SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378448564|ref|YP_005235923.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378448564|ref|YP_005235923.1|
Domain Number 1 Region: 2-257
Classification Level Classification E-value
Superfamily NAD(P)-linked oxidoreductase 7.99e-82
Family Aldo-keto reductases (NADP) 0.00000164
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|378448564|ref|YP_005235923.1|
Sequence length 267
Comment 2,5-diketo-D-gluconate reductase B [Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S]
Sequence
MTIPAFGLGTFRLKDDVVIASVKTALELGYRAVDTAQIYDNEAAVGQAIAESGVPRNELY
ITTKIWIENLSKDKLIPSLKESLKKLRTDYVDLTLIHWPSPGDAVSVEEFMQALLEAKKQ
GLTREIGISNFTIPLMEKAIAAVGADNIATNQIELSPYLQNRKVVDWAKAHGIHITSYMT
LAYGKALKDEVIARIAAKHNATPAQVILAWAMGEGYSVIPSSTRRENLASNLLAQDLHLD
AEDKNAIAALDCNDRLVSPEGLAPAWD
Download sequence
Identical sequences A0A0D6HGJ6 A0A0F6AX55 A0A0F7J5M0 A0A0H3N9F6 A0A0M0PT34 A0A0T9VRB2 A0A2D3AL98 A0A2G1P1R0 A0A2H9YBW3 E8XIS0 G5RAS8
gi|378987654|ref|YP_005250818.1| gi|378448564|ref|YP_005235923.1| gi|383495073|ref|YP_005395762.1| gi|549722973|ref|YP_008643163.1| gi|378698228|ref|YP_005180185.1| WP_000154871.1.100010 WP_000154871.1.100234 WP_000154871.1.100258 WP_000154871.1.100424 WP_000154871.1.100436 WP_000154871.1.100484 WP_000154871.1.100488 WP_000154871.1.100597 WP_000154871.1.10076 WP_000154871.1.100781 WP_000154871.1.100793 WP_000154871.1.100869 WP_000154871.1.100871 WP_000154871.1.100882 WP_000154871.1.100948 WP_000154871.1.101020 WP_000154871.1.101074 WP_000154871.1.101078 WP_000154871.1.101180 WP_000154871.1.101259 WP_000154871.1.101284 WP_000154871.1.101320 WP_000154871.1.101353 WP_000154871.1.101386 WP_000154871.1.101404 WP_000154871.1.101420 WP_000154871.1.101589 WP_000154871.1.101707 WP_000154871.1.101734 WP_000154871.1.101953 WP_000154871.1.10220 WP_000154871.1.10429 WP_000154871.1.10439 WP_000154871.1.10678 WP_000154871.1.10753 WP_000154871.1.11000 WP_000154871.1.11024 WP_000154871.1.11031 WP_000154871.1.11098 WP_000154871.1.11168 WP_000154871.1.11190 WP_000154871.1.11295 WP_000154871.1.11455 WP_000154871.1.11458 WP_000154871.1.11532 WP_000154871.1.11763 WP_000154871.1.11865 WP_000154871.1.11897 WP_000154871.1.12025 WP_000154871.1.12114 WP_000154871.1.12351 WP_000154871.1.12370 WP_000154871.1.12546 WP_000154871.1.1264 WP_000154871.1.12728 WP_000154871.1.12879 WP_000154871.1.12936 WP_000154871.1.12995 WP_000154871.1.13027 WP_000154871.1.13106 WP_000154871.1.13130 WP_000154871.1.13311 WP_000154871.1.13334 WP_000154871.1.13414 WP_000154871.1.13488 WP_000154871.1.13669 WP_000154871.1.13741 WP_000154871.1.1387 WP_000154871.1.13908 WP_000154871.1.13932 WP_000154871.1.13968 WP_000154871.1.14001 WP_000154871.1.14151 WP_000154871.1.14239 WP_000154871.1.14320 WP_000154871.1.14379 WP_000154871.1.14406 WP_000154871.1.14410 WP_000154871.1.14466 WP_000154871.1.14524 WP_000154871.1.14554 WP_000154871.1.14725 WP_000154871.1.14737 WP_000154871.1.14852 WP_000154871.1.1489 WP_000154871.1.14932 WP_000154871.1.15055 