412.1.75718 WP_000569412.1.75745 WP_000569412.1.75751 WP_000569412.1.75760 WP_000569412.1.75764 WP_000569412.1.75793 WP_000569412.1.75794 WP_000569412.1.75810 WP_000569412.1.75837 WP_000569412.1.75844 WP_000569412.1.75863 WP_000569412.1.75874 WP_000569412.1.75884 WP_000569412.1.75886 WP_000569412.1.75898 WP_000569412.1.75902 WP_000569412.1.75945 WP_000569412.1.76 WP_000569412.1.76020 WP_000569412.1.76024 WP_000569412.1.76081 WP_000569412.1.76097 WP_000569412.1.76108 WP_000569412.1.76115 WP_000569412.1.76116 WP_000569412.1.76122 WP_000569412.1.76137 WP_000569412.1.76156 WP_000569412.1.76164 WP_000569412.1.76186 WP_000569412.1.76197 WP_000569412.1.76208 WP_000569412.1.76252 WP_000569412.1.76256 WP_000569412.1.7629 WP_000569412.1.76327 WP_000569412.1.76339 WP_000569412.1.7634 WP_000569412.1.76345 WP_000569412.1.76364 WP_000569412.1.76366 WP_000569412.1.76417 WP_000569412.1.76445 WP_000569412.1.76451 WP_000569412.1.7646 WP_000569412.1.76471 WP_000569412.1.76495 WP_000569412.1.76510 WP_000569412.1.76532 WP_000569412.1.76558 WP_000569412.1.76572 WP_000569412.1.7660 WP_000569412.1.76641 WP_000569412.1.76651 WP_000569412.1.76653 WP_000569412.1.76673 WP_000569412.1.76706 WP_000569412.1.76721 WP_000569412.1.76756 WP_000569412.1.76760 WP_000569412.1.76776 WP_000569412.1.76788 WP_000569412.1.76806 WP_000569412.1.76854 WP_000569412.1.76866 WP_000569412.1.76875 WP_000569412.1.76880 WP_000569412.1.76899 WP_000569412.1.76913 WP_000569412.1.76916 WP_000569412.1.76932 WP_000569412.1.76968 WP_000569412.1.76973 WP_000569412.1.76988 WP_000569412.1.77016 WP_000569412.1.77017 WP_000569412.1.77038 WP_000569412.1.77047 WP_000569412.1.77067 WP_000569412.1.77080 WP_000569412.1.77087 WP_000569412.1.77090 WP_000569412.1.77111 WP_000569412.1.7712 WP_000569412.1.77177 WP_000569412.1.77180 WP_000569412.1.77184 WP_000569412.1.77244 WP_000569412.1.77267 WP_000569412.1.77292 WP_000569412.1.77299 WP_000569412.1.77306 WP_000569412.1.77313 WP_000569412.1.77349 WP_000569412.1.77356 WP_000569412.1.77384 WP_000569412.1.77414 WP_000569412.1.77431 WP_000569412.1.77440 WP_000569412.1.77475 WP_000569412.1.77496 WP_000569412.1.77501 WP_000569412.1.77512 WP_000569412.1.77513 WP_000569412.1.77514 WP_000569412.1.77529 WP_000569412.1.77543 WP_000569412.1.77549 WP_000569412.1.77563 WP_000569412.1.77575 WP_000569412.1.77596 WP_000569412.1.77629 WP_000569412.1.77646 WP_000569412.1.77692 WP_000569412.1.77702 WP_000569412.1.77710 WP_000569412.1.77713 WP_000569412.1.7772 WP_000569412.1.7782 WP_000569412.1.77825 WP_000569412.1.77837 WP_000569412.1.7784 WP_000569412.1.77851 WP_000569412.1.77871 WP_000569412.1.77898 WP_000569412.1.77900 WP_000569412.1.77918 WP_000569412.1.7792 WP_000569412.1.77923 WP_000569412.1.7793 WP_000569412.1.77951 WP_000569412.1.77960 WP_000569412.1.77971 WP_000569412.1.77975 WP_000569412.1.77983 WP_000569412.1.77989 WP_000569412.1.78 WP_000569412.1.7802 WP_000569412.1.78033 WP_000569412.1.78035 WP_000569412.1.78048 WP_000569412.1.78051 WP_000569412.1.78076 WP_000569412.1.78096 WP_000569412.1.78100 WP_000569412.1.78110 WP_000569412.1.78120 WP_000569412.1.78166 WP_000569412.1.78168 WP_000569412.1.78192 WP_000569412.1.78195 WP_000569412.1.78201 WP_000569412.1.78259 WP_000569412.1.78291 WP_000569412.1.78309 WP_000569412.1.78320 WP_000569412.1.78339 WP_000569412.1.78352 WP_000569412.1.78372 WP_000569412.1.78382 WP_000569412.1.78383 WP_000569412.1.78388 WP_000569412.1.78407 WP_000569412.1.78410 WP_000569412.1.78443 WP_000569412.1.78501 WP_000569412.1.78602 WP_000569412.1.78603 WP_000569412.1.7861 WP_000569412.1.78618 WP_000569412.1.7862 WP_000569412.1.78626 WP_000569412.1.78632 WP_000569412.1.78658 WP_000569412.1.78661 WP_000569412.1.78673 WP_000569412.1.78674 WP_000569412.1.78676 WP_000569412.1.78697 WP_000569412.1.78715 WP_000569412.1.78734 WP_000569412.1.78735 WP_000569412.1.78761 WP_000569412.1.7877 WP_000569412.1.78771 WP_000569412.1.78789 