SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378448572|ref|YP_005235931.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378448572|ref|YP_005235931.1|
Domain Number 1 Region: 4-141
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.01e-58
Family Ribonuclease H 0.000000177
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|378448572|ref|YP_005235931.1|
Sequence length 155
Comment ribonuclease H [Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S]
Sequence
MLKQVEIFTDGSCLGNPGPGGYGAILRYRGHEKTFSEGYTLTTNNRMELMAAIVALEALK
EHCEVTLSTDSQYVRQGITQWIHNWKKRGWKTAEKKPVKNVDLWKRLDAALGQHQIKWVW
VKGHAGHPENERCDELARAAAMNPTQEDSGYQAEA
Download sequence
Identical sequences A0A089GAY3 A0A0F5B7A3 A0A0F6AX63 A0A0F7J5D7 A0A0G2NJA5 A0A0H3N8C8 A0A0K6RJR3 A0A0L9E692 A0A0M0QZ72 A0A0R9NCS1 A0A0T7RPC7 A0A0U1H0A5 A0A0V2D511 A0A0V2EBD5 A0A1C2ZQ89 A0A1M3YBE1 A0A1R2S351 A0A1S0ZGA4 A0A1S1AMQ5 A0A1X2RII7 A0A1X2T8U7 A0A1X2UII2 A0A1X2YAN8 A0A1Z3QCG6 A0A221YUR9 A0A221Z3P4 A0A265B9Q8 A0A267S5J6 A0A271CBW2 A0A271CPT8 A0A2C6G096 A0A2C9P335 A0A2D1XHD0 A0A2D1XVD7 A0A2D3TZK7 A0A2G1NMY8 A0A2H9YBX0 A0A2I6MC16 A0A2I6MPM6 A0A2I6N354 A0A2I6NGX1 A0A2I6NUR3 A0A2I6P7P8 A0A2K2S3P9 A0A2K2S4J4 A0A2K2SJG4 A0A2K2T1S9 A0A2K2TA62 A0A2K2ZRL9 A9MPF1 A9MZ19 B4SV39 B4TK85 B4TYH0 B5BDW5 B5F8X2 B5FJ58 B5R449 B5R5L3 E8XIS8 G4C4J5 G5MDY2 M7S4W1 P0A2B9 P0A2C0 Q57SZ6 Q5PFD8 S4HTF9 S5HQN1 V1XBN9 V7IQ72 V7UMQ1
gi|205351594|ref|YP_002225395.1| gi|161615576|ref|YP_001589541.1| 209261.t2602 220341.STY0284 272994.SPAB_03351 295319.SPA2506 321314.SC0259 41514.SARI_02739 423368.SNSL254_A0288 439843.SeSA_A0293 439851.SeD_A0286 454166.SeAg_B0307 454169.SeHA_C0301 550537.SEN0265 550538.SG0261 554290.SSPA2337 99287.STM0263 gi|538360836|ref|YP_008504121.1| gi|378448572|ref|YP_005235931.1| gi|525839287|ref|YP_008256562.1| gi|383495081|ref|YP_005395770.1| gi|378443709|ref|YP_005231341.1| gi|16763646|ref|NP_459261.1| gi|197247626|ref|YP_002145263.1| gi|549478360|ref|YP_008612107.1| gi|525856666|ref|YP_008259507.1| gi|197363545|ref|YP_002143182.1| gi|162139612|ref|YP_215246.2| gi|482905219|ref|YP_007903779.1| gi|29142976|ref|NP_806318.1| gi|525827706|ref|YP_008250400.1| gi|378987662|ref|YP_005250826.1| gi|525816130|ref|YP_008246148.1| gi|378960778|ref|YP_005218264.1| gi|161504624|ref|YP_001571736.1| gi|529220624|ref|YP_008381960.1| gi|16759249|ref|NP_454866.1| NP_454866.1.84458 NP_459261.1.58477 WP_000917872.1.100002 WP_000917872.1.100007 WP_000917872.1.100008 WP_000917872.1.100010 WP_000917872.1.100017 WP_000917872.1.100031 WP_000917872.1.100036 WP_000917872.1.100077 WP_000917872.1.100079 WP_000917872.1.100115 WP_000917872.1.100129 WP_000917872.1.10013 WP_000917872.1.100137 WP_000917872.1.100149 WP_000917872.1.100165 WP_000917872.1.100191 WP_000917872.1.100196 WP_000917872.1.1002 WP_000917872.1.100234 WP_000917872.1.100258 WP_000917872.1.100266 WP_000917872.1.100284 WP_000917872.1.100288 WP_000917872.1.100313 WP_000917872.1.100314 WP_000917872.1.100321 WP_000917872.1.100354 WP_000917872.1.100376 WP_000917872.1.100392 WP_000917872.1.100412 WP_000917872.1.100421 WP_000917872.1.100424 WP_000917872.1.100432 WP_000917872.1.100436 WP_000917872.1.100438 WP_000917872.1.100446 WP_000917872.1.100450 WP_000917872.1.100457 WP_000917872.1.100472 WP_000917872.1.100484 WP_000917872.1.100488 WP_000917872.1.100502 WP_000917872.1.100519 WP_000917872.1.100521 WP_000917872.1.100541 WP_000917872.1.100557 WP_000917872.1.100584 WP_000917872.1.100589 WP_000917872.1.100592 WP_000917872.1.100597 WP_000917872.1.100605 WP_000917872.1.100610 WP_000917872.1.100642 WP_000917872.1.10065 WP_000917872.1.100650 WP_000917872.1.100707 WP_000917872.1.100711 WP_000917872.1.100714 WP_000917872.1.100721 WP_000917872.1.100732 WP_000917872.1.100733 WP_000917872.1.100739 WP_000917872.1.10074 WP_000917872.1.100750 WP_000917872.1.10076 WP_000917872.1.100764 WP_000917872.1.100773 WP_000917872.1.100776 WP_000917872.1.100781 WP_000917872.1.100790 WP_000917872.1.100793 WP_000917872.1.100799 WP_000917872.1.10081 WP_000917872.1.100814 WP_000917872.1.100857 WP_000917872.1.100865 WP_000917872.1.100869 WP_000917872.1.100870 WP_000917872.1.100871 WP_000917872.1.100882 WP_000917872.1.100895 WP_000917872.1.100932 WP_000917872.1.100941 WP_000917872.1.100944 WP_000917872.1.100948 WP_000917872.1.100953 WP_000917872.1.100979 WP_000917872.1.101007 WP_000917872.1.101011 WP_000917872.1.101020 WP_000917872.1.101042 WP_000917872.1.101074 WP_000917872.1.101078 WP_000917872.1.10108 WP_000917872.1.101091 WP_000917872.1.101094 WP_000917872.1.101111 WP_000917872.1.101112 WP_000917872.1.101123 WP_000917872.1.101147 WP_000917872.1.101180 WP_000917872.1.101185 WP_000917872.1.101199 WP_000917872.1.101223 WP_000917872.1.101226 WP_000917872.1.101239 WP_000917872.1.10124 WP_000917872.1.101259 WP_000917872.1.101271 WP_000917872.1.101284 WP_000917872.1.101291 WP_000917872.1.1013 WP_000917872.1.101312 WP_000917872.1.101320 WP_000917872.1.101322 WP_000917872.1.101353 WP_000917872.1.101363 WP_000917872.1.101374 WP_000917872.1.101386 WP_000917872.1.101404 WP_000917872.1.101420 WP_000917872.1.101425 WP_000917872.1.101473 WP_000917872.1.101519 WP_000917872.1.101520 WP_000917872.1.101541 WP_000917872.1.101589 WP_000917872.1.101609 WP_000917872.1.101612 WP_000917872.1.101616 WP_000917872.1.101634 WP_000917872.1.101639 WP_000917872.1.10164 WP_000917872.1.101666 WP_000917872.1.101674 WP_000917872.1.101707 WP_000917872.1.101724 WP_000917872.1.101734 WP_000917872.1.101740 WP_000917872.1.101744 WP_000917872.1.101759 WP_000917872.1.10177 WP_000917872.1.101776 WP_000917872.1.101815 WP_000917872.1.101832 WP_000917872.1.101839 WP_000917872.1.101841 WP_000917872.1.101868 WP_000917872.1.101878 WP_000917872.1.101890 WP_000917872.1.101904 WP_000917872.1.10191 WP_000917872.1.101917 WP_000917872.1.101927 WP_000917872.1.101941 WP_000917872.1.101949 WP_000917872.1.101953 WP_000917872.1.102009 WP_000917872.1.102050 WP_000917872.1.102087 WP_000917872.1.102103 WP_000917872.1.102111 WP_000917872.1.10220 WP_000917872.1.10231 WP_000917872.1.10237 WP_000917872.1.10266 WP_000917872.1.10276 WP_000917872.1.10293 WP_000917872.1.10300 WP_000917872.1.10310 WP_000917872.1.10338 WP_000917872.1.1038 WP_000917872.1.10394 WP_000917872.1.104 WP_000917872.1.10401 WP_000917872.1.10428 WP_000917872.1.10429 WP_000917872.1.10439 WP_000917872.1.10459 WP_000917872.1.10463 WP_000917872.1.10465 WP_000917872.1.10475 WP_000917872.1.10498 WP_000917872.1.10507 WP_000917872.1.10511 WP_000917872.1.10514 WP_000917872.1.10521 WP_000917872.1.10530 WP_000917872.1.10532 WP_000917872.1.10547 WP_000917872.1.10562 WP_000917872.1.10566 WP_000917872.1.10568 WP_000917872.1.10595 WP_000917872.1.106 WP_000917872.1.10631 WP_000917872.1.10642 WP_000917872.1.10654 WP_000917872.1.10675 WP_000917872.1.10677 WP_000917872.1.10678 WP_000917872.1.10720 WP_000917872.1.10753 WP_000917872.1.10755 WP_000917872.1.10797 WP_000917872.1.10857 WP_000917872.1.10868 WP_000917872.1.10873 WP_000917872.1.10898 WP_000917872.1.10926 WP_000917872.1.10936 WP_000917872.1.10992 WP_000917872.1.11000 WP_000917872.1.11012 WP_000917872.1.11024 WP_000917872.1.11031 WP_000917872.1.11041 WP_000917872.1.11055 WP_000917872.1.11098 WP_000917872.1.1110 WP_000917872.1.11119 WP_000917872.1.11126 WP_000917872.1.11142 WP_000917872.1.11156 WP_000917872.1.11168 WP_000917872.1.11190 WP_000917872.1.11213 WP_000917872.1.11216 WP_000917872.1.11239 WP_000917872.1.11253 WP_000917872.1.11295 WP_000917872.1.113 WP_000917872.1.11304 