WP_000154871.1.15124 WP_000154871.1.15223 WP_000154871.1.15226 WP_000154871.1.15316 WP_000154871.1.15369 WP_000154871.1.1540 WP_000154871.1.15784 WP_000154871.1.15830 WP_000154871.1.16062 WP_000154871.1.16063 WP_000154871.1.16226 WP_000154871.1.16233 WP_000154871.1.16284 WP_000154871.1.16468 WP_000154871.1.16614 WP_000154871.1.16650 WP_000154871.1.16686 WP_000154871.1.16691 WP_000154871.1.167 WP_000154871.1.16732 WP_000154871.1.16735 WP_000154871.1.16786 WP_000154871.1.16858 WP_000154871.1.16965 WP_000154871.1.1700 WP_000154871.1.17307 WP_000154871.1.174 WP_000154871.1.17480 WP_000154871.1.17546 WP_000154871.1.17702 WP_000154871.1.17705 WP_000154871.1.17747 WP_000154871.1.18019 WP_000154871.1.18111 WP_000154871.1.18163 WP_000154871.1.18249 WP_000154871.1.18265 WP_000154871.1.18267 WP_000154871.1.18282 WP_000154871.1.18468 WP_000154871.1.18607 WP_000154871.1.18705 WP_000154871.1.18715 WP_000154871.1.18776 WP_000154871.1.18822 WP_000154871.1.18881 WP_000154871.1.18940 WP_000154871.1.19053 WP_000154871.1.19320 WP_000154871.1.19458 WP_000154871.1.19460 WP_000154871.1.19461 WP_000154871.1.19614 WP_000154871.1.19642 WP_000154871.1.19706 WP_000154871.1.19724 WP_000154871.1.19749 WP_000154871.1.19784 WP_000154871.1.19802 WP_000154871.1.19809 WP_000154871.1.19867 WP_000154871.1.1998 WP_000154871.1.20 WP_000154871.1.2010 WP_000154871.1.20212 WP_000154871.1.20266 WP_000154871.1.20271 WP_000154871.1.20330 WP_000154871.1.20362 WP_000154871.1.20418 WP_000154871.1.20443 WP_000154871.1.2054 WP_000154871.1.20553 WP_000154871.1.20626 WP_000154871.1.20646 WP_000154871.1.20908 WP_000154871.1.21049 WP_000154871.1.21146 WP_000154871.1.21245 WP_000154871.1.21246 WP_000154871.1.21269 WP_000154871.1.21400 WP_000154871.1.21497 WP_000154871.1.21499 WP_000154871.1.21548 WP_000154871.1.21603 WP_000154871.1.21751 WP_000154871.1.21757 WP_000154871.1.22024 WP_000154871.1.2205 WP_000154871.1.22062 WP_000154871.1.22067 WP_000154871.1.2221 WP_000154871.1.22379 WP_000154871.1.22427 WP_000154871.1.2246 WP_000154871.1.22485 WP_000154871.1.22537 WP_000154871.1.22620 WP_000154871.1.22870 WP_000154871.1.22979 WP_000154871.1.23102 WP_000154871.1.23114 WP_000154871.1.2314 WP_000154871.1.23172 WP_000154871.1.23192 WP_000154871.1.23259 WP_000154871.1.23460 WP_000154871.1.23472 WP_000154871.1.23482 WP_000154871.1.23634 WP_000154871.1.2364 WP_000154871.1.24017 WP_000154871.1.24206 WP_000154871.1.24308 WP_000154871.1.24578 WP_000154871.1.24737 WP_000154871.1.24779 WP_000154871.1.25008 WP_000154871.1.25015 WP_000154871.1.25206 WP_000154871.1.25405 WP_000154871.1.25493 WP_000154871.1.25668 WP_000154871.1.25690 WP_000154871.1.2570 WP_000154871.1.25793 WP_000154871.1.25814 WP_000154871.1.25988 WP_000154871.1.26282 WP_000154871.1.26311 WP_000154871.1.26319 WP_000154871.1.26429 WP_000154871.1.26440 WP_000154871.1.26493 WP_000154871.1.26551 WP_000154871.1.26567 WP_000154871.1.27010 WP_000154871.1.27173 WP_000154871.1.27423 WP_000154871.1.27561 WP_000154871.1.2763 WP_000154871.1.27665 