WP_000569412.1.78802 WP_000569412.1.78815 WP_000569412.1.78830 WP_000569412.1.78835 WP_000569412.1.78838 WP_000569412.1.78871 WP_000569412.1.78874 WP_000569412.1.78877 WP_000569412.1.78896 WP_000569412.1.789 WP_000569412.1.78913 WP_000569412.1.78918 WP_000569412.1.78930 WP_000569412.1.78959 WP_000569412.1.78993 WP_000569412.1.79011 WP_000569412.1.79012 WP_000569412.1.79069 WP_000569412.1.79074 WP_000569412.1.79081 WP_000569412.1.79098 WP_000569412.1.79099 WP_000569412.1.79140 WP_000569412.1.79151 WP_000569412.1.79155 WP_000569412.1.79164 WP_000569412.1.79167 WP_000569412.1.79203 WP_000569412.1.79204 WP_000569412.1.79280 WP_000569412.1.79289 WP_000569412.1.79335 WP_000569412.1.79370 WP_000569412.1.79397 WP_000569412.1.794 WP_000569412.1.79427 WP_000569412.1.79456 WP_000569412.1.79462 WP_000569412.1.79468 WP_000569412.1.79472 WP_000569412.1.79490 WP_000569412.1.79495 WP_000569412.1.79529 WP_000569412.1.79531 WP_000569412.1.79532 WP_000569412.1.79547 WP_000569412.1.79570 WP_000569412.1.79580 WP_000569412.1.79586 WP_000569412.1.7964 WP_000569412.1.79642 WP_000569412.1.79654 WP_000569412.1.79659 WP_000569412.1.79668 WP_000569412.1.7970 WP_000569412.1.79708 WP_000569412.1.79722 WP_000569412.1.79734 WP_000569412.1.79738 WP_000569412.1.79757 WP_000569412.1.79772 WP_000569412.1.7979 WP_000569412.1.7982 WP_000569412.1.79845 WP_000569412.1.79867 WP_000569412.1.79880 WP_000569412.1.79892 WP_000569412.1.79916 WP_000569412.1.79929 WP_000569412.1.79934 WP_000569412.1.7994 WP_000569412.1.79942 WP_000569412.1.79945 WP_000569412.1.79951 WP_000569412.1.79977 WP_000569412.1.79996 WP_000569412.1.80045 WP_000569412.1.80065 WP_000569412.1.80077 WP_000569412.1.80103 WP_000569412.1.80137 WP_000569412.1.80149 WP_000569412.1.80182 WP_000569412.1.80249 WP_000569412.1.80254 WP_000569412.1.80273 WP_000569412.1.80282 WP_000569412.1.80293 WP_000569412.1.80296 WP_000569412.1.80307 WP_000569412.1.80354 WP_000569412.1.80366 WP_000569412.1.80368 WP_000569412.1.80380 WP_000569412.1.80386 WP_000569412.1.80400 WP_000569412.1.80443 WP_000569412.1.80462 WP_000569412.1.80480 WP_000569412.1.8049 WP_000569412.1.80492 WP_000569412.1.80529 WP_000569412.1.80542 WP_000569412.1.80569 WP_000569412.1.80586 WP_000569412.1.80609 WP_000569412.1.80638 WP_000569412.1.80664 WP_000569412.1.80696 WP_000569412.1.80725 WP_000569412.1.80741 WP_000569412.1.80757 WP_000569412.1.80760 WP_000569412.1.80780 WP_000569412.1.80819 WP_000569412.1.80831 WP_000569412.1.80850 WP_000569412.1.80868 WP_000569412.1.80874 WP_000569412.1.80876 WP_000569412.1.80881 WP_000569412.1.80913 WP_000569412.1.80927 WP_000569412.1.80939 WP_000569412.1.8096 WP_000569412.1.80984 WP_000569412.1.81037 WP_000569412.1.81041 WP_000569412.1.8106 WP_000569412.1.81067 WP_000569412.1.81069 WP_000569412.1.81084 WP_000569412.1.81109 WP_000569412.1.81110 WP_000569412.1.81131 WP_000569412.1.81149 WP_000569412.1.81175 WP_000569412.1.81187 WP_000569412.1.8119 WP_000569412.1.81193 WP_000569412.1.81197 WP_000569412.1.81225 WP_000569412.1.81231 WP_000569412.1.81262 WP_000569412.1.81268 WP_000569412.1.81269 WP_000569412.1.81271 WP_000569412.1.8130 WP_000569412.1.81305 WP_000569412.1.8131 WP_000569412.1.81320 WP_000569412.1.81328 WP_000569412.1.81333 WP_000569412.1.8134 WP_000569412.1.81342 WP_000569412.1.81354 WP_000569412.1.81364 WP_000569412.1.81388 WP_000569412.1.81404 WP_000569412.1.81409 WP_000569412.1.81410 WP_000569412.1.81425 WP_000569412.1.81455 WP_000569412.1.81494 WP_000569412.1.81528 WP_000569412.1.81548 WP_000569412.1.81557 WP_000569412.1.81568 WP_000569412.1.81667 WP_000569412.1.81668 WP_000569412.1.81676 WP_000569412.1.8168 WP_000569412.1.81681 WP_000569412.1.8170 WP_000569412.1.81735 WP_000569412.1.81743 WP_000569412.1.81746 WP_000569412.1.81750 WP_000569412.1.81760 WP_000569412.1.81763 WP_000569412.1.81768 WP_000569412.1.81785 WP_000569412.1.81795 WP_000569412.1.81798 WP_000569412.1.81855 WP_000569412.1.81902 