WP_000917872.1.11314 WP_000917872.1.1135 WP_000917872.1.11362 WP_000917872.1.11369 WP_000917872.1.1137 WP_000917872.1.11385 WP_000917872.1.11405 WP_000917872.1.1142 WP_000917872.1.11426 WP_000917872.1.11429 WP_000917872.1.11444 WP_000917872.1.11455 WP_000917872.1.11458 WP_000917872.1.11479 WP_000917872.1.1150 WP_000917872.1.11511 WP_000917872.1.11518 WP_000917872.1.11526 WP_000917872.1.11528 WP_000917872.1.11532 WP_000917872.1.11543 WP_000917872.1.11544 WP_000917872.1.11557 WP_000917872.1.1156 WP_000917872.1.11565 WP_000917872.1.11567 WP_000917872.1.11588 WP_000917872.1.11603 WP_000917872.1.11621 WP_000917872.1.11638 WP_000917872.1.11677 WP_000917872.1.11681 WP_000917872.1.11687 WP_000917872.1.1169 WP_000917872.1.11735 WP_000917872.1.1174 WP_000917872.1.11763 WP_000917872.1.11772 WP_000917872.1.11810 WP_000917872.1.11824 WP_000917872.1.11834 WP_000917872.1.11841 WP_000917872.1.11865 WP_000917872.1.11868 WP_000917872.1.11883 WP_000917872.1.11897 WP_000917872.1.11900 WP_000917872.1.11908 WP_000917872.1.11914 WP_000917872.1.11936 WP_000917872.1.11938 WP_000917872.1.11978 WP_000917872.1.12007 WP_000917872.1.12017 WP_000917872.1.12025 WP_000917872.1.12027 WP_000917872.1.1204 WP_000917872.1.12040 WP_000917872.1.12047 WP_000917872.1.12059 WP_000917872.1.12061 WP_000917872.1.12063 WP_000917872.1.1207 WP_000917872.1.12106 WP_000917872.1.12114 WP_000917872.1.12141 WP_000917872.1.12144 WP_000917872.1.1215 WP_000917872.1.12159 WP_000917872.1.12160 WP_000917872.1.12168 WP_000917872.1.12172 WP_000917872.1.12192 WP_000917872.1.12210 WP_000917872.1.1224 WP_000917872.1.12244 WP_000917872.1.12282 WP_000917872.1.12308 WP_000917872.1.12340 WP_000917872.1.12351 WP_000917872.1.12364 WP_000917872.1.12370 WP_000917872.1.12374 WP_000917872.1.1239 WP_000917872.1.12396 WP_000917872.1.12398 WP_000917872.1.12441 WP_000917872.1.1246 WP_000917872.1.12472 WP_000917872.1.12484 WP_000917872.1.12485 WP_000917872.1.1250 WP_000917872.1.12517 WP_000917872.1.12546 WP_000917872.1.12568 WP_000917872.1.12569 WP_000917872.1.12581 WP_000917872.1.12584 WP_000917872.1.12585 WP_000917872.1.12620 WP_000917872.1.1264 WP_000917872.1.12648 WP_000917872.1.12650 WP_000917872.1.12683 WP_000917872.1.12696 WP_000917872.1.12718 WP_000917872.1.12726 WP_000917872.1.12727 WP_000917872.1.12728 WP_000917872.1.12741 WP_000917872.1.12834 WP_000917872.1.12864 WP_000917872.1.12865 WP_000917872.1.12877 WP_000917872.1.12879 WP_000917872.1.12936 WP_000917872.1.1299 WP_000917872.1.12995 WP_000917872.1.1300 WP_000917872.1.13027 WP_000917872.1.13076 WP_000917872.1.13101 WP_000917872.1.13102 WP_000917872.1.13106 WP_000917872.1.13108 WP_000917872.1.13130 WP_000917872.1.13161 WP_000917872.1.13207 WP_000917872.1.1321 WP_000917872.1.13247 WP_000917872.1.1326 WP_000917872.1.13262 WP_000917872.1.13268 WP_000917872.1.13274 WP_000917872.1.13291 WP_000917872.1.133 WP_000917872.1.13311 WP_000917872.1.13314 WP_000917872.1.13334 WP_000917872.1.13338 WP_000917872.1.13342 WP_000917872.1.13352 WP_000917872.1.13367 WP_000917872.1.13391 WP_000917872.1.13406 WP_000917872.1.13414 WP_000917872.1.13429 WP_000917872.1.13440 WP_000917872.1.13443 WP_000917872.1.13446 WP_000917872.1.1346 WP_000917872.1.13465 WP_000917872.1.13476 WP_000917872.1.13488 WP_000917872.1.13509 WP_000917872.1.13528 WP_000917872.1.13543 WP_000917872.1.13573 WP_000917872.1.13599 WP_000917872.1.13602 WP_000917872.1.13625 WP_000917872.1.13661 WP_000917872.1.13669 WP_000917872.1.13677 WP_000917872.1.13686 WP_000917872.1.13691 WP_000917872.1.1372 WP_000917872.1.13732 WP_000917872.1.13741 WP_000917872.1.13750 WP_000917872.1.13764 WP_000917872.1.13799 WP_000917872.1.13819 WP_000917872.1.1382 WP_000917872.1.13827 WP_000917872.1.13829 WP_000917872.1.13848 WP_000917872.1.13857 WP_000917872.1.1387 WP_000917872.1.13908 WP_000917872.1.13932 WP_000917872.1.13967 WP_000917872.1.13968 WP_000917872.1.1397 WP_000917872.1.13972 WP_000917872.1.140 WP_000917872.1.14001 WP_000917872.1.1401 WP_000917872.1.14011 WP_000917872.1.14041 WP_000917872.1.1408 WP_000917872.1.14089 WP_000917872.1.14099 WP_000917872.1.14111 WP_000917872.1.1412 WP_000917872.1.14120 WP_000917872.1.14123 WP_000917872.1.14150 WP_000917872.1.14151 WP_000917872.1.14191 WP_000917872.1.14197 WP_000917872.1.14212 WP_000917872.1.14239 WP_000917872.1.14280 WP_000917872.1.14286 WP_000917872.1.14296 WP_000917872.1.14320 WP_000917872.1.14333 WP_000917872.1.14369 WP_000917872.1.14379 WP_000917872.1.14399 WP_000917872.1.1440 WP_000917872.1.14406 WP_000917872.1.14410 WP_000917872.1.14436 WP_000917872.1.14444 WP_000917872.1.14446 WP_000917872.1.14458 WP_000917872.1.14466 WP_000917872.1.14467 WP_000917872.1.14474 WP_000917872.1.14495 WP_000917872.1.14500 WP_000917872.1.14505 WP_000917872.1.14516 WP_000917872.1.14519 WP_000917872.1.14524 WP_000917872.1.14526 WP_000917872.1.14528 WP_000917872.1.14550 WP_000917872.1.14554 WP_000917872.1.14575 WP_000917872.1.146 WP_000917872.1.14618 WP_000917872.1.14688 WP_000917872.1.14701 WP_000917872.1.14703 WP_000917872.1.14706 WP_000917872.1.14708 WP_000917872.1.14719 WP_000917872.1.14725 WP_000917872.1.1473 WP_000917872.1.14737 WP_000917872.1.14765 WP_000917872.1.14793 WP_000917872.1.14808 WP_000917872.1.14810 WP_000917872.1.14819 WP_000917872.1.14852 WP_000917872.1.14876 WP_000917872.1.14877 WP_000917872.1.14884 WP_000917872.1.1489 WP_000917872.1.14894 WP_000917872.1.14913 WP_000917872.1.14917 WP_000917872.1.14927 WP_000917872.1.14930 WP_000917872.1.14932 WP_000917872.1.14936 WP_000917872.1.14947 WP_000917872.1.14948 WP_000917872.1.14964 WP_000917872.1.15011 WP_000917872.1.15046 WP_000917872.1.15054 WP_000917872.1.15055 WP_000917872.1.15059 WP_000917872.1.15067 WP_000917872.1.15079 WP_000917872.1.15100 WP_000917872.1.15124 WP_000917872.1.15184 WP_000917872.1.15214 WP_000917872.1.15223 WP_000917872.1.15226 WP_000917872.1.15244 WP_000917872.1.15265 WP_000917872.1.15276 WP_000917872.1.15316 WP_000917872.1.15318 WP_000917872.1.15353 WP_000917872.1.15362 WP_000917872.1.15369 WP_000917872.1.1540 WP_000917872.1.15415 WP_000917872.1.15423 WP_000917872.1.15433 WP_000917872.1.15439 WP_000917872.1.15468 WP_000917872.1.15479 WP_000917872.1.15483 WP_000917872.1.15487 WP_000917872.1.15508 WP_000917872.1.1551 WP_000917872.1.15535 WP_000917872.1.15581 WP_000917872.1.15585 WP_000917872.1.15586 WP_000917872.1.15597 WP_000917872.1.15612 WP_000917872.1.15616 WP_000917872.1.15625 WP_000917872.1.15644 WP_000917872.1.1568 WP_000917872.1.15708 WP_000917872.1.15710 WP_000917872.1.15717 WP_000917872.1.15775 WP_000917872.1.15777 WP_000917872.1.15784 WP_000917872.1.15795 WP_000917872.1.158 WP_000917872.1.15830 WP_000917872.1.15835 WP_000917872.1.15862 WP_000917872.1.15881 WP_000917872.1.15905 WP_000917872.1.15909 WP_000917872.1.15910 WP_000917872.1.15912 WP_000917872.1.1592 WP_000917872.1.15922 WP_000917872.1.15938 WP_000917872.1.15970 WP_000917872.1.15978 WP_000917872.1.15986 WP_000917872.1.15995 WP_000917872.1.16000 WP_000917872.1.16004 WP_000917872.1.16006 WP_000917872.1.1601 WP_000917872.1.16028 WP_000917872.1.16032 WP_000917872.1.16046 WP_000917872.1.16047 WP_000917872.1.16051 WP_000917872.1.16052 WP_000917872.1.16058 WP_000917872.1.16062 WP_000917872.1.16063 WP_000917872.1.16103 WP_000917872.1.1611 WP_000917872.1.16125 WP_000917872.1.16150 WP_000917872.1.16155 WP_000917872.1.16158 WP_000917872.1.16166 WP_000917872.1.16201 WP_000917872.1.16226 WP_000917872.1.16233 WP_000917872.1.16244 WP_000917872.1.1626 WP_000917872.1.16264 