WP_000154871.1.27707 WP_000154871.1.27761 WP_000154871.1.2777 WP_000154871.1.27857 WP_000154871.1.27977 WP_000154871.1.28094 WP_000154871.1.28126 WP_000154871.1.28170 WP_000154871.1.28302 WP_000154871.1.2835 WP_000154871.1.28370 WP_000154871.1.28538 WP_000154871.1.28575 WP_000154871.1.28625 WP_000154871.1.28655 WP_000154871.1.28694 WP_000154871.1.2879 WP_000154871.1.28830 WP_000154871.1.2890 WP_000154871.1.28938 WP_000154871.1.28946 WP_000154871.1.29006 WP_000154871.1.2910 WP_000154871.1.29588 WP_000154871.1.29601 WP_000154871.1.29606 WP_000154871.1.29615 WP_000154871.1.29619 WP_000154871.1.29704 WP_000154871.1.29969 WP_000154871.1.30006 WP_000154871.1.30027 WP_000154871.1.30180 WP_000154871.1.30469 WP_000154871.1.30507 WP_000154871.1.30535 WP_000154871.1.30547 WP_000154871.1.30794 WP_000154871.1.30833 WP_000154871.1.30835 WP_000154871.1.30972 WP_000154871.1.31 WP_000154871.1.31111 WP_000154871.1.3113 WP_000154871.1.31171 WP_000154871.1.31185 WP_000154871.1.3119 WP_000154871.1.31190 WP_000154871.1.31195 WP_000154871.1.31196 WP_000154871.1.31219 WP_000154871.1.31281 WP_000154871.1.31362 WP_000154871.1.31504 WP_000154871.1.31515 WP_000154871.1.31578 WP_000154871.1.31658 WP_000154871.1.31720 WP_000154871.1.31940 WP_000154871.1.31967 WP_000154871.1.32192 WP_000154871.1.32206 WP_000154871.1.32438 WP_000154871.1.32515 WP_000154871.1.32527 WP_000154871.1.32629 WP_000154871.1.32660 WP_000154871.1.32702 WP_000154871.1.32714 WP_000154871.1.32786 WP_000154871.1.32804 WP_000154871.1.32860 WP_000154871.1.32907 WP_000154871.1.33030 WP_000154871.1.33127 WP_000154871.1.33143 WP_000154871.1.333 WP_000154871.1.33492 WP_000154871.1.33553 WP_000154871.1.33592 WP_000154871.1.33817 WP_000154871.1.33894 WP_000154871.1.34043 WP_000154871.1.34075 WP_000154871.1.34257 WP_000154871.1.34279 WP_000154871.1.34319 WP_000154871.1.34453 WP_000154871.1.34610 WP_000154871.1.34856 WP_000154871.1.34977 WP_000154871.1.35045 WP_000154871.1.35129 WP_000154871.1.35184 WP_000154871.1.35404 WP_000154871.1.35408 WP_000154871.1.35425 WP_000154871.1.35429 WP_000154871.1.35446 WP_000154871.1.35463 WP_000154871.1.35503 WP_000154871.1.35509 WP_000154871.1.35590 WP_000154871.1.35940 WP_000154871.1.36003 WP_000154871.1.3601 WP_000154871.1.36609 WP_000154871.1.36690 WP_000154871.1.3670 WP_000154871.1.36705 WP_000154871.1.36918 WP_000154871.1.36931 WP_000154871.1.37073 WP_000154871.1.37293 WP_000154871.1.37370 WP_000154871.1.37376 WP_000154871.1.3744 WP_000154871.1.37498 WP_000154871.1.37504 WP_000154871.1.37618 WP_000154871.1.37687 WP_000154871.1.37968 WP_000154871.1.37978 WP_000154871.1.38026 WP_000154871.1.38125 WP_000154871.1.38145 WP_000154871.1.383 WP_000154871.1.3848 WP_000154871.1.38613 WP_000154871.1.38673 WP_000154871.1.3869 WP_000154871.1.38693 WP_000154871.1.38773 WP_000154871.1.38882 WP_000154871.1.38913 WP_000154871.1.39003 WP_000154871.1.39136 WP_000154871.1.39197 WP_000154871.1.39229 WP_000154871.1.39405 WP_000154871.1.39449 WP_000154871.1.39512 WP_000154871.1.39556 