WP_000569412.1.81921 WP_000569412.1.81931 WP_000569412.1.81936 WP_000569412.1.81941 WP_000569412.1.81949 WP_000569412.1.8196 WP_000569412.1.81965 WP_000569412.1.81974 WP_000569412.1.82037 WP_000569412.1.82070 WP_000569412.1.82076 WP_000569412.1.82141 WP_000569412.1.82149 WP_000569412.1.82156 WP_000569412.1.8218 WP_000569412.1.82180 WP_000569412.1.82192 WP_000569412.1.82201 WP_000569412.1.82214 WP_000569412.1.82225 WP_000569412.1.82232 WP_000569412.1.82258 WP_000569412.1.82337 WP_000569412.1.82347 WP_000569412.1.8236 WP_000569412.1.82369 WP_000569412.1.82395 WP_000569412.1.8240 WP_000569412.1.82401 WP_000569412.1.82408 WP_000569412.1.82416 WP_000569412.1.8242 WP_000569412.1.82420 WP_000569412.1.82434 WP_000569412.1.82456 WP_000569412.1.82464 WP_000569412.1.82465 WP_000569412.1.8247 WP_000569412.1.82473 WP_000569412.1.82474 WP_000569412.1.82479 WP_000569412.1.82503 WP_000569412.1.82515 WP_000569412.1.82529 WP_000569412.1.82530 WP_000569412.1.82553 WP_000569412.1.82569 WP_000569412.1.82636 WP_000569412.1.82646 WP_000569412.1.82670 WP_000569412.1.82676 WP_000569412.1.82692 WP_000569412.1.82731 WP_000569412.1.82761 WP_000569412.1.82763 WP_000569412.1.82812 WP_000569412.1.8282 WP_000569412.1.82841 WP_000569412.1.82843 WP_000569412.1.82850 WP_000569412.1.82867 WP_000569412.1.82872 WP_000569412.1.82886 WP_000569412.1.82895 WP_000569412.1.82937 WP_000569412.1.8294 WP_000569412.1.82944 WP_000569412.1.82956 WP_000569412.1.82959 WP_000569412.1.82964 WP_000569412.1.82992 WP_000569412.1.83005 WP_000569412.1.83006 WP_000569412.1.83007 WP_000569412.1.8304 WP_000569412.1.83061 WP_000569412.1.83092 WP_000569412.1.83139 WP_000569412.1.83163 WP_000569412.1.83180 WP_000569412.1.83204 WP_000569412.1.8322 WP_000569412.1.83221 WP_000569412.1.83229 WP_000569412.1.83235 WP_000569412.1.83252 WP_000569412.1.83280 WP_000569412.1.83290 WP_000569412.1.83301 WP_000569412.1.83305 WP_000569412.1.83331 WP_000569412.1.83333 WP_000569412.1.83354 WP_000569412.1.83356 WP_000569412.1.83360 WP_000569412.1.83365 WP_000569412.1.83407 WP_000569412.1.83413 WP_000569412.1.83491 WP_000569412.1.83523 WP_000569412.1.8354 WP_000569412.1.83558 WP_000569412.1.83598 WP_000569412.1.83650 WP_000569412.1.83657 WP_000569412.1.83677 WP_000569412.1.83710 WP_000569412.1.83721 WP_000569412.1.8375 WP_000569412.1.83759 WP_000569412.1.83760 WP_000569412.1.83806 WP_000569412.1.83854 WP_000569412.1.83923 WP_000569412.1.83979 WP_000569412.1.8399 WP_000569412.1.83994 WP_000569412.1.83995 WP_000569412.1.84 WP_000569412.1.84000 WP_000569412.1.84001 WP_000569412.1.84011 WP_000569412.1.84031 WP_000569412.1.8406 WP_000569412.1.84075 WP_000569412.1.84076 WP_000569412.1.84083 WP_000569412.1.84086 WP_000569412.1.84100 WP_000569412.1.84103 WP_000569412.1.84106 WP_000569412.1.84110 WP_000569412.1.84127 WP_000569412.1.84150 WP_000569412.1.84154 WP_000569412.1.84179 WP_000569412.1.84230 WP_000569412.1.8425 WP_000569412.1.84252 WP_000569412.1.84283 WP_000569412.1.84291 WP_000569412.1.84300 WP_000569412.1.8431 WP_000569412.1.84345 WP_000569412.1.84355 WP_000569412.1.84369 WP_000569412.1.84373 WP_000569412.1.84392 WP_000569412.1.84397 WP_000569412.1.84401 WP_000569412.1.8441 WP_000569412.1.84435 WP_000569412.1.84459 WP_000569412.1.84475 WP_000569412.1.84497 WP_000569412.1.84515 WP_000569412.1.84532 WP_000569412.1.84567 WP_000569412.1.84572 WP_000569412.1.84598 WP_000569412.1.84631 WP_000569412.1.84644 WP_000569412.1.84659 WP_000569412.1.84693 WP_000569412.1.84711 WP_000569412.1.84727 WP_000569412.1.84744 WP_000569412.1.84745 WP_000569412.1.84773 WP_000569412.1.84814 WP_000569412.1.84872 WP_000569412.1.84876 WP_000569412.1.84879 WP_000569412.1.84899 WP_000569412.1.84945 WP_000569412.1.84967 WP_000569412.1.8497 WP_000569412.1.84983 WP_000569412.1.85004 WP_000569412.1.85014 WP_000569412.1.8502 WP_000569412.1.85039 WP_000569412.1.85040 WP_000569412.1.85079 WP_000569412.1.85094 WP_000569412.1.85120 