WP_000917872.1.16273 WP_000917872.1.16284 WP_000917872.1.16328 WP_000917872.1.16331 WP_000917872.1.16344 WP_000917872.1.1635 WP_000917872.1.16361 WP_000917872.1.16363 WP_000917872.1.16365 WP_000917872.1.16366 WP_000917872.1.16394 WP_000917872.1.16452 WP_000917872.1.16453 WP_000917872.1.16461 WP_000917872.1.16462 WP_000917872.1.16465 WP_000917872.1.16468 WP_000917872.1.16474 WP_000917872.1.16508 WP_000917872.1.16522 WP_000917872.1.16525 WP_000917872.1.16565 WP_000917872.1.16581 WP_000917872.1.16588 WP_000917872.1.16614 WP_000917872.1.16650 WP_000917872.1.16656 WP_000917872.1.16658 WP_000917872.1.16666 WP_000917872.1.16673 WP_000917872.1.1668 WP_000917872.1.16686 WP_000917872.1.16691 WP_000917872.1.167 WP_000917872.1.16710 WP_000917872.1.16729 WP_000917872.1.16732 WP_000917872.1.16735 WP_000917872.1.16736 WP_000917872.1.1674 WP_000917872.1.16767 WP_000917872.1.16781 WP_000917872.1.16786 WP_000917872.1.16804 WP_000917872.1.16817 WP_000917872.1.16819 WP_000917872.1.16826 WP_000917872.1.16846 WP_000917872.1.16855 WP_000917872.1.16858 WP_000917872.1.16873 WP_000917872.1.16879 WP_000917872.1.1689 WP_000917872.1.16893 WP_000917872.1.16896 WP_000917872.1.16903 WP_000917872.1.16905 WP_000917872.1.16910 WP_000917872.1.16916 WP_000917872.1.16941 WP_000917872.1.16942 WP_000917872.1.16944 WP_000917872.1.16948 WP_000917872.1.16949 WP_000917872.1.16965 WP_000917872.1.16972 WP_000917872.1.16998 WP_000917872.1.1700 WP_000917872.1.17031 WP_000917872.1.17049 WP_000917872.1.17058 WP_000917872.1.17060 WP_000917872.1.17078 WP_000917872.1.17093 WP_000917872.1.17096 WP_000917872.1.17098 WP_000917872.1.17105 WP_000917872.1.17188 WP_000917872.1.17202 WP_000917872.1.17219 WP_000917872.1.1722 WP_000917872.1.17270 WP_000917872.1.17285 WP_000917872.1.17302 WP_000917872.1.17307 WP_000917872.1.17308 WP_000917872.1.1733 WP_000917872.1.17368 WP_000917872.1.1737 WP_000917872.1.17390 WP_000917872.1.174 WP_000917872.1.17405 WP_000917872.1.17406 WP_000917872.1.17439 WP_000917872.1.17447 WP_000917872.1.17480 WP_000917872.1.17482 WP_000917872.1.1749 WP_000917872.1.17504 WP_000917872.1.17513 WP_000917872.1.17525 WP_000917872.1.17543 WP_000917872.1.17546 WP_000917872.1.17560 WP_000917872.1.17563 WP_000917872.1.17578 WP_000917872.1.17583 WP_000917872.1.17622 WP_000917872.1.17629 WP_000917872.1.17659 WP_000917872.1.17667 WP_000917872.1.17686 WP_000917872.1.17702 WP_000917872.1.17703 WP_000917872.1.17705 WP_000917872.1.17732 WP_000917872.1.17741 WP_000917872.1.17743 WP_000917872.1.17747 WP_000917872.1.17755 WP_000917872.1.17758 WP_000917872.1.17840 WP_000917872.1.17865 WP_000917872.1.17886 WP_000917872.1.17891 WP_000917872.1.17901 WP_000917872.1.17914 WP_000917872.1.17919 WP_000917872.1.17936 WP_000917872.1.17949 WP_000917872.1.17956 WP_000917872.1.1798 WP_000917872.1.17991 WP_000917872.1.18005 WP_000917872.1.1801 WP_000917872.1.18019 WP_000917872.1.18021 WP_000917872.1.18022 WP_000917872.1.18056 WP_000917872.1.18061 WP_000917872.1.1807 WP_000917872.1.18089 WP_000917872.1.18092 WP_000917872.1.18099 WP_000917872.1.18103 WP_000917872.1.18109 WP_000917872.1.18111 WP_000917872.1.18122 WP_000917872.1.18124 WP_000917872.1.1814 WP_000917872.1.18144 WP_000917872.1.18149 WP_000917872.1.18163 WP_000917872.1.18173 WP_000917872.1.18177 WP_000917872.1.18178 WP_000917872.1.1818 WP_000917872.1.18192 WP_000917872.1.18249 WP_000917872.1.18254 WP_000917872.1.18265 WP_000917872.1.18267 WP_000917872.1.18270 WP_000917872.1.18277 WP_000917872.1.18280 WP_000917872.1.18281 WP_000917872.1.18282 WP_000917872.1.1832 WP_000917872.1.18328 WP_000917872.1.18355 WP_000917872.1.18358 WP_000917872.1.18365 WP_000917872.1.18370 WP_000917872.1.18384 WP_000917872.1.18406 WP_000917872.1.18426 WP_000917872.1.18441 WP_000917872.1.18445 WP_000917872.1.18468 WP_000917872.1.18474 WP_000917872.1.18485 WP_000917872.1.18489 WP_000917872.1.18513 WP_000917872.1.18607 WP_000917872.1.18610 WP_000917872.1.18641 WP_000917872.1.18678 WP_000917872.1.18686 WP_000917872.1.18692 WP_000917872.1.18705 WP_000917872.1.18715 WP_000917872.1.18722 WP_000917872.1.18737 WP_000917872.1.18766 WP_000917872.1.18776 WP_000917872.1.18796 WP_000917872.1.1880 WP_000917872.1.18822 WP_000917872.1.18847 WP_000917872.1.1885 WP_000917872.1.18860 WP_000917872.1.18881 WP_000917872.1.18886 WP_000917872.1.18895 WP_000917872.1.18919 WP_000917872.1.18922 WP_000917872.1.18940 WP_000917872.1.18949 WP_000917872.1.1895 WP_000917872.1.18959 WP_000917872.1.1897 WP_000917872.1.18972 WP_000917872.1.19001 WP_000917872.1.19006 WP_000917872.1.19030 WP_000917872.1.19038 WP_000917872.1.19044 WP_000917872.1.19053 WP_000917872.1.19055 WP_000917872.1.19064 WP_000917872.1.19084 WP_000917872.1.19093 WP_000917872.1.19163 WP_000917872.1.19174 WP_000917872.1.19187 WP_000917872.1.19228 WP_000917872.1.19240 WP_000917872.1.19273 WP_000917872.1.19288 WP_000917872.1.19291 WP_000917872.1.19300 WP_000917872.1.19320 WP_000917872.1.19340 WP_000917872.1.19357 WP_000917872.1.19373 WP_000917872.1.1939 WP_000917872.1.19405 WP_000917872.1.19422 WP_000917872.1.19433 WP_000917872.1.19454 WP_000917872.1.19456 WP_000917872.1.19458 WP_000917872.1.19460 WP_000917872.1.19461 WP_000917872.1.19469 WP_000917872.1.19496 WP_000917872.1.19535 WP_000917872.1.19538 WP_000917872.1.1954 WP_000917872.1.1955 WP_000917872.1.19588 WP_000917872.1.19589 WP_000917872.1.19614 WP_000917872.1.19616 WP_000917872.1.19642 WP_000917872.1.19656 WP_000917872.1.19660 WP_000917872.1.19663 WP_000917872.1.19683 WP_000917872.1.19686 WP_000917872.1.19702 WP_000917872.1.19706 WP_000917872.1.19723 WP_000917872.1.19724 WP_000917872.1.19731 WP_000917872.1.19749 WP_000917872.1.19784 WP_000917872.1.19793 WP_000917872.1.19794 WP_000917872.1.19802 WP_000917872.1.19809 WP_000917872.1.19823 WP_000917872.1.19834 WP_000917872.1.19851 WP_000917872.1.19863 WP_000917872.1.19867 WP_000917872.1.19882 WP_000917872.1.19884 WP_000917872.1.1990 WP_000917872.1.1992 WP_000917872.1.19938 WP_000917872.1.19967 WP_000917872.1.19970 WP_000917872.1.19975 WP_000917872.1.1998 WP_000917872.1.19987 WP_000917872.1.19999 WP_000917872.1.20 WP_000917872.1.20023 WP_000917872.1.20034 WP_000917872.1.20081 WP_000917872.1.20086 WP_000917872.1.20089 WP_000917872.1.20091 WP_000917872.1.2010 WP_000917872.1.20119 WP_000917872.1.20212 WP_000917872.1.20218 WP_000917872.1.20254 WP_000917872.1.20255 WP_000917872.1.2026 WP_000917872.1.20261 WP_000917872.1.20266 WP_000917872.1.20271 WP_000917872.1.20296 WP_000917872.1.20330 WP_000917872.1.20339 WP_000917872.1.20349 WP_000917872.1.2036 WP_000917872.1.20362 WP_000917872.1.20364 WP_000917872.1.20376 WP_000917872.1.20391 WP_000917872.1.2041 WP_000917872.1.20418 WP_000917872.1.20419 WP_000917872.1.20425 WP_000917872.1.20437 WP_000917872.1.20438 WP_000917872.1.20443 WP_000917872.1.20446 WP_000917872.1.20465 WP_000917872.1.2047 WP_000917872.1.20492 WP_000917872.1.20525 WP_000917872.1.2053 WP_000917872.1.2054 WP_000917872.1.20553 WP_000917872.1.20564 WP_000917872.1.20573 WP_000917872.1.20614 WP_000917872.1.20626 WP_000917872.1.20631 WP_000917872.1.20635 WP_000917872.1.20646 WP_000917872.1.20695 WP_000917872.1.20700 WP_000917872.1.20718 WP_000917872.1.20721 WP_000917872.1.2073 WP_000917872.1.20740 WP_000917872.1.20760 WP_000917872.1.20767 WP_000917872.1.20787 WP_000917872.1.20789 WP_000917872.1.20795 WP_000917872.1.20810 WP_000917872.1.20828 WP_000917872.1.20839 WP_000917872.1.2087 WP_000917872.1.20883 WP_000917872.1.20886 WP_000917872.1.20894 WP_000917872.1.20908 