WP_000154871.1.39629 WP_000154871.1.39763 WP_000154871.1.39862 WP_000154871.1.39921 WP_000154871.1.39923 WP_000154871.1.40017 WP_000154871.1.40072 WP_000154871.1.40073 WP_000154871.1.4011 WP_000154871.1.40208 WP_000154871.1.40224 WP_000154871.1.40240 WP_000154871.1.40257 WP_000154871.1.40305 WP_000154871.1.40311 WP_000154871.1.40380 WP_000154871.1.40395 WP_000154871.1.40710 WP_000154871.1.4075 WP_000154871.1.4087 WP_000154871.1.40877 WP_000154871.1.41017 WP_000154871.1.41086 WP_000154871.1.41091 WP_000154871.1.41226 WP_000154871.1.41279 WP_000154871.1.41516 WP_000154871.1.41572 WP_000154871.1.41591 WP_000154871.1.41662 WP_000154871.1.41708 WP_000154871.1.41761 WP_000154871.1.41859 WP_000154871.1.41882 WP_000154871.1.41979 WP_000154871.1.41985 WP_000154871.1.42104 WP_000154871.1.42320 WP_000154871.1.42342 WP_000154871.1.42422 WP_000154871.1.42864 WP_000154871.1.4288 WP_000154871.1.43018 WP_000154871.1.43041 WP_000154871.1.43244 WP_000154871.1.43312 WP_000154871.1.43334 WP_000154871.1.43351 WP_000154871.1.43437 WP_000154871.1.43522 WP_000154871.1.43668 WP_000154871.1.43886 WP_000154871.1.44005 WP_000154871.1.44043 WP_000154871.1.44099 WP_000154871.1.44121 WP_000154871.1.44291 WP_000154871.1.44310 WP_000154871.1.44386 WP_000154871.1.44479 WP_000154871.1.44640 WP_000154871.1.4467 WP_000154871.1.44747 WP_000154871.1.4485 WP_000154871.1.44877 WP_000154871.1.44927 WP_000154871.1.44971 WP_000154871.1.45067 WP_000154871.1.45074 WP_000154871.1.45079 WP_000154871.1.45098 WP_000154871.1.45177 WP_000154871.1.45259 WP_000154871.1.45344 WP_000154871.1.45349 WP_000154871.1.45365 WP_000154871.1.45544 WP_000154871.1.45585 WP_000154871.1.45660 WP_000154871.1.45797 WP_000154871.1.458 WP_000154871.1.46011 WP_000154871.1.46069 WP_000154871.1.46174 WP_000154871.1.46303 WP_000154871.1.46595 WP_000154871.1.46620 WP_000154871.1.46675 WP_000154871.1.46804 WP_000154871.1.46930 WP_000154871.1.47057 WP_000154871.1.47214 WP_000154871.1.47448 WP_000154871.1.4747 WP_000154871.1.47472 WP_000154871.1.47478 WP_000154871.1.47621 WP_000154871.1.47799 WP_000154871.1.48242 WP_000154871.1.48253 WP_000154871.1.483 WP_000154871.1.48367 WP_000154871.1.48377 WP_000154871.1.4853 WP_000154871.1.48788 WP_000154871.1.4885 WP_000154871.1.48894 WP_000154871.1.48919 WP_000154871.1.49084 WP_000154871.1.49204 WP_000154871.1.49239 WP_000154871.1.49256 WP_000154871.1.49290 WP_000154871.1.49309 WP_000154871.1.49340 WP_000154871.1.49366 WP_000154871.1.49375 WP_000154871.1.49490 WP_000154871.1.49515 WP_000154871.1.49572 WP_000154871.1.4979 WP_000154871.1.49803 WP_000154871.1.49805 WP_000154871.1.49929 WP_000154871.1.50080 WP_000154871.1.50161 WP_000154871.1.50211 WP_000154871.1.50376 WP_000154871.1.50389 WP_000154871.1.50676 WP_000154871.1.50774 WP_000154871.1.50804 WP_000154871.1.50808 WP_000154871.1.5088 WP_000154871.1.50908 WP_000154871.1.50941 WP_000154871.1.51022 WP_000154871.1.51179 WP_000154871.1.51186 WP_000154871.1.51464 WP_000154871.1.51487 WP_000154871.1.51488 WP_000154871.1.51594 