WP_000569412.1.85134 WP_000569412.1.85147 WP_000569412.1.85153 WP_000569412.1.85178 WP_000569412.1.85180 WP_000569412.1.85190 WP_000569412.1.85192 WP_000569412.1.8526 WP_000569412.1.85271 WP_000569412.1.85273 WP_000569412.1.85301 WP_000569412.1.8533 WP_000569412.1.85338 WP_000569412.1.85339 WP_000569412.1.8537 WP_000569412.1.85433 WP_000569412.1.8545 WP_000569412.1.85456 WP_000569412.1.85481 WP_000569412.1.85483 WP_000569412.1.85511 WP_000569412.1.85512 WP_000569412.1.8552 WP_000569412.1.85541 WP_000569412.1.8556 WP_000569412.1.85568 WP_000569412.1.8557 WP_000569412.1.85606 WP_000569412.1.85615 WP_000569412.1.85617 WP_000569412.1.85635 WP_000569412.1.85646 WP_000569412.1.85663 WP_000569412.1.85665 WP_000569412.1.85669 WP_000569412.1.85671 WP_000569412.1.85672 WP_000569412.1.85688 WP_000569412.1.85703 WP_000569412.1.85728 WP_000569412.1.85746 WP_000569412.1.85759 WP_000569412.1.85777 WP_000569412.1.85780 WP_000569412.1.85784 WP_000569412.1.85811 WP_000569412.1.85854 WP_000569412.1.85855 WP_000569412.1.85886 WP_000569412.1.859 WP_000569412.1.85900 WP_000569412.1.85904 WP_000569412.1.8591 WP_000569412.1.85917 WP_000569412.1.8594 WP_000569412.1.85976 WP_000569412.1.85977 WP_000569412.1.85982 WP_000569412.1.860 WP_000569412.1.86017 WP_000569412.1.86043 WP_000569412.1.8605 WP_000569412.1.86084 WP_000569412.1.8610 WP_000569412.1.86120 WP_000569412.1.86138 WP_000569412.1.8614 WP_000569412.1.86156 WP_000569412.1.86157 WP_000569412.1.86159 WP_000569412.1.8616 WP_000569412.1.86173 WP_000569412.1.86224 WP_000569412.1.86240 WP_000569412.1.86259 WP_000569412.1.86306 WP_000569412.1.86323 WP_000569412.1.86342 WP_000569412.1.86347 WP_000569412.1.86356 WP_000569412.1.86380 WP_000569412.1.8640 WP_000569412.1.8642 WP_000569412.1.86426 WP_000569412.1.86450 WP_000569412.1.86453 WP_000569412.1.86466 WP_000569412.1.86469 WP_000569412.1.8647 WP_000569412.1.86489 WP_000569412.1.86514 WP_000569412.1.86530 WP_000569412.1.86580 WP_000569412.1.86588 WP_000569412.1.86593 WP_000569412.1.86610 WP_000569412.1.86634 WP_000569412.1.86661 WP_000569412.1.86663 WP_000569412.1.86699 WP_000569412.1.8671 WP_000569412.1.8672 WP_000569412.1.86744 WP_000569412.1.86770 WP_000569412.1.8678 WP_000569412.1.86794 WP_000569412.1.86800 WP_000569412.1.86810 WP_000569412.1.86811 WP_000569412.1.86815 WP_000569412.1.8684 WP_000569412.1.86895 WP_000569412.1.86902 WP_000569412.1.86906 WP_000569412.1.86915 WP_000569412.1.86945 WP_000569412.1.86982 WP_000569412.1.86989 WP_000569412.1.87023 WP_000569412.1.87034 WP_000569412.1.87038 WP_000569412.1.87041 WP_000569412.1.87095 WP_000569412.1.87136 WP_000569412.1.87143 WP_000569412.1.87155 WP_000569412.1.87187 WP_000569412.1.87219 WP_000569412.1.8722 WP_000569412.1.87220 WP_000569412.1.87258 WP_000569412.1.87265 WP_000569412.1.87276 WP_000569412.1.87283 WP_000569412.1.87293 WP_000569412.1.87323 WP_000569412.1.87346 WP_000569412.1.8736 WP_000569412.1.87365 WP_000569412.1.87370 WP_000569412.1.87376 WP_000569412.1.87420 WP_000569412.1.87460 WP_000569412.1.87484 WP_000569412.1.87500 WP_000569412.1.87528 WP_000569412.1.87552 WP_000569412.1.87560 WP_000569412.1.87583 WP_000569412.1.87584 WP_000569412.1.8760 WP_000569412.1.87600 WP_000569412.1.87609 WP_000569412.1.87612 WP_000569412.1.87615 WP_000569412.1.87618 WP_000569412.1.87626 WP_000569412.1.87651 WP_000569412.1.87653 WP_000569412.1.87659 WP_000569412.1.8767 WP_000569412.1.87687 WP_000569412.1.87695 WP_000569412.1.87698 WP_000569412.1.87706 WP_000569412.1.87712 WP_000569412.1.87739 WP_000569412.1.87741 WP_000569412.1.87742 WP_000569412.1.87760 WP_000569412.1.87779 WP_000569412.1.87852 WP_000569412.1.87875 WP_000569412.1.87891 WP_000569412.1.87899 WP_000569412.1.87905 WP_000569412.1.8792 WP_000569412.1.87936 WP_000569412.1.87945 WP_000569412.1.87949 WP_000569412.1.88019 WP_000569412.1.88025 WP_000569412.1.88026 WP_000569412.1.8805 WP_000569412.1.88052 WP_000569412.1.8806 WP_000569412.1.88073 