WP_000917872.1.20947 WP_000917872.1.20953 WP_000917872.1.2101 WP_000917872.1.21010 WP_000917872.1.21049 WP_000917872.1.2106 WP_000917872.1.21062 WP_000917872.1.2107 WP_000917872.1.21075 WP_000917872.1.21079 WP_000917872.1.21086 WP_000917872.1.21089 WP_000917872.1.21103 WP_000917872.1.21136 WP_000917872.1.21144 WP_000917872.1.21146 WP_000917872.1.2116 WP_000917872.1.21162 WP_000917872.1.21165 WP_000917872.1.21181 WP_000917872.1.21184 WP_000917872.1.21185 WP_000917872.1.21194 WP_000917872.1.21202 WP_000917872.1.21241 WP_000917872.1.21245 WP_000917872.1.21246 WP_000917872.1.21260 WP_000917872.1.21269 WP_000917872.1.21286 WP_000917872.1.2130 WP_000917872.1.21309 WP_000917872.1.21326 WP_000917872.1.21332 WP_000917872.1.21351 WP_000917872.1.21362 WP_000917872.1.21366 WP_000917872.1.2139 WP_000917872.1.21399 WP_000917872.1.21400 WP_000917872.1.21404 WP_000917872.1.21423 WP_000917872.1.21443 WP_000917872.1.21453 WP_000917872.1.21473 WP_000917872.1.21492 WP_000917872.1.21497 WP_000917872.1.21499 WP_000917872.1.21534 WP_000917872.1.21548 WP_000917872.1.2155 WP_000917872.1.21603 WP_000917872.1.21616 WP_000917872.1.2166 WP_000917872.1.21674 WP_000917872.1.21681 WP_000917872.1.21692 WP_000917872.1.21715 WP_000917872.1.21728 WP_000917872.1.21730 WP_000917872.1.21750 WP_000917872.1.21751 WP_000917872.1.21757 WP_000917872.1.21792 WP_000917872.1.21845 WP_000917872.1.21877 WP_000917872.1.21886 WP_000917872.1.21909 WP_000917872.1.21910 WP_000917872.1.21940 WP_000917872.1.21946 WP_000917872.1.21950 WP_000917872.1.21966 WP_000917872.1.21981 WP_000917872.1.21991 WP_000917872.1.22019 WP_000917872.1.22024 WP_000917872.1.22026 WP_000917872.1.22030 WP_000917872.1.2205 WP_000917872.1.22051 WP_000917872.1.22062 WP_000917872.1.22064 WP_000917872.1.22067 WP_000917872.1.22069 WP_000917872.1.22096 WP_000917872.1.22117 WP_000917872.1.22118 WP_000917872.1.22126 WP_000917872.1.22136 WP_000917872.1.22158 WP_000917872.1.2216 WP_000917872.1.22162 WP_000917872.1.22169 WP_000917872.1.22205 WP_000917872.1.22208 WP_000917872.1.2221 WP_000917872.1.22235 WP_000917872.1.2224 WP_000917872.1.2227 WP_000917872.1.22270 WP_000917872.1.22296 WP_000917872.1.22315 WP_000917872.1.22323 WP_000917872.1.22337 WP_000917872.1.22346 WP_000917872.1.2235 WP_000917872.1.22373 WP_000917872.1.22379 WP_000917872.1.22388 WP_000917872.1.22427 WP_000917872.1.22449 WP_000917872.1.22451 WP_000917872.1.22453 WP_000917872.1.22454 WP_000917872.1.2246 WP_000917872.1.22460 WP_000917872.1.22476 WP_000917872.1.22485 WP_000917872.1.22514 WP_000917872.1.22537 WP_000917872.1.22565 WP_000917872.1.22566 WP_000917872.1.22575 WP_000917872.1.22582 WP_000917872.1.22590 WP_000917872.1.22595 WP_000917872.1.22604 WP_000917872.1.22605 WP_000917872.1.22614 WP_000917872.1.22620 WP_000917872.1.22623 WP_000917872.1.22652 WP_000917872.1.22676 WP_000917872.1.22683 WP_000917872.1.22692 WP_000917872.1.22758 WP_000917872.1.22760 WP_000917872.1.2283 WP_000917872.1.2284 WP_000917872.1.22845 WP_000917872.1.22855 WP_000917872.1.22857 WP_000917872.1.22864 WP_000917872.1.22870 WP_000917872.1.22880 WP_000917872.1.22895 WP_000917872.1.22902 WP_000917872.1.22926 WP_000917872.1.22943 WP_000917872.1.22947 WP_000917872.1.22966 WP_000917872.1.22967 WP_000917872.1.22979 WP_000917872.1.23010 WP_000917872.1.23040 WP_000917872.1.23053 WP_000917872.1.23058 WP_000917872.1.23080 WP_000917872.1.23102 WP_000917872.1.23114 WP_000917872.1.2314 WP_000917872.1.23148 WP_000917872.1.23155 WP_000917872.1.23169 WP_000917872.1.23172 WP_000917872.1.23175 WP_000917872.1.23192 WP_000917872.1.23201 WP_000917872.1.23218 WP_000917872.1.2324 WP_000917872.1.23246 WP_000917872.1.23258 WP_000917872.1.23259 WP_000917872.1.23274 WP_000917872.1.23279 WP_000917872.1.23309 WP_000917872.1.2331 WP_000917872.1.23311 WP_000917872.1.2332 WP_000917872.1.23329 WP_000917872.1.23340 WP_000917872.1.23343 WP_000917872.1.2336 WP_000917872.1.23365 WP_000917872.1.23379 WP_000917872.1.23409 WP_000917872.1.23412 WP_000917872.1.2342 WP_000917872.1.23426 WP_000917872.1.23442 WP_000917872.1.23460 WP_000917872.1.23466 WP_000917872.1.23472 WP_000917872.1.23482 WP_000917872.1.23485 WP_000917872.1.23492 WP_000917872.1.235 WP_000917872.1.23500 WP_000917872.1.23503 WP_000917872.1.23509 WP_000917872.1.23515 WP_000917872.1.23529 WP_000917872.1.23548 WP_000917872.1.23571 WP_000917872.1.2358 WP_000917872.1.23587 WP_000917872.1.23604 WP_000917872.1.23621 WP_000917872.1.23629 WP_000917872.1.23631 WP_000917872.1.23634 WP_000917872.1.23639 WP_000917872.1.2364 WP_000917872.1.23643 WP_000917872.1.23670 WP_000917872.1.23675 WP_000917872.1.23679 WP_000917872.1.23685 WP_000917872.1.237 WP_000917872.1.23707 WP_000917872.1.23720 WP_000917872.1.23728 WP_000917872.1.23736 WP_000917872.1.23746 WP_000917872.1.2375 WP_000917872.1.23755 WP_000917872.1.2376 WP_000917872.1.23783 WP_000917872.1.23786 WP_000917872.1.23787 WP_000917872.1.2380 WP_000917872.1.23801 WP_000917872.1.23819 WP_000917872.1.23932 WP_000917872.1.23959 WP_000917872.1.24017 WP_000917872.1.24028 WP_000917872.1.24061 WP_000917872.1.24082 WP_000917872.1.24083 WP_000917872.1.24117 WP_000917872.1.24125 WP_000917872.1.24138 WP_000917872.1.24145 WP_000917872.1.2415 WP_000917872.1.24153 WP_000917872.1.24158 WP_000917872.1.24163 WP_000917872.1.24206 WP_000917872.1.24214 WP_000917872.1.24250 WP_000917872.1.24259 WP_000917872.1.24291 WP_000917872.1.24297 WP_000917872.1.24303 WP_000917872.1.24308 WP_000917872.1.24322 WP_000917872.1.24325 WP_000917872.1.24355 WP_000917872.1.24361 WP_000917872.1.24375 WP_000917872.1.24376 WP_000917872.1.24392 WP_000917872.1.24394 WP_000917872.1.24400 WP_000917872.1.24408 WP_000917872.1.24409 WP_000917872.1.24412 WP_000917872.1.24419 WP_000917872.1.24420 WP_000917872.1.24433 WP_000917872.1.24444 WP_000917872.1.24450 WP_000917872.1.24476 WP_000917872.1.24494 WP_000917872.1.24521 WP_000917872.1.24555 WP_000917872.1.24567 WP_000917872.1.24578 WP_000917872.1.24619 WP_000917872.1.24643 WP_000917872.1.2467 WP_000917872.1.24673 WP_000917872.1.24686 WP_000917872.1.24688 WP_000917872.1.24689 WP_000917872.1.24696 WP_000917872.1.24716 WP_000917872.1.24723 WP_000917872.1.24727 WP_000917872.1.24737 WP_000917872.1.24779 WP_000917872.1.24803 WP_000917872.1.2481 WP_000917872.1.24832 WP_000917872.1.24837 WP_000917872.1.24839 WP_000917872.1.24873 WP_000917872.1.24901 WP_000917872.1.24944 WP_000917872.1.24964 WP_000917872.1.24995 WP_000917872.1.25008 WP_000917872.1.25015 WP_000917872.1.25017 WP_000917872.1.25032 WP_000917872.1.25036 WP_000917872.1.25041 WP_000917872.1.25053 WP_000917872.1.25064 WP_000917872.1.25072 WP_000917872.1.25119 WP_000917872.1.25130 WP_000917872.1.25140 WP_000917872.1.25159 WP_000917872.1.25175 WP_000917872.1.25185 WP_000917872.1.25196 WP_000917872.1.25205 WP_000917872.1.25206 WP_000917872.1.25210 WP_000917872.1.25217 WP_000917872.1.25219 WP_000917872.1.25229 WP_000917872.1.2525 WP_000917872.1.25297 WP_000917872.1.25304 WP_000917872.1.25354 WP_000917872.1.25374 WP_000917872.1.25397 WP_000917872.1.25405 WP_000917872.1.25421 WP_000917872.1.25426 WP_000917872.1.25454 WP_000917872.1.25475 WP_000917872.1.25490 WP_000917872.1.25493 WP_000917872.1.25498 WP_000917872.1.25508 WP_000917872.1.25512 WP_000917872.1.25514 WP_000917872.1.2554 WP_000917872.1.25546 WP_000917872.1.25564 WP_000917872.1.25596 WP_000917872.1.25603 WP_000917872.1.25618 WP_000917872.1.2562 WP_000917872.1.25666 WP_000917872.1.25668 WP_000917872.1.2568 WP_000917872.1.25690 WP_000917872.1.25692 