WP_000154871.1.51634 WP_000154871.1.51649 WP_000154871.1.51686 WP_000154871.1.51841 WP_000154871.1.51911 WP_000154871.1.51932 WP_000154871.1.51989 WP_000154871.1.52121 WP_000154871.1.52148 WP_000154871.1.52346 WP_000154871.1.52353 WP_000154871.1.52361 WP_000154871.1.52653 WP_000154871.1.52656 WP_000154871.1.52743 WP_000154871.1.52857 WP_000154871.1.52898 WP_000154871.1.52915 WP_000154871.1.53190 WP_000154871.1.53406 WP_000154871.1.53436 WP_000154871.1.53466 WP_000154871.1.53529 WP_000154871.1.53543 WP_000154871.1.53688 WP_000154871.1.53757 WP_000154871.1.53812 WP_000154871.1.54033 WP_000154871.1.54075 WP_000154871.1.542 WP_000154871.1.54271 WP_000154871.1.54273 WP_000154871.1.54319 WP_000154871.1.54364 WP_000154871.1.54400 WP_000154871.1.54644 WP_000154871.1.54662 WP_000154871.1.54722 WP_000154871.1.54749 WP_000154871.1.54764 WP_000154871.1.55008 WP_000154871.1.55152 WP_000154871.1.55156 WP_000154871.1.55285 WP_000154871.1.55475 WP_000154871.1.55647 WP_000154871.1.55743 WP_000154871.1.55768 WP_000154871.1.55782 WP_000154871.1.55796 WP_000154871.1.55993 WP_000154871.1.56002 WP_000154871.1.56012 WP_000154871.1.56238 WP_000154871.1.56304 WP_000154871.1.56414 WP_000154871.1.56438 WP_000154871.1.56560 WP_000154871.1.56597 WP_000154871.1.56601 WP_000154871.1.56614 WP_000154871.1.56671 WP_000154871.1.56875 WP_000154871.1.56877 WP_000154871.1.57168 WP_000154871.1.57187 WP_000154871.1.57232 WP_000154871.1.57377 WP_000154871.1.57418 WP_000154871.1.57515 WP_000154871.1.57529 WP_000154871.1.57576 WP_000154871.1.57601 WP_000154871.1.57607 WP_000154871.1.57763 WP_000154871.1.57862 WP_000154871.1.57891 WP_000154871.1.57978 WP_000154871.1.5801 WP_000154871.1.58041 WP_000154871.1.58418 WP_000154871.1.5854 WP_000154871.1.58548 WP_000154871.1.5858 WP_000154871.1.58662 WP_000154871.1.58669 WP_000154871.1.58745 WP_000154871.1.58803 WP_000154871.1.5886 WP_000154871.1.59094 WP_000154871.1.59224 WP_000154871.1.59321 WP_000154871.1.59375 WP_000154871.1.59458 WP_000154871.1.59490 WP_000154871.1.5953 WP_000154871.1.59684 WP_000154871.1.59694 WP_000154871.1.59771 WP_000154871.1.5979 WP_000154871.1.59953 WP_000154871.1.60008 WP_000154871.1.60106 WP_000154871.1.60140 WP_000154871.1.60155 WP_000154871.1.60285 WP_000154871.1.60379 WP_000154871.1.60464 WP_000154871.1.60874 WP_000154871.1.60941 WP_000154871.1.61078 WP_000154871.1.6114 WP_000154871.1.61232 WP_000154871.1.6129 WP_000154871.1.61296 WP_000154871.1.61345 WP_000154871.1.61417 WP_000154871.1.61574 WP_000154871.1.61609 WP_000154871.1.61712 WP_000154871.1.61714 WP_000154871.1.61730 WP_000154871.1.61857 WP_000154871.1.61918 WP_000154871.1.62007 WP_000154871.1.62025 WP_000154871.1.62204 WP_000154871.1.62304 WP_000154871.1.62364 WP_000154871.1.62374 WP_000154871.1.62403 WP_000154871.1.62404 WP_000154871.1.6253 WP_000154871.1.62570 WP_000154871.1.62903 WP_000154871.1.62910 WP_000154871.1.63063 WP_000154871.1.63181 WP_000154871.1.63203 WP_000154871.1.63256 WP_000154871.1.63290 WP_000154871.1.63382 WP_000154871.1.63432 