WP_000569412.1.8809 WP_000569412.1.88092 WP_000569412.1.881 WP_000569412.1.88145 WP_000569412.1.88185 WP_000569412.1.88199 WP_000569412.1.88244 WP_000569412.1.88275 WP_000569412.1.88291 WP_000569412.1.88293 WP_000569412.1.88299 WP_000569412.1.88303 WP_000569412.1.88313 WP_000569412.1.88356 WP_000569412.1.88359 WP_000569412.1.8837 WP_000569412.1.88393 WP_000569412.1.88407 WP_000569412.1.88414 WP_000569412.1.88444 WP_000569412.1.88446 WP_000569412.1.88458 WP_000569412.1.88474 WP_000569412.1.8849 WP_000569412.1.88501 WP_000569412.1.88508 WP_000569412.1.88538 WP_000569412.1.88547 WP_000569412.1.886 WP_000569412.1.88620 WP_000569412.1.88647 WP_000569412.1.88648 WP_000569412.1.88692 WP_000569412.1.88703 WP_000569412.1.88707 WP_000569412.1.88727 WP_000569412.1.88731 WP_000569412.1.88762 WP_000569412.1.88772 WP_000569412.1.88792 WP_000569412.1.88817 WP_000569412.1.88845 WP_000569412.1.88850 WP_000569412.1.88854 WP_000569412.1.8889 WP_000569412.1.88892 WP_000569412.1.88894 WP_000569412.1.88902 WP_000569412.1.8891 WP_000569412.1.88942 WP_000569412.1.88957 WP_000569412.1.88966 WP_000569412.1.88968 WP_000569412.1.88980 WP_000569412.1.88981 WP_000569412.1.88982 WP_000569412.1.88998 WP_000569412.1.89008 WP_000569412.1.89114 WP_000569412.1.89116 WP_000569412.1.89119 WP_000569412.1.89120 WP_000569412.1.89138 WP_000569412.1.89174 WP_000569412.1.89177 WP_000569412.1.89182 WP_000569412.1.89221 WP_000569412.1.89298 WP_000569412.1.89304 WP_000569412.1.89308 WP_000569412.1.89311 WP_000569412.1.89314 WP_000569412.1.89328 WP_000569412.1.89332 WP_000569412.1.89343 WP_000569412.1.89362 WP_000569412.1.89395 WP_000569412.1.8940 WP_000569412.1.89408 WP_000569412.1.89425 WP_000569412.1.89449 WP_000569412.1.89462 WP_000569412.1.8947 WP_000569412.1.89503 WP_000569412.1.89512 WP_000569412.1.89527 WP_000569412.1.89570 WP_000569412.1.89580 WP_000569412.1.89591 WP_000569412.1.89604 WP_000569412.1.89606 WP_000569412.1.8961 WP_000569412.1.89612 WP_000569412.1.89622 WP_000569412.1.89634 WP_000569412.1.89647 WP_000569412.1.89657 WP_000569412.1.89659 WP_000569412.1.89668 WP_000569412.1.89680 WP_000569412.1.89706 WP_000569412.1.89713 WP_000569412.1.89733 WP_000569412.1.89764 WP_000569412.1.89765 WP_000569412.1.89777 WP_000569412.1.89789 WP_000569412.1.89796 WP_000569412.1.89804 WP_000569412.1.89817 WP_000569412.1.89832 WP_000569412.1.89845 WP_000569412.1.89870 WP_000569412.1.89888 WP_000569412.1.89902 WP_000569412.1.89911 WP_000569412.1.89940 WP_000569412.1.8995 WP_000569412.1.89952 WP_000569412.1.8996 WP_000569412.1.89975 WP_000569412.1.90007 WP_000569412.1.9002 WP_000569412.1.9003 WP_000569412.1.90084 WP_000569412.1.90097 WP_000569412.1.90108 WP_000569412.1.9011 WP_000569412.1.90196 WP_000569412.1.90211 WP_000569412.1.90220 WP_000569412.1.90240 WP_000569412.1.90252 WP_000569412.1.90274 WP_000569412.1.90280 WP_000569412.1.90330 WP_000569412.1.90338 WP_000569412.1.90348 WP_000569412.1.90365 WP_000569412.1.90409 WP_000569412.1.90417 WP_000569412.1.90421 WP_000569412.1.90428 WP_000569412.1.90453 WP_000569412.1.90458 WP_000569412.1.90472 WP_000569412.1.90489 WP_000569412.1.90513 WP_000569412.1.90522 WP_000569412.1.90540 WP_000569412.1.90557 WP_000569412.1.90563 WP_000569412.1.90582 WP_000569412.1.90585 WP_000569412.1.90641 WP_000569412.1.90686 WP_000569412.1.90713 WP_000569412.1.90734 WP_000569412.1.90748 WP_000569412.1.90759 WP_000569412.1.90792 WP_000569412.1.90794 WP_000569412.1.90796 WP_000569412.1.90811 WP_000569412.1.90814 WP_000569412.1.90859 WP_000569412.1.90876 WP_000569412.1.9091 WP_000569412.1.9093 WP_000569412.1.90959 WP_000569412.1.90973 WP_000569412.1.91003 WP_000569412.1.91042 WP_000569412.1.91049 WP_000569412.1.91056 WP_000569412.1.91067 WP_000569412.1.91069 WP_000569412.1.91107 WP_000569412.1.91156 WP_000569412.1.91164 WP_000569412.1.91179 WP_000569412.1.91189 WP_000569412.1.91205 WP_000569412.1.91215 WP_000569412.1.91239 WP_000569412.1.91278 