WP_000917872.1.2570 WP_000917872.1.25700 WP_000917872.1.25703 WP_000917872.1.25708 WP_000917872.1.25709 WP_000917872.1.25722 WP_000917872.1.25740 WP_000917872.1.25780 WP_000917872.1.25793 WP_000917872.1.25807 WP_000917872.1.25809 WP_000917872.1.2581 WP_000917872.1.25814 WP_000917872.1.25821 WP_000917872.1.25825 WP_000917872.1.25833 WP_000917872.1.25835 WP_000917872.1.25846 WP_000917872.1.25882 WP_000917872.1.25911 WP_000917872.1.25932 WP_000917872.1.25951 WP_000917872.1.25962 WP_000917872.1.25963 WP_000917872.1.25988 WP_000917872.1.26001 WP_000917872.1.26027 WP_000917872.1.26030 WP_000917872.1.26034 WP_000917872.1.26075 WP_000917872.1.26083 WP_000917872.1.26093 WP_000917872.1.26107 WP_000917872.1.26122 WP_000917872.1.26123 WP_000917872.1.26129 WP_000917872.1.2615 WP_000917872.1.26194 WP_000917872.1.26199 WP_000917872.1.26213 WP_000917872.1.26217 WP_000917872.1.26224 WP_000917872.1.26230 WP_000917872.1.26232 WP_000917872.1.26269 WP_000917872.1.26272 WP_000917872.1.26282 WP_000917872.1.26286 WP_000917872.1.26288 WP_000917872.1.26311 WP_000917872.1.26319 WP_000917872.1.2634 WP_000917872.1.26363 WP_000917872.1.26384 WP_000917872.1.26394 WP_000917872.1.26414 WP_000917872.1.26426 WP_000917872.1.26429 WP_000917872.1.26440 WP_000917872.1.26441 WP_000917872.1.26491 WP_000917872.1.26493 WP_000917872.1.26512 WP_000917872.1.26532 WP_000917872.1.2654 WP_000917872.1.26551 WP_000917872.1.26554 WP_000917872.1.26563 WP_000917872.1.26567 WP_000917872.1.26576 WP_000917872.1.26582 WP_000917872.1.26587 WP_000917872.1.2660 WP_000917872.1.26636 WP_000917872.1.26646 WP_000917872.1.2667 WP_000917872.1.26687 WP_000917872.1.26689 WP_000917872.1.26709 WP_000917872.1.2672 WP_000917872.1.26741 WP_000917872.1.26750 WP_000917872.1.26787 WP_000917872.1.2679 WP_000917872.1.26794 WP_000917872.1.26833 WP_000917872.1.26883 WP_000917872.1.26892 WP_000917872.1.26908 WP_000917872.1.26919 WP_000917872.1.2692 WP_000917872.1.26924 WP_000917872.1.26928 WP_000917872.1.26936 WP_000917872.1.270 WP_000917872.1.27008 WP_000917872.1.27010 WP_000917872.1.27027 WP_000917872.1.27051 WP_000917872.1.27055 WP_000917872.1.27070 WP_000917872.1.27077 WP_000917872.1.27084 WP_000917872.1.27086 WP_000917872.1.27087 WP_000917872.1.27111 WP_000917872.1.27115 WP_000917872.1.27122 WP_000917872.1.27123 WP_000917872.1.2713 WP_000917872.1.27142 WP_000917872.1.27169 WP_000917872.1.2717 WP_000917872.1.27173 WP_000917872.1.272 WP_000917872.1.27206 WP_000917872.1.27223 WP_000917872.1.27228 WP_000917872.1.2723 WP_000917872.1.27272 WP_000917872.1.27279 WP_000917872.1.27282 WP_000917872.1.27285 WP_000917872.1.27309 WP_000917872.1.27314 WP_000917872.1.27329 WP_000917872.1.27342 WP_000917872.1.27361 WP_000917872.1.27383 WP_000917872.1.27419 WP_000917872.1.27423 WP_000917872.1.27452 WP_000917872.1.27513 WP_000917872.1.27522 WP_000917872.1.27535 WP_000917872.1.27544 WP_000917872.1.27547 WP_000917872.1.27556 WP_000917872.1.27561 WP_000917872.1.27565 WP_000917872.1.27595 WP_000917872.1.27598 WP_000917872.1.27616 WP_000917872.1.2763 WP_000917872.1.27632 WP_000917872.1.27638 WP_000917872.1.27655 WP_000917872.1.27658 WP_000917872.1.27665 WP_000917872.1.27679 WP_000917872.1.27706 WP_000917872.1.27707 WP_000917872.1.27713 WP_000917872.1.27755 WP_000917872.1.27761 WP_000917872.1.2777 WP_000917872.1.27775 WP_000917872.1.27776 WP_000917872.1.27785 WP_000917872.1.27798 WP_000917872.1.27800 WP_000917872.1.27815 WP_000917872.1.27833 WP_000917872.1.27857 WP_000917872.1.27883 WP_000917872.1.27900 WP_000917872.1.27928 WP_000917872.1.27945 WP_000917872.1.27969 WP_000917872.1.27977 WP_000917872.1.27995 WP_000917872.1.27997 WP_000917872.1.28002 WP_000917872.1.28004 WP_000917872.1.28032 WP_000917872.1.28037 WP_000917872.1.28056 WP_000917872.1.2806 WP_000917872.1.28073 WP_000917872.1.2809 WP_000917872.1.28094 WP_000917872.1.28116 WP_000917872.1.28126 WP_000917872.1.28139 WP_000917872.1.28155 WP_000917872.1.28170 WP_000917872.1.28174 WP_000917872.1.28198 WP_000917872.1.28200 WP_000917872.1.2822 WP_000917872.1.28225 WP_000917872.1.28229 WP_000917872.1.28232 WP_000917872.1.28233 WP_000917872.1.28235 WP_000917872.1.2825 WP_000917872.1.28267 WP_000917872.1.2829 WP_000917872.1.28302 WP_000917872.1.28303 WP_000917872.1.2835 WP_000917872.1.28370 WP_000917872.1.28384 WP_000917872.1.28386 WP_000917872.1.28393 WP_000917872.1.28395 WP_000917872.1.284 WP_000917872.1.2845 WP_000917872.1.28462 WP_000917872.1.28479 WP_000917872.1.28504 WP_000917872.1.28514 WP_000917872.1.2853 WP_000917872.1.28538 WP_000917872.1.28570 WP_000917872.1.28575 WP_000917872.1.28612 WP_000917872.1.28620 WP_000917872.1.28625 WP_000917872.1.28627 WP_000917872.1.28655 WP_000917872.1.28673 WP_000917872.1.28692 WP_000917872.1.28694 WP_000917872.1.287 WP_000917872.1.2873 WP_000917872.1.28733 WP_000917872.1.28773 WP_000917872.1.28775 WP_000917872.1.28776 WP_000917872.1.2879 WP_000917872.1.28811 WP_000917872.1.2890 WP_000917872.1.28902 WP_000917872.1.28917 WP_000917872.1.28921 WP_000917872.1.28938 WP_000917872.1.28946 WP_000917872.1.28962 WP_000917872.1.28963 WP_000917872.1.28977 WP_000917872.1.29006 WP_000917872.1.29010 WP_000917872.1.29023 WP_000917872.1.29042 WP_000917872.1.2905 WP_000917872.1.2907 WP_000917872.1.29081 WP_000917872.1.29089 WP_000917872.1.29099 WP_000917872.1.2910 WP_000917872.1.29113 WP_000917872.1.29130 WP_000917872.1.2915 WP_000917872.1.29153 WP_000917872.1.29168 WP_000917872.1.29174 WP_000917872.1.29190 WP_000917872.1.29203 WP_000917872.1.29218 WP_000917872.1.29237 WP_000917872.1.2924 WP_000917872.1.29248 WP_000917872.1.29255 WP_000917872.1.29265 WP_000917872.1.29274 WP_000917872.1.29288 WP_000917872.1.2932 WP_000917872.1.29379 WP_000917872.1.29389 WP_000917872.1.29422 WP_000917872.1.29436 WP_000917872.1.29439 WP_000917872.1.29454 WP_000917872.1.2946 WP_000917872.1.29462 WP_000917872.1.29509 WP_000917872.1.29530 WP_000917872.1.29563 WP_000917872.1.29576 WP_000917872.1.29588 WP_000917872.1.29593 WP_000917872.1.29601 WP_000917872.1.29606 WP_000917872.1.29615 WP_000917872.1.29619 WP_000917872.1.29682 WP_000917872.1.29704 WP_000917872.1.29711 WP_000917872.1.29727 WP_000917872.1.29732 WP_000917872.1.2974 WP_000917872.1.29743 WP_000917872.1.29768 WP_000917872.1.29774 WP_000917872.1.29775 WP_000917872.1.29782 WP_000917872.1.29827 WP_000917872.1.29833 WP_000917872.1.2984 WP_000917872.1.29845 WP_000917872.1.29851 WP_000917872.1.29865 WP_000917872.1.29886 WP_000917872.1.29898 WP_000917872.1.29919 WP_000917872.1.29923 WP_000917872.1.29924 WP_000917872.1.2994 WP_000917872.1.29964 WP_000917872.1.29969 WP_000917872.1.29983 WP_000917872.1.29990 WP_000917872.1.30006 WP_000917872.1.30009 WP_000917872.1.30013 WP_000917872.1.30018 WP_000917872.1.3002 WP_000917872.1.30022 WP_000917872.1.30027 WP_000917872.1.30034 WP_000917872.1.30049 WP_000917872.1.3005 WP_000917872.1.30058 WP_000917872.1.30059 WP_000917872.1.30086 WP_000917872.1.30093 WP_000917872.1.30165 WP_000917872.1.3017 WP_000917872.1.30170 WP_000917872.1.30172 WP_000917872.1.30179 WP_000917872.1.30180 WP_000917872.1.30185 WP_000917872.1.30195 WP_000917872.1.30202 WP_000917872.1.30210 WP_000917872.1.30213 WP_000917872.1.30225 WP_000917872.1.30238 WP_000917872.1.30246 WP_000917872.1.30278 WP_000917872.1.30331 WP_000917872.1.30354 WP_000917872.1.30356 WP_000917872.1.30357 WP_000917872.1.30362 WP_000917872.1.30386 WP_000917872.1.30389 WP_000917872.1.3042 WP_000917872.1.30421 WP_000917872.1.30425 WP_000917872.1.30437 WP_000917872.1.30440 WP_000917872.1.30448 