WP_000154871.1.63479 WP_000154871.1.63577 WP_000154871.1.63664 WP_000154871.1.63718 WP_000154871.1.6375 WP_000154871.1.63757 WP_000154871.1.63834 WP_000154871.1.64046 WP_000154871.1.64403 WP_000154871.1.64649 WP_000154871.1.64781 WP_000154871.1.64831 WP_000154871.1.6489 WP_000154871.1.65018 WP_000154871.1.65028 WP_000154871.1.65171 WP_000154871.1.65248 WP_000154871.1.6535 WP_000154871.1.65474 WP_000154871.1.65572 WP_000154871.1.65633 WP_000154871.1.6565 WP_000154871.1.65696 WP_000154871.1.6575 WP_000154871.1.65782 WP_000154871.1.6630 WP_000154871.1.66314 WP_000154871.1.66358 WP_000154871.1.6638 WP_000154871.1.6640 WP_000154871.1.66698 WP_000154871.1.66834 WP_000154871.1.66901 WP_000154871.1.66962 WP_000154871.1.67037 WP_000154871.1.67045 WP_000154871.1.67181 WP_000154871.1.67268 WP_000154871.1.67347 WP_000154871.1.67465 WP_000154871.1.67552 WP_000154871.1.67637 WP_000154871.1.67682 WP_000154871.1.67829 WP_000154871.1.67887 WP_000154871.1.68073 WP_000154871.1.68201 WP_000154871.1.68206 WP_000154871.1.6827 WP_000154871.1.68275 WP_000154871.1.68547 WP_000154871.1.68589 WP_000154871.1.68655 WP_000154871.1.68656 WP_000154871.1.68778 WP_000154871.1.68787 WP_000154871.1.68894 WP_000154871.1.68928 WP_000154871.1.68975 WP_000154871.1.69006 WP_000154871.1.6913 WP_000154871.1.69397 WP_000154871.1.69564 WP_000154871.1.69644 WP_000154871.1.7021 WP_000154871.1.70241 WP_000154871.1.70269 WP_000154871.1.70289 WP_000154871.1.70447 WP_000154871.1.70643 WP_000154871.1.70683 WP_000154871.1.70883 WP_000154871.1.70948 WP_000154871.1.71165 WP_000154871.1.71243 WP_000154871.1.71306 WP_000154871.1.71337 WP_000154871.1.71378 WP_000154871.1.71401 WP_000154871.1.71691 WP_000154871.1.71702 WP_000154871.1.71750 WP_000154871.1.71845 WP_000154871.1.71881 WP_000154871.1.71908 WP_000154871.1.71952 WP_000154871.1.71973 WP_000154871.1.72105 WP_000154871.1.72203 WP_000154871.1.72372 WP_000154871.1.72376 WP_000154871.1.72594 WP_000154871.1.72871 WP_000154871.1.72975 WP_000154871.1.73062 WP_000154871.1.7315 WP_000154871.1.73200 WP_000154871.1.7334 WP_000154871.1.73377 WP_000154871.1.73481 WP_000154871.1.7356 WP_000154871.1.73561 WP_000154871.1.73581 WP_000154871.1.73617 WP_000154871.1.73667 WP_000154871.1.73753 WP_000154871.1.73758 WP_000154871.1.73794 WP_000154871.1.7387 WP_000154871.1.73924 WP_000154871.1.73926 WP_000154871.1.73945 WP_000154871.1.74029 WP_000154871.1.74049 WP_000154871.1.74181 WP_000154871.1.7433 WP_000154871.1.74379 WP_000154871.1.74466 WP_000154871.1.74545 WP_000154871.1.74745 WP_000154871.1.75129 WP_000154871.1.75177 WP_000154871.1.75187 WP_000154871.1.75288 WP_000154871.1.75334 WP_000154871.1.75362 WP_000154871.1.75385 WP_000154871.1.75392 WP_000154871.1.75760 WP_000154871.1.75764 WP_000154871.1.75837 WP_000154871.1.75874 WP_000154871.1.75945 WP_000154871.1.76020 WP_000154871.1.76252 WP_000154871.1.76445 WP_000154871.1.76706 WP_000154871.1.76721 WP_000154871.1.76756 WP_000154871.1.76760 WP_000154871.1.76875 WP_000154871.1.76880 WP_000154871.1.76899 