WP_000569412.1.91282 WP_000569412.1.91291 WP_000569412.1.9131 WP_000569412.1.91312 WP_000569412.1.91313 WP_000569412.1.91331 WP_000569412.1.91334 WP_000569412.1.9135 WP_000569412.1.9137 WP_000569412.1.91372 WP_000569412.1.91424 WP_000569412.1.91470 WP_000569412.1.91474 WP_000569412.1.91505 WP_000569412.1.91506 WP_000569412.1.91512 WP_000569412.1.91557 WP_000569412.1.91564 WP_000569412.1.91579 WP_000569412.1.91597 WP_000569412.1.91621 WP_000569412.1.91628 WP_000569412.1.91655 WP_000569412.1.9166 WP_000569412.1.91702 WP_000569412.1.91715 WP_000569412.1.91724 WP_000569412.1.91732 WP_000569412.1.91736 WP_000569412.1.91742 WP_000569412.1.91772 WP_000569412.1.91776 WP_000569412.1.91788 WP_000569412.1.91795 WP_000569412.1.91806 WP_000569412.1.9187 WP_000569412.1.91870 WP_000569412.1.91898 WP_000569412.1.91903 WP_000569412.1.91904 WP_000569412.1.91974 WP_000569412.1.91984 WP_000569412.1.92013 WP_000569412.1.92018 WP_000569412.1.92044 WP_000569412.1.92047 WP_000569412.1.92060 WP_000569412.1.92082 WP_000569412.1.92087 WP_000569412.1.92093 WP_000569412.1.92098 WP_000569412.1.92108 WP_000569412.1.92122 WP_000569412.1.92129 WP_000569412.1.92156 WP_000569412.1.92165 WP_000569412.1.92171 WP_000569412.1.92172 WP_000569412.1.92183 WP_000569412.1.92208 WP_000569412.1.9222 WP_000569412.1.92240 WP_000569412.1.92243 WP_000569412.1.92268 WP_000569412.1.92310 WP_000569412.1.92318 WP_000569412.1.92327 WP_000569412.1.92375 WP_000569412.1.92399 WP_000569412.1.92408 WP_000569412.1.92439 WP_000569412.1.92443 WP_000569412.1.92452 WP_000569412.1.92470 WP_000569412.1.92477 WP_000569412.1.92482 WP_000569412.1.92529 WP_000569412.1.92531 WP_000569412.1.92545 WP_000569412.1.92557 WP_000569412.1.92570 WP_000569412.1.92588 WP_000569412.1.926 WP_000569412.1.92628 WP_000569412.1.92633 WP_000569412.1.92646 WP_000569412.1.92649 WP_000569412.1.92659 WP_000569412.1.92669 WP_000569412.1.92671 WP_000569412.1.92676 WP_000569412.1.92705 WP_000569412.1.9271 WP_000569412.1.92729 WP_000569412.1.92734 WP_000569412.1.92738 WP_000569412.1.92754 WP_000569412.1.92758 WP_000569412.1.92786 WP_000569412.1.92806 WP_000569412.1.92810 WP_000569412.1.92823 WP_000569412.1.92832 WP_000569412.1.92842 WP_000569412.1.92875 WP_000569412.1.92890 WP_000569412.1.92893 WP_000569412.1.92895 WP_000569412.1.92929 WP_000569412.1.92936 WP_000569412.1.92939 WP_000569412.1.92975 WP_000569412.1.92987 WP_000569412.1.92988 WP_000569412.1.93007 WP_000569412.1.93022 WP_000569412.1.93059 WP_000569412.1.93061 WP_000569412.1.93076 WP_000569412.1.93086 WP_000569412.1.93101 WP_000569412.1.93103 WP_000569412.1.93105 WP_000569412.1.93111 WP_000569412.1.93118 WP_000569412.1.93121 WP_000569412.1.93136 WP_000569412.1.93155 WP_000569412.1.93168 WP_000569412.1.93184 WP_000569412.1.93215 WP_000569412.1.93221 WP_000569412.1.93223 WP_000569412.1.93239 WP_000569412.1.93275 WP_000569412.1.93302 WP_000569412.1.93339 WP_000569412.1.93350 WP_000569412.1.9336 WP_000569412.1.93365 WP_000569412.1.93376 WP_000569412.1.93387 WP_000569412.1.93410 WP_000569412.1.93469 WP_000569412.1.93511 WP_000569412.1.93512 WP_000569412.1.93524 WP_000569412.1.93543 WP_000569412.1.93577 WP_000569412.1.93596 WP_000569412.1.93604 WP_000569412.1.93635 WP_000569412.1.93650 WP_000569412.1.93656 WP_000569412.1.93657 WP_000569412.1.93662 WP_000569412.1.937 WP_000569412.1.93705 WP_000569412.1.9374 WP_000569412.1.9375 WP_000569412.1.93754 WP_000569412.1.93761 WP_000569412.1.93780 WP_000569412.1.9380 WP_000569412.1.93804 WP_000569412.1.93809 WP_000569412.1.93828 WP_000569412.1.93837 WP_000569412.1.93842 WP_000569412.1.93843 WP_000569412.1.93875 WP_000569412.1.9389 WP_000569412.1.93909 WP_000569412.1.93919 WP_000569412.1.93937 WP_000569412.1.93938 WP_000569412.1.93956 WP_000569412.1.93984 WP_000569412.1.9399 WP_000569412.1.93994 WP_000569412.1.94017 WP_000569412.1.94070 WP_000569412.1.94071 WP_000569412.1.94072 WP_000569412.1.94079 WP_000569412.1.94097 