WP_000917872.1.30469 WP_000917872.1.30489 WP_000917872.1.30492 WP_000917872.1.30505 WP_000917872.1.30507 WP_000917872.1.30517 WP_000917872.1.30535 WP_000917872.1.30542 WP_000917872.1.30544 WP_000917872.1.30547 WP_000917872.1.30548 WP_000917872.1.30555 WP_000917872.1.30556 WP_000917872.1.30572 WP_000917872.1.30573 WP_000917872.1.30585 WP_000917872.1.30589 WP_000917872.1.30602 WP_000917872.1.30618 WP_000917872.1.30619 WP_000917872.1.30627 WP_000917872.1.30635 WP_000917872.1.3066 WP_000917872.1.30664 WP_000917872.1.3067 WP_000917872.1.30688 WP_000917872.1.30696 WP_000917872.1.30752 WP_000917872.1.3076 WP_000917872.1.30794 WP_000917872.1.30803 WP_000917872.1.30806 WP_000917872.1.30819 WP_000917872.1.30823 WP_000917872.1.30833 WP_000917872.1.30835 WP_000917872.1.3089 WP_000917872.1.30909 WP_000917872.1.30934 WP_000917872.1.3095 WP_000917872.1.30951 WP_000917872.1.30967 WP_000917872.1.30968 WP_000917872.1.30972 WP_000917872.1.31 WP_000917872.1.31001 WP_000917872.1.31011 WP_000917872.1.31042 WP_000917872.1.31046 WP_000917872.1.31066 WP_000917872.1.31069 WP_000917872.1.31078 WP_000917872.1.31086 WP_000917872.1.31092 WP_000917872.1.31107 WP_000917872.1.31111 WP_000917872.1.31122 WP_000917872.1.3113 WP_000917872.1.31139 WP_000917872.1.31145 WP_000917872.1.31167 WP_000917872.1.31171 WP_000917872.1.31182 WP_000917872.1.31185 WP_000917872.1.3119 WP_000917872.1.31190 WP_000917872.1.31195 WP_000917872.1.31196 WP_000917872.1.31198 WP_000917872.1.31205 WP_000917872.1.3121 WP_000917872.1.31210 WP_000917872.1.31214 WP_000917872.1.31219 WP_000917872.1.31222 WP_000917872.1.31223 WP_000917872.1.3124 WP_000917872.1.31251 WP_000917872.1.31262 WP_000917872.1.3127 WP_000917872.1.31272 WP_000917872.1.31281 WP_000917872.1.31303 WP_000917872.1.3131 WP_000917872.1.31335 WP_000917872.1.31352 WP_000917872.1.31362 WP_000917872.1.31389 WP_000917872.1.31413 WP_000917872.1.31435 WP_000917872.1.31446 WP_000917872.1.31451 WP_000917872.1.31476 WP_000917872.1.31504 WP_000917872.1.31515 WP_000917872.1.31533 WP_000917872.1.31546 WP_000917872.1.31578 WP_000917872.1.31585 WP_000917872.1.31658 WP_000917872.1.3167 WP_000917872.1.3170 WP_000917872.1.31720 WP_000917872.1.31762 WP_000917872.1.31782 WP_000917872.1.31799 WP_000917872.1.31836 WP_000917872.1.31845 WP_000917872.1.3185 WP_000917872.1.31854 WP_000917872.1.31895 WP_000917872.1.31901 WP_000917872.1.31927 WP_000917872.1.31940 WP_000917872.1.31951 WP_000917872.1.31952 WP_000917872.1.31967 WP_000917872.1.31972 WP_000917872.1.31983 WP_000917872.1.32006 WP_000917872.1.32038 WP_000917872.1.32041 WP_000917872.1.32042 WP_000917872.1.32054 WP_000917872.1.32056 WP_000917872.1.3207 WP_000917872.1.3208 WP_000917872.1.32109 WP_000917872.1.32116 WP_000917872.1.32170 WP_000917872.1.32189 WP_000917872.1.32192 WP_000917872.1.32202 WP_000917872.1.32204 WP_000917872.1.32206 WP_000917872.1.32252 WP_000917872.1.32255 WP_000917872.1.32260 WP_000917872.1.32263 WP_000917872.1.32274 WP_000917872.1.32275 WP_000917872.1.32277 WP_000917872.1.32293 WP_000917872.1.32299 WP_000917872.1.32309 WP_000917872.1.32357 WP_000917872.1.32368 WP_000917872.1.32408 WP_000917872.1.32422 WP_000917872.1.32423 WP_000917872.1.32424 WP_000917872.1.32425 WP_000917872.1.32434 WP_000917872.1.32438 WP_000917872.1.32458 WP_000917872.1.32459 WP_000917872.1.32460 WP_000917872.1.32493 WP_000917872.1.32515 WP_000917872.1.32519 WP_000917872.1.32527 WP_000917872.1.32529 WP_000917872.1.32545 WP_000917872.1.32563 WP_000917872.1.32578 WP_000917872.1.32617 WP_000917872.1.32624 WP_000917872.1.32643 WP_000917872.1.32660 WP_000917872.1.32668 WP_000917872.1.3270 WP_000917872.1.32702 WP_000917872.1.32714 WP_000917872.1.32725 WP_000917872.1.32740 WP_000917872.1.32747 WP_000917872.1.32750 WP_000917872.1.3278 WP_000917872.1.32786 WP_000917872.1.32804 WP_000917872.1.32832 WP_000917872.1.32838 WP_000917872.1.32848 WP_000917872.1.32860 WP_000917872.1.32868 WP_000917872.1.32881 WP_000917872.1.32899 WP_000917872.1.329 WP_000917872.1.3290 WP_000917872.1.32900 WP_000917872.1.32902 WP_000917872.1.32907 WP_000917872.1.32930 WP_000917872.1.32940 WP_000917872.1.32941 WP_000917872.1.3296 WP_000917872.1.32961 WP_000917872.1.32966 WP_000917872.1.32977 WP_000917872.1.32985 WP_000917872.1.33030 WP_000917872.1.33037 WP_000917872.1.3304 WP_000917872.1.3305 WP_000917872.1.33051 WP_000917872.1.33065 WP_000917872.1.33078 WP_000917872.1.3310 WP_000917872.1.33114 WP_000917872.1.33122 WP_000917872.1.33127 WP_000917872.1.33143 WP_000917872.1.33144 WP_000917872.1.3315 WP_000917872.1.33160 WP_000917872.1.33208 WP_000917872.1.33214 WP_000917872.1.33247 WP_000917872.1.33248 WP_000917872.1.33253 WP_000917872.1.33261 WP_000917872.1.33270 WP_000917872.1.33280 WP_000917872.1.33283 WP_000917872.1.333 WP_000917872.1.33313 WP_000917872.1.33339 WP_000917872.1.33382 WP_000917872.1.33392 WP_000917872.1.33409 WP_000917872.1.33420 WP_000917872.1.33486 WP_000917872.1.33490 WP_000917872.1.33492 WP_000917872.1.33499 WP_000917872.1.335 WP_000917872.1.33501 WP_000917872.1.33504 WP_000917872.1.33529 WP_000917872.1.33553 WP_000917872.1.3356 WP_000917872.1.33580 WP_000917872.1.33586 WP_000917872.1.33592 WP_000917872.1.33609 WP_000917872.1.33629 WP_000917872.1.3364 WP_000917872.1.33659 WP_000917872.1.33689 WP_000917872.1.33693 WP_000917872.1.3370 WP_000917872.1.33730 WP_000917872.1.33741 WP_000917872.1.33786 WP_000917872.1.33817 WP_000917872.1.33840 WP_000917872.1.33865 WP_000917872.1.33870 WP_000917872.1.33894 WP_000917872.1.3392 WP_000917872.1.33926 WP_000917872.1.3394 WP_000917872.1.3395 WP_000917872.1.33957 WP_000917872.1.3396 WP_000917872.1.33969 WP_000917872.1.34 WP_000917872.1.34001 WP_000917872.1.34022 WP_000917872.1.34043 WP_000917872.1.34059 WP_000917872.1.34075 WP_000917872.1.34081 WP_000917872.1.34084 WP_000917872.1.34091 WP_000917872.1.34107 WP_000917872.1.34118 WP_000917872.1.34126 WP_000917872.1.34179 WP_000917872.1.34184 WP_000917872.1.34185 WP_000917872.1.34211 WP_000917872.1.34214 WP_000917872.1.34234 WP_000917872.1.34257 WP_000917872.1.34259 WP_000917872.1.34279 WP_000917872.1.34284 WP_000917872.1.34292 WP_000917872.1.34304 WP_000917872.1.34319 WP_000917872.1.34330 WP_000917872.1.34376 WP_000917872.1.3438 WP_000917872.1.34382 WP_000917872.1.34417 WP_000917872.1.34424 WP_000917872.1.34431 WP_000917872.1.3445 WP_000917872.1.34453 WP_000917872.1.34454 WP_000917872.1.34484 WP_000917872.1.34496 WP_000917872.1.34517 WP_000917872.1.34530 WP_000917872.1.34610 WP_000917872.1.34614 WP_000917872.1.34647 WP_000917872.1.34659 WP_000917872.1.34665 WP_000917872.1.34667 WP_000917872.1.34684 WP_000917872.1.34694 WP_000917872.1.34703 WP_000917872.1.34704 WP_000917872.1.34707 WP_000917872.1.34711 WP_000917872.1.34745 WP_000917872.1.34751 WP_000917872.1.3476 WP_000917872.1.34801 WP_000917872.1.34808 WP_000917872.1.34817 WP_000917872.1.34820 WP_000917872.1.34824 WP_000917872.1.34834 WP_000917872.1.34856 WP_000917872.1.34881 WP_000917872.1.3489 WP_000917872.1.34932 WP_000917872.1.34962 WP_000917872.1.34975 WP_000917872.1.34977 WP_000917872.1.35001 WP_000917872.1.35035 WP_000917872.1.35040 WP_000917872.1.35045 WP_000917872.1.35074 WP_000917872.1.35075 WP_000917872.1.35125 WP_000917872.1.35129 WP_000917872.1.35175 WP_000917872.1.35184 WP_000917872.1.35193 WP_000917872.1.35219 WP_000917872.1.35240 WP_000917872.1.35274 WP_000917872.1.35294 WP_000917872.1.35298 WP_000917872.1.35321 WP_000917872.1.35331 WP_000917872.1.35332 WP_000917872.1.35404 WP_000917872.1.35408 