WP_000154871.1.77038 WP_000154871.1.77080 WP_000154871.1.7712 WP_000154871.1.77180 WP_000154871.1.77244 WP_000154871.1.77292 WP_000154871.1.77514 WP_000154871.1.77529 WP_000154871.1.77549 WP_000154871.1.77692 WP_000154871.1.7782 WP_000154871.1.77851 WP_000154871.1.77898 WP_000154871.1.77918 WP_000154871.1.77960 WP_000154871.1.77971 WP_000154871.1.77987 WP_000154871.1.78033 WP_000154871.1.78076 WP_000154871.1.78096 WP_000154871.1.78100 WP_000154871.1.78110 WP_000154871.1.78120 WP_000154871.1.78407 WP_000154871.1.7861 WP_000154871.1.78618 WP_000154871.1.78673 WP_000154871.1.78735 WP_000154871.1.78802 WP_000154871.1.78830 WP_000154871.1.78835 WP_000154871.1.78918 WP_000154871.1.78930 WP_000154871.1.79151 WP_000154871.1.79167 WP_000154871.1.79462 WP_000154871.1.79466 WP_000154871.1.79490 WP_000154871.1.79495 WP_000154871.1.79529 WP_000154871.1.79570 WP_000154871.1.7964 WP_000154871.1.79659 WP_000154871.1.79668 WP_000154871.1.79708 WP_000154871.1.79845 WP_000154871.1.80077 WP_000154871.1.80137 WP_000154871.1.80182 WP_000154871.1.80296 WP_000154871.1.80366 WP_000154871.1.80850 WP_000154871.1.80881 WP_000154871.1.80939 WP_000154871.1.8096 WP_000154871.1.81037 WP_000154871.1.81069 WP_000154871.1.81149 WP_000154871.1.81175 WP_000154871.1.8119 WP_000154871.1.81193 WP_000154871.1.81354 WP_000154871.1.81410 WP_000154871.1.81425 WP_000154871.1.81785 WP_000154871.1.81902 WP_000154871.1.81974 WP_000154871.1.82395 WP_000154871.1.82479 WP_000154871.1.82503 WP_000154871.1.82515 WP_000154871.1.82676 WP_000154871.1.82761 WP_000154871.1.8282 WP_000154871.1.82867 WP_000154871.1.82944 WP_000154871.1.82956 WP_000154871.1.83163 WP_000154871.1.83305 WP_000154871.1.83365 WP_000154871.1.83491 WP_000154871.1.83523 WP_000154871.1.8354 WP_000154871.1.83721 WP_000154871.1.83760 WP_000154871.1.83995 WP_000154871.1.84283 WP_000154871.1.84392 WP_000154871.1.8441 WP_000154871.1.84532 WP_000154871.1.84659 WP_000154871.1.84693 WP_000154871.1.84899 WP_000154871.1.8497 WP_000154871.1.85040 WP_000154871.1.85134 WP_000154871.1.85178 WP_000154871.1.85180 WP_000154871.1.85190 WP_000154871.1.8533 WP_000154871.1.8545 WP_000154871.1.85481 WP_000154871.1.8556 WP_000154871.1.85615 WP_000154871.1.85617 WP_000154871.1.85663 WP_000154871.1.85671 WP_000154871.1.85777 WP_000154871.1.85855 WP_000154871.1.85886 WP_000154871.1.85904 WP_000154871.1.85976 WP_000154871.1.86306 WP_000154871.1.86356 WP_000154871.1.86450 WP_000154871.1.86469 WP_000154871.1.86580 WP_000154871.1.86588 WP_000154871.1.86661 WP_000154871.1.8672 WP_000154871.1.8678 WP_000154871.1.86810 WP_000154871.1.8684 WP_000154871.1.86895 WP_000154871.1.86906 WP_000154871.1.87095 WP_000154871.1.8736 WP_000154871.1.87460 WP_000154871.1.87552 WP_000154871.1.87779 WP_000154871.1.87945 WP_000154871.1.88019 WP_000154871.1.88073 WP_000154871.1.8809 WP_000154871.1.88291 WP_000154871.1.88293 WP_000154871.1.8837 WP_000154871.1.88393 WP_000154871.1.88703 WP_000154871.1.88792 WP_000154871.1.88902 WP_000154871.1.8891 WP_000154871.1.89008 