WP_000569412.1.94107 WP_000569412.1.94132 WP_000569412.1.94142 WP_000569412.1.94162 WP_000569412.1.94167 WP_000569412.1.94168 WP_000569412.1.94198 WP_000569412.1.94215 WP_000569412.1.94303 WP_000569412.1.9432 WP_000569412.1.94352 WP_000569412.1.94354 WP_000569412.1.94365 WP_000569412.1.94379 WP_000569412.1.94380 WP_000569412.1.94383 WP_000569412.1.94390 WP_000569412.1.9440 WP_000569412.1.94412 WP_000569412.1.94415 WP_000569412.1.94458 WP_000569412.1.94473 WP_000569412.1.94492 WP_000569412.1.94510 WP_000569412.1.94527 WP_000569412.1.94562 WP_000569412.1.94565 WP_000569412.1.94573 WP_000569412.1.94579 WP_000569412.1.94584 WP_000569412.1.94586 WP_000569412.1.94593 WP_000569412.1.94598 WP_000569412.1.94622 WP_000569412.1.94649 WP_000569412.1.94650 WP_000569412.1.94655 WP_000569412.1.94659 WP_000569412.1.94662 WP_000569412.1.94670 WP_000569412.1.94674 WP_000569412.1.94700 WP_000569412.1.94722 WP_000569412.1.94745 WP_000569412.1.94782 WP_000569412.1.94796 WP_000569412.1.9481 WP_000569412.1.94815 WP_000569412.1.94820 WP_000569412.1.94835 WP_000569412.1.94850 WP_000569412.1.94851 WP_000569412.1.94862 WP_000569412.1.94864 WP_000569412.1.94952 WP_000569412.1.94959 WP_000569412.1.94983 WP_000569412.1.95006 WP_000569412.1.9503 WP_000569412.1.95051 WP_000569412.1.95055 WP_000569412.1.95076 WP_000569412.1.95085 WP_000569412.1.95094 WP_000569412.1.95099 WP_000569412.1.95121 WP_000569412.1.95133 WP_000569412.1.95136 WP_000569412.1.9516 WP_000569412.1.95165 WP_000569412.1.95235 WP_000569412.1.95239 WP_000569412.1.95246 WP_000569412.1.95248 WP_000569412.1.9525 WP_000569412.1.95255 WP_000569412.1.95265 WP_000569412.1.9527 WP_000569412.1.95277 WP_000569412.1.95282 WP_000569412.1.95298 WP_000569412.1.95338 WP_000569412.1.95388 WP_000569412.1.95412 WP_000569412.1.95434 WP_000569412.1.95447 WP_000569412.1.95456 WP_000569412.1.95530 WP_000569412.1.95546 WP_000569412.1.95547 WP_000569412.1.95558 WP_000569412.1.95579 WP_000569412.1.95590 WP_000569412.1.95607 WP_000569412.1.95625 WP_000569412.1.95630 WP_000569412.1.95641 WP_000569412.1.95656 WP_000569412.1.95670 WP_000569412.1.95675 WP_000569412.1.95691 WP_000569412.1.95703 WP_000569412.1.95716 WP_000569412.1.9574 WP_000569412.1.95744 WP_000569412.1.95757 WP_000569412.1.95776 WP_000569412.1.95805 WP_000569412.1.9586 WP_000569412.1.95866 WP_000569412.1.95884 WP_000569412.1.95890 WP_000569412.1.95906 WP_000569412.1.95911 WP_000569412.1.95939 WP_000569412.1.95940 WP_000569412.1.95963 WP_000569412.1.96004 WP_000569412.1.96025 WP_000569412.1.96044 WP_000569412.1.96045 WP_000569412.1.96054 WP_000569412.1.96094 WP_000569412.1.96107 WP_000569412.1.96127 WP_000569412.1.96139 WP_000569412.1.96141 WP_000569412.1.96144 WP_000569412.1.96162 WP_000569412.1.96172 WP_000569412.1.96188 WP_000569412.1.96190 WP_000569412.1.96211 WP_000569412.1.96212 WP_000569412.1.9624 WP_000569412.1.96260 WP_000569412.1.96317 WP_000569412.1.96319 WP_000569412.1.9633 WP_000569412.1.96335 WP_000569412.1.96340 WP_000569412.1.96343 WP_000569412.1.96348 WP_000569412.1.96349 WP_000569412.1.96359 WP_000569412.1.96380 WP_000569412.1.9644 WP_000569412.1.96469 WP_000569412.1.96490 WP_000569412.1.96497 WP_000569412.1.96500 WP_000569412.1.96521 WP_000569412.1.96533 WP_000569412.1.96537 WP_000569412.1.96539 WP_000569412.1.96552 WP_000569412.1.96555 WP_000569412.1.96563 WP_000569412.1.96584 WP_000569412.1.96588 WP_000569412.1.96590 WP_000569412.1.96610 WP_000569412.1.96625 WP_000569412.1.96635 WP_000569412.1.9664 WP_000569412.1.96640 WP_000569412.1.96662 WP_000569412.1.96675 WP_000569412.1.9670 WP_000569412.1.96731 WP_000569412.1.96732 WP_000569412.1.96735 WP_000569412.1.9674 WP_000569412.1.96750 WP_000569412.1.96758 WP_000569412.1.96771 WP_000569412.1.96792 WP_000569412.1.96798 WP_000569412.1.96801 WP_000569412.1.96803 WP_000569412.1.9686 WP_000569412.1.96876 WP_000569412.1.96902 WP_000569412.1.96917 WP_000569412.1.96925 