WP_000917872.1.3541 WP_000917872.1.35425 WP_000917872.1.35429 WP_000917872.1.35446 WP_000917872.1.35460 WP_000917872.1.35463 WP_000917872.1.35494 WP_000917872.1.35503 WP_000917872.1.35507 WP_000917872.1.35509 WP_000917872.1.35532 WP_000917872.1.3556 WP_000917872.1.35560 WP_000917872.1.35563 WP_000917872.1.3557 WP_000917872.1.35570 WP_000917872.1.35590 WP_000917872.1.35594 WP_000917872.1.35619 WP_000917872.1.35624 WP_000917872.1.35628 WP_000917872.1.3566 WP_000917872.1.3570 WP_000917872.1.35712 WP_000917872.1.35713 WP_000917872.1.3572 WP_000917872.1.35736 WP_000917872.1.35777 WP_000917872.1.35791 WP_000917872.1.35795 WP_000917872.1.35809 WP_000917872.1.35835 WP_000917872.1.35868 WP_000917872.1.35870 WP_000917872.1.35887 WP_000917872.1.35892 WP_000917872.1.35916 WP_000917872.1.35936 WP_000917872.1.35938 WP_000917872.1.35940 WP_000917872.1.35961 WP_000917872.1.35966 WP_000917872.1.35993 WP_000917872.1.36000 WP_000917872.1.36003 WP_000917872.1.3601 WP_000917872.1.36011 WP_000917872.1.36017 WP_000917872.1.36034 WP_000917872.1.36036 WP_000917872.1.36037 WP_000917872.1.36057 WP_000917872.1.36063 WP_000917872.1.36069 WP_000917872.1.3610 WP_000917872.1.36157 WP_000917872.1.36172 WP_000917872.1.36229 WP_000917872.1.36232 WP_000917872.1.36236 WP_000917872.1.36286 WP_000917872.1.36291 WP_000917872.1.36298 WP_000917872.1.36308 WP_000917872.1.36323 WP_000917872.1.36343 WP_000917872.1.36409 WP_000917872.1.36425 WP_000917872.1.36445 WP_000917872.1.36460 WP_000917872.1.3649 WP_000917872.1.36495 WP_000917872.1.36512 WP_000917872.1.36526 WP_000917872.1.36542 WP_000917872.1.36547 WP_000917872.1.36564 WP_000917872.1.36567 WP_000917872.1.36579 WP_000917872.1.36584 WP_000917872.1.36586 WP_000917872.1.36592 WP_000917872.1.36609 WP_000917872.1.36617 WP_000917872.1.36618 WP_000917872.1.36643 WP_000917872.1.36663 WP_000917872.1.36685 WP_000917872.1.36690 WP_000917872.1.3670 WP_000917872.1.36701 WP_000917872.1.36705 WP_000917872.1.36721 WP_000917872.1.36725 WP_000917872.1.36751 WP_000917872.1.36764 WP_000917872.1.36765 WP_000917872.1.36779 WP_000917872.1.36792 WP_000917872.1.36798 WP_000917872.1.36802 WP_000917872.1.36821 WP_000917872.1.36839 WP_000917872.1.36853 WP_000917872.1.36875 WP_000917872.1.3688 WP_000917872.1.36885 WP_000917872.1.36889 WP_000917872.1.36899 WP_000917872.1.36918 WP_000917872.1.36931 WP_000917872.1.36948 WP_000917872.1.36949 WP_000917872.1.36950 WP_000917872.1.36978 WP_000917872.1.37014 WP_000917872.1.37021 WP_000917872.1.37028 WP_000917872.1.37029 WP_000917872.1.37073 WP_000917872.1.37100 WP_000917872.1.37111 WP_000917872.1.37112 WP_000917872.1.37114 WP_000917872.1.37119 WP_000917872.1.37133 WP_000917872.1.37147 WP_000917872.1.37158 WP_000917872.1.37176 WP_000917872.1.37190 WP_000917872.1.37191 WP_000917872.1.37199 WP_000917872.1.37200 WP_000917872.1.37256 WP_000917872.1.37258 WP_000917872.1.3726 WP_000917872.1.37267 WP_000917872.1.3728 WP_000917872.1.37293 WP_000917872.1.37297 WP_000917872.1.37303 WP_000917872.1.37320 WP_000917872.1.3734 WP_000917872.1.37351 WP_000917872.1.37363 WP_000917872.1.37370 WP_000917872.1.37376 WP_000917872.1.37405 WP_000917872.1.3744 WP_000917872.1.3748 WP_000917872.1.37498 WP_000917872.1.37504 WP_000917872.1.3751 WP_000917872.1.37513 WP_000917872.1.37521 WP_000917872.1.37558 WP_000917872.1.3756 WP_000917872.1.37584 WP_000917872.1.37590 WP_000917872.1.37593 WP_000917872.1.37600 WP_000917872.1.37610 WP_000917872.1.37613 WP_000917872.1.37618 WP_000917872.1.37659 WP_000917872.1.37662 WP_000917872.1.37666 WP_000917872.1.37675 WP_000917872.1.37687 WP_000917872.1.37691 WP_000917872.1.3771 WP_000917872.1.37719 WP_000917872.1.37761 WP_000917872.1.37775 WP_000917872.1.37777 WP_000917872.1.3778 WP_000917872.1.378 WP_000917872.1.37808 WP_000917872.1.37848 WP_000917872.1.37864 WP_000917872.1.379 WP_000917872.1.3790 WP_000917872.1.37911 WP_000917872.1.37941 WP_000917872.1.37965 WP_000917872.1.37968 WP_000917872.1.37978 WP_000917872.1.37985 WP_000917872.1.38001 WP_000917872.1.38026 WP_000917872.1.38037 WP_000917872.1.38047 WP_000917872.1.38055 WP_000917872.1.38061 WP_000917872.1.38064 WP_000917872.1.38108 WP_000917872.1.38113 WP_000917872.1.38125 WP_000917872.1.38145 WP_000917872.1.3816 WP_000917872.1.38199 WP_000917872.1.38207 WP_000917872.1.38261 WP_000917872.1.38266 WP_000917872.1.38273 WP_000917872.1.3828 WP_000917872.1.383 WP_000917872.1.38310 WP_000917872.1.38322 WP_000917872.1.3834 WP_000917872.1.38341 WP_000917872.1.38344 WP_000917872.1.38349 WP_000917872.1.38351 WP_000917872.1.3838 WP_000917872.1.38381 WP_000917872.1.38393 WP_000917872.1.38408 WP_000917872.1.38440 WP_000917872.1.38452 WP_000917872.1.3848 WP_000917872.1.38486 WP_000917872.1.38512 WP_000917872.1.38515 WP_000917872.1.38569 WP_000917872.1.38595 WP_000917872.1.3860 WP_000917872.1.38609 WP_000917872.1.38613 WP_000917872.1.38620 WP_000917872.1.38622 WP_000917872.1.38642 WP_000917872.1.38673 WP_000917872.1.3869 WP_000917872.1.38693 WP_000917872.1.38734 WP_000917872.1.38740 WP_000917872.1.38773 WP_000917872.1.38781 WP_000917872.1.38797 WP_000917872.1.38830 WP_000917872.1.38857 WP_000917872.1.38877 WP_000917872.1.38881 WP_000917872.1.38882 WP_000917872.1.38895 WP_000917872.1.38898 WP_000917872.1.3891 WP_000917872.1.38913 WP_000917872.1.38942 WP_000917872.1.38983 WP_000917872.1.38995 WP_000917872.1.38996 WP_000917872.1.39003 WP_000917872.1.39038 WP_000917872.1.39048 WP_000917872.1.39055 WP_000917872.1.39056 WP_000917872.1.39059 WP_000917872.1.39065 WP_000917872.1.3907 WP_000917872.1.39075 WP_000917872.1.39082 WP_000917872.1.39105 WP_000917872.1.39112 WP_000917872.1.39128 WP_000917872.1.39136 WP_000917872.1.3914 WP_000917872.1.39140 WP_000917872.1.39146 WP_000917872.1.39147 WP_000917872.1.39161 WP_000917872.1.39183 WP_000917872.1.39197 WP_000917872.1.39210 WP_000917872.1.39229 WP_000917872.1.39235 WP_000917872.1.39265 WP_000917872.1.39275 WP_000917872.1.3931 WP_000917872.1.39311 WP_000917872.1.39312 WP_000917872.1.39385 WP_000917872.1.39395 WP_000917872.1.39405 WP_000917872.1.39414 WP_000917872.1.39420 WP_000917872.1.39435 WP_000917872.1.39449 WP_000917872.1.39466 WP_000917872.1.39497 WP_000917872.1.39502 WP_000917872.1.39503 WP_000917872.1.39512 WP_000917872.1.39530 WP_000917872.1.39553 WP_000917872.1.39556 WP_000917872.1.39576 WP_000917872.1.39584 WP_000917872.1.39614 WP_000917872.1.39619 WP_000917872.1.39620 WP_000917872.1.39624 WP_000917872.1.39629 WP_000917872.1.39659 WP_000917872.1.39667 WP_000917872.1.39722 WP_000917872.1.39723 WP_000917872.1.39724 WP_000917872.1.39763 WP_000917872.1.39775 WP_000917872.1.39808 WP_000917872.1.39862 WP_000917872.1.39879 WP_000917872.1.39890 WP_000917872.1.39921 WP_000917872.1.39923 WP_000917872.1.39941 WP_000917872.1.39945 WP_000917872.1.39947 WP_000917872.1.39953 WP_000917872.1.40008 WP_000917872.1.40017 WP_000917872.1.40025 WP_000917872.1.40031 WP_000917872.1.40072 WP_000917872.1.40073 WP_000917872.1.40081 WP_000917872.1.40095 WP_000917872.1.40097 WP_000917872.1.401 WP_000917872.1.4011 WP_000917872.1.40111 WP_000917872.1.40155 WP_000917872.1.40158 WP_000917872.1.40160 WP_000917872.1.40167 WP_000917872.1.40170 WP_000917872.1.40171 WP_000917872.1.40205 WP_000917872.1.40208 WP_000917872.1.40224 WP_000917872.1.40229 WP_000917872.1.40240 WP_000917872.1.40254 WP_000917872.1.40257 WP_000917872.1.40259 WP_000917872.1.40279 WP_000917872.1.40284 WP_000917872.1.40292 WP_000917872.1.40305 WP_000917872.1.40307 WP_000917872.1.40311 WP_000917872.1.40341 