WP_000154871.1.89116 WP_000154871.1.89138 WP_000154871.1.89304 WP_000154871.1.89512 WP_000154871.1.89527 WP_000154871.1.89570 WP_000154871.1.89604 WP_000154871.1.89902 WP_000154871.1.8996 WP_000154871.1.90409 WP_000154871.1.90417 WP_000154871.1.90453 WP_000154871.1.90458 WP_000154871.1.90472 WP_000154871.1.90557 WP_000154871.1.90625 WP_000154871.1.90641 WP_000154871.1.91003 WP_000154871.1.91278 WP_000154871.1.9131 WP_000154871.1.91512 WP_000154871.1.91564 WP_000154871.1.91628 WP_000154871.1.91655 WP_000154871.1.91724 WP_000154871.1.91732 WP_000154871.1.91788 WP_000154871.1.91880 WP_000154871.1.92013 WP_000154871.1.92060 WP_000154871.1.92093 WP_000154871.1.92108 WP_000154871.1.92171 WP_000154871.1.92183 WP_000154871.1.92208 WP_000154871.1.92268 WP_000154871.1.92310 WP_000154871.1.92318 WP_000154871.1.92443 WP_000154871.1.92482 WP_000154871.1.92531 WP_000154871.1.93086 WP_000154871.1.93101 WP_000154871.1.93136 WP_000154871.1.93155 WP_000154871.1.93275 WP_000154871.1.93376 WP_000154871.1.93543 WP_000154871.1.93650 WP_000154871.1.93662 WP_000154871.1.937 WP_000154871.1.93705 WP_000154871.1.93804 WP_000154871.1.9389 WP_000154871.1.93994 WP_000154871.1.94072 WP_000154871.1.94162 WP_000154871.1.94168 WP_000154871.1.94198 WP_000154871.1.9432 WP_000154871.1.94354 WP_000154871.1.94380 WP_000154871.1.94458 WP_000154871.1.94565 WP_000154871.1.94584 WP_000154871.1.94674 WP_000154871.1.94796 WP_000154871.1.94798 WP_000154871.1.94959 WP_000154871.1.95051 WP_000154871.1.95085 WP_000154871.1.95121 WP_000154871.1.95282 WP_000154871.1.95546 WP_000154871.1.95630 WP_000154871.1.95911 WP_000154871.1.96139 WP_000154871.1.96203 WP_000154871.1.96317 WP_000154871.1.96343 WP_000154871.1.9644 WP_000154871.1.96469 WP_000154871.1.96497 WP_000154871.1.96500 WP_000154871.1.96555 WP_000154871.1.96732 WP_000154871.1.96771 WP_000154871.1.97015 WP_000154871.1.97145 WP_000154871.1.97185 WP_000154871.1.97190 WP_000154871.1.97318 WP_000154871.1.97369 WP_000154871.1.97594 WP_000154871.1.97597 WP_000154871.1.97613 WP_000154871.1.97620 WP_000154871.1.97727 WP_000154871.1.97732 WP_000154871.1.9775 WP_000154871.1.97846 WP_000154871.1.98019 WP_000154871.1.98022 WP_000154871.1.98110 WP_000154871.1.98146 WP_000154871.1.98219 WP_000154871.1.98236 WP_000154871.1.9841 WP_000154871.1.98495 WP_000154871.1.98531 WP_000154871.1.98676 WP_000154871.1.98677 WP_000154871.1.98760 WP_000154871.1.98843 WP_000154871.1.9898 WP_000154871.1.99098 WP_000154871.1.99184 WP_000154871.1.99267 WP_000154871.1.99276 WP_000154871.1.99646 WP_000154871.1.99657 WP_000154871.1.99660 WP_000154871.1.99712 WP_000154871.1.99813 WP_000154871.1.99858 WP_000154871.1.99889 WP_000154871.1.99958 gi|525839295|ref|YP_008256570.1| ABAM02000001|CDS_796265-797068 ABAO01000059|CDS_413-1216 CP001363|CDS_295769-296572 FN424405|CDS_295056-295859 gi|550899670|ref|YP_008668762.1| gi|526219192|ref|YP_008264509.1| gi|379699471|ref|YP_005241199.1| gi|378443701|ref|YP_005231333.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]