WP_000569412.1.96938 WP_000569412.1.96946 WP_000569412.1.96957 WP_000569412.1.96978 WP_000569412.1.96993 WP_000569412.1.97015 WP_000569412.1.97026 WP_000569412.1.97028 WP_000569412.1.97047 WP_000569412.1.97079 WP_000569412.1.97103 WP_000569412.1.97143 WP_000569412.1.97145 WP_000569412.1.97154 WP_000569412.1.97184 WP_000569412.1.97190 WP_000569412.1.97260 WP_000569412.1.97287 WP_000569412.1.97291 WP_000569412.1.97297 WP_000569412.1.97318 WP_000569412.1.97322 WP_000569412.1.97328 WP_000569412.1.97337 WP_000569412.1.97368 WP_000569412.1.97369 WP_000569412.1.97422 WP_000569412.1.97441 WP_000569412.1.97477 WP_000569412.1.97487 WP_000569412.1.97497 WP_000569412.1.97505 WP_000569412.1.97534 WP_000569412.1.97547 WP_000569412.1.97594 WP_000569412.1.97597 WP_000569412.1.97599 WP_000569412.1.97606 WP_000569412.1.97613 WP_000569412.1.97615 WP_000569412.1.97620 WP_000569412.1.97628 WP_000569412.1.97631 WP_000569412.1.97640 WP_000569412.1.97646 WP_000569412.1.97648 WP_000569412.1.97656 WP_000569412.1.97690 WP_000569412.1.97693 WP_000569412.1.97704 WP_000569412.1.97726 WP_000569412.1.97727 WP_000569412.1.97732 WP_000569412.1.97736 WP_000569412.1.9774 WP_000569412.1.9775 WP_000569412.1.97768 WP_000569412.1.97772 WP_000569412.1.97819 WP_000569412.1.97840 WP_000569412.1.97846 WP_000569412.1.97873 WP_000569412.1.9793 WP_000569412.1.97938 WP_000569412.1.97981 WP_000569412.1.97983 WP_000569412.1.97986 WP_000569412.1.9799 WP_000569412.1.97991 WP_000569412.1.98006 WP_000569412.1.98019 WP_000569412.1.98022 WP_000569412.1.98036 WP_000569412.1.9805 WP_000569412.1.98080 WP_000569412.1.98086 WP_000569412.1.9811 WP_000569412.1.98110 WP_000569412.1.98119 WP_000569412.1.98124 WP_000569412.1.98146 WP_000569412.1.98158 WP_000569412.1.98170 WP_000569412.1.98201 WP_000569412.1.98219 WP_000569412.1.98236 WP_000569412.1.9826 WP_000569412.1.98263 WP_000569412.1.98314 WP_000569412.1.98338 WP_000569412.1.98392 WP_000569412.1.98402 WP_000569412.1.9841 WP_000569412.1.98418 WP_000569412.1.98438 WP_000569412.1.98440 WP_000569412.1.98446 WP_000569412.1.98448 WP_000569412.1.98457 WP_000569412.1.98472 WP_000569412.1.98483 WP_000569412.1.98495 WP_000569412.1.9850 WP_000569412.1.98502 WP_000569412.1.98513 WP_000569412.1.98531 WP_000569412.1.98570 WP_000569412.1.98577 WP_000569412.1.98607 WP_000569412.1.98676 WP_000569412.1.98677 WP_000569412.1.98726 WP_000569412.1.98731 WP_000569412.1.98760 WP_000569412.1.98762 WP_000569412.1.98763 WP_000569412.1.9877 WP_000569412.1.98801 WP_000569412.1.98818 WP_000569412.1.98843 WP_000569412.1.98899 WP_000569412.1.98931 WP_000569412.1.9898 WP_000569412.1.9899 WP_000569412.1.99057 WP_000569412.1.99073 WP_000569412.1.99097 WP_000569412.1.99098 WP_000569412.1.99163 WP_000569412.1.99164 WP_000569412.1.99184 WP_000569412.1.9919 WP_000569412.1.99215 WP_000569412.1.99219 WP_000569412.1.99255 WP_000569412.1.99267 WP_000569412.1.99276 WP_000569412.1.99327 WP_000569412.1.99335 WP_000569412.1.99350 WP_000569412.1.99360 WP_000569412.1.99363 WP_000569412.1.99369 WP_000569412.1.99370 WP_000569412.1.99388 WP_000569412.1.99397 WP_000569412.1.99456 WP_000569412.1.99463 WP_000569412.1.99469 WP_000569412.1.99483 WP_000569412.1.99490 WP_000569412.1.99493 WP_000569412.1.99531 WP_000569412.1.9954 WP_000569412.1.99546 WP_000569412.1.99561 WP_000569412.1.99577 WP_000569412.1.99579 WP_000569412.1.99595 WP_000569412.1.99613 WP_000569412.1.99626 WP_000569412.1.99630 WP_000569412.1.99646 WP_000569412.1.99657 WP_000569412.1.99660 WP_000569412.1.99671 WP_000569412.1.99676 WP_000569412.1.99712 WP_000569412.1.99764 WP_000569412.1.99783 WP_000569412.1.99813 WP_000569412.1.99824 WP_000569412.1.99829 WP_000569412.1.99837 WP_000569412.1.99841 WP_000569412.1.99858 WP_000569412.1.99889 WP_000569412.1.9992 WP_000569412.1.99924 WP_000569412.1.99958 WP_000569412.1.99961 WP_000569412.1.99996 gi|378958377|ref|YP_005215863.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]