WP_000917872.1.40361 WP_000917872.1.40374 WP_000917872.1.40380 WP_000917872.1.40395 WP_000917872.1.4042 WP_000917872.1.40465 WP_000917872.1.40467 WP_000917872.1.40492 WP_000917872.1.40493 WP_000917872.1.40496 WP_000917872.1.40517 WP_000917872.1.40528 WP_000917872.1.40533 WP_000917872.1.40577 WP_000917872.1.40583 WP_000917872.1.40605 WP_000917872.1.40622 WP_000917872.1.40648 WP_000917872.1.40688 WP_000917872.1.40693 WP_000917872.1.40695 WP_000917872.1.40698 WP_000917872.1.40710 WP_000917872.1.40722 WP_000917872.1.40745 WP_000917872.1.4075 WP_000917872.1.40750 WP_000917872.1.40763 WP_000917872.1.40771 WP_000917872.1.40788 WP_000917872.1.40849 WP_000917872.1.40854 WP_000917872.1.4087 WP_000917872.1.40877 WP_000917872.1.4088 WP_000917872.1.4089 WP_000917872.1.40910 WP_000917872.1.40924 WP_000917872.1.40930 WP_000917872.1.40932 WP_000917872.1.40946 WP_000917872.1.40973 WP_000917872.1.40996 WP_000917872.1.41004 WP_000917872.1.41017 WP_000917872.1.41018 WP_000917872.1.41048 WP_000917872.1.41050 WP_000917872.1.4106 WP_000917872.1.41070 WP_000917872.1.41074 WP_000917872.1.41075 WP_000917872.1.41086 WP_000917872.1.4109 WP_000917872.1.41091 WP_000917872.1.41097 WP_000917872.1.41116 WP_000917872.1.41128 WP_000917872.1.41132 WP_000917872.1.4114 WP_000917872.1.41176 WP_000917872.1.41192 WP_000917872.1.41225 WP_000917872.1.41226 WP_000917872.1.41251 WP_000917872.1.41258 WP_000917872.1.41265 WP_000917872.1.41277 WP_000917872.1.41279 WP_000917872.1.41299 WP_000917872.1.41305 WP_000917872.1.41308 WP_000917872.1.41310 WP_000917872.1.41321 WP_000917872.1.41333 WP_000917872.1.41335 WP_000917872.1.41345 WP_000917872.1.4136 WP_000917872.1.41375 WP_000917872.1.4141 WP_000917872.1.41415 WP_000917872.1.41427 WP_000917872.1.41434 WP_000917872.1.41438 WP_000917872.1.41459 WP_000917872.1.41468 WP_000917872.1.41498 WP_000917872.1.41516 WP_000917872.1.41519 WP_000917872.1.41524 WP_000917872.1.41528 WP_000917872.1.41554 WP_000917872.1.41572 WP_000917872.1.41591 WP_000917872.1.41593 WP_000917872.1.41610 WP_000917872.1.41628 WP_000917872.1.41631 WP_000917872.1.41658 WP_000917872.1.41659 WP_000917872.1.41662 WP_000917872.1.41688 WP_000917872.1.41690 WP_000917872.1.41708 WP_000917872.1.41716 WP_000917872.1.41724 WP_000917872.1.41735 WP_000917872.1.41746 WP_000917872.1.41761 WP_000917872.1.4178 WP_000917872.1.41789 WP_000917872.1.41799 WP_000917872.1.41802 WP_000917872.1.41824 WP_000917872.1.41825 WP_000917872.1.41836 WP_000917872.1.4184 WP_000917872.1.41859 WP_000917872.1.41862 WP_000917872.1.41882 WP_000917872.1.41894 WP_000917872.1.41897 WP_000917872.1.41904 WP_000917872.1.41911 WP_000917872.1.41919 WP_000917872.1.41929 WP_000917872.1.41931 WP_000917872.1.41938 WP_000917872.1.4194 WP_000917872.1.41949 WP_000917872.1.41978 WP_000917872.1.41979 WP_000917872.1.41985 WP_000917872.1.41994 WP_000917872.1.41998 WP_000917872.1.42009 WP_000917872.1.42069 WP_000917872.1.42081 WP_000917872.1.42090 WP_000917872.1.42098 WP_000917872.1.42104 WP_000917872.1.42109 WP_000917872.1.42111 WP_000917872.1.42136 WP_000917872.1.42156 WP_000917872.1.42187 WP_000917872.1.422 WP_000917872.1.42200 WP_000917872.1.42219 WP_000917872.1.4222 WP_000917872.1.42238 WP_000917872.1.42243 WP_000917872.1.42244 WP_000917872.1.42248 WP_000917872.1.42257 WP_000917872.1.42261 WP_000917872.1.42262 WP_000917872.1.42263 WP_000917872.1.42276 WP_000917872.1.4229 WP_000917872.1.42320 WP_000917872.1.42322 WP_000917872.1.42328 WP_000917872.1.42342 WP_000917872.1.42349 WP_000917872.1.42356 WP_000917872.1.42364 WP_000917872.1.42371 WP_000917872.1.42372 WP_000917872.1.42379 WP_000917872.1.4239 WP_000917872.1.42391 WP_000917872.1.42392 WP_000917872.1.42394 WP_000917872.1.42399 WP_000917872.1.42404 WP_000917872.1.42422 WP_000917872.1.42433 WP_000917872.1.42444 WP_000917872.1.42453 WP_000917872.1.42489 WP_000917872.1.42491 WP_000917872.1.42539 WP_000917872.1.4257 WP_000917872.1.42595 WP_000917872.1.42603 WP_000917872.1.42605 WP_000917872.1.42650 WP_000917872.1.42655 WP_000917872.1.42666 WP_000917872.1.4267 WP_000917872.1.42675 WP_000917872.1.42676 WP_000917872.1.42683 WP_000917872.1.42685 WP_000917872.1.42701 WP_000917872.1.42734 WP_000917872.1.4276 WP_000917872.1.42767 WP_000917872.1.42794 WP_000917872.1.42797 WP_000917872.1.42805 WP_000917872.1.42815 WP_000917872.1.42829 WP_000917872.1.42859 WP_000917872.1.42861 WP_000917872.1.42864 WP_000917872.1.4288 WP_000917872.1.42887 WP_000917872.1.42892 WP_000917872.1.42923 WP_000917872.1.42932 WP_000917872.1.42957 WP_000917872.1.42978 WP_000917872.1.4298 WP_000917872.1.42981 WP_000917872.1.43008 WP_000917872.1.43016 WP_000917872.1.43018 WP_000917872.1.43019 WP_000917872.1.43041 WP_000917872.1.43065 WP_000917872.1.43068 WP_000917872.1.43069 WP_000917872.1.43070 WP_000917872.1.43077 WP_000917872.1.43086 WP_000917872.1.43089 WP_000917872.1.43126 WP_000917872.1.43128 WP_000917872.1.43141 WP_000917872.1.43149 WP_000917872.1.43157 WP_000917872.1.43160 WP_000917872.1.43161 WP_000917872.1.43190 WP_000917872.1.43198 WP_000917872.1.43201 WP_000917872.1.43244 WP_000917872.1.43258 WP_000917872.1.4326 WP_000917872.1.43272 WP_000917872.1.43276 WP_000917872.1.43290 WP_000917872.1.43292 WP_000917872.1.43299 WP_000917872.1.43307 WP_000917872.1.43312 WP_000917872.1.4332 WP_000917872.1.43334 WP_000917872.1.43339 WP_000917872.1.43351 WP_000917872.1.43371 WP_000917872.1.43437 WP_000917872.1.4344 WP_000917872.1.43441 WP_000917872.1.43476 WP_000917872.1.43508 WP_000917872.1.43513 WP_000917872.1.43520 WP_000917872.1.43522 WP_000917872.1.43528 WP_000917872.1.43535 WP_000917872.1.43606 WP_000917872.1.43613 WP_000917872.1.43633 WP_000917872.1.43637 WP_000917872.1.43651 WP_000917872.1.43654 WP_000917872.1.43668 WP_000917872.1.43676 WP_000917872.1.43685 WP_000917872.1.43711 WP_000917872.1.43722 WP_000917872.1.4373 WP_000917872.1.43763 WP_000917872.1.43778 WP_000917872.1.43782 WP_000917872.1.43785 WP_000917872.1.43801 WP_000917872.1.43812 WP_000917872.1.43828 WP_000917872.1.43839 WP_000917872.1.43864 WP_000917872.1.43873 WP_000917872.1.43875 WP_000917872.1.43878 WP_000917872.1.43886 WP_000917872.1.43888 WP_000917872.1.43919 WP_000917872.1.43951 WP_000917872.1.43954 WP_000917872.1.43974 WP_000917872.1.44005 WP_000917872.1.44010 WP_000917872.1.4404 WP_000917872.1.44043 WP_000917872.1.44049 WP_000917872.1.4405 WP_000917872.1.44063 WP_000917872.1.44099 WP_000917872.1.44101 WP_000917872.1.44113 WP_000917872.1.44121 WP_000917872.1.44132 WP_000917872.1.44144 WP_000917872.1.44160 WP_000917872.1.44180 WP_000917872.1.44187 WP_000917872.1.44191 WP_000917872.1.44196 WP_000917872.1.44208 WP_000917872.1.4422 WP_000917872.1.4423 WP_000917872.1.44248 WP_000917872.1.44250 WP_000917872.1.44262 WP_000917872.1.44268 WP_000917872.1.4427 WP_000917872.1.44291 WP_000917872.1.44296 WP_000917872.1.44300 WP_000917872.1.44310 WP_000917872.1.44337 WP_000917872.1.44339 WP_000917872.1.44343 WP_000917872.1.44351 WP_000917872.1.44359 WP_000917872.1.44360 WP_000917872.1.44380 WP_000917872.1.44386 WP_000917872.1.44397 WP_000917872.1.4440 WP_000917872.1.44416 WP_000917872.1.44431 WP_000917872.1.44433 WP_000917872.1.44437 WP_000917872.1.44438 WP_000917872.1.44440 WP_000917872.1.44443 WP_000917872.1.44453 WP_000917872.1.44474 WP_000917872.1.44479 WP_000917872.1.44546 WP_000917872.1.44549 WP_000917872.1.44578 WP_000917872.1.44593 WP_000917872.1.44606 WP_000917872.1.44633 WP_000917872.1.44636 WP_000917872.1.44640 WP_000917872.1.4467 WP_000917872.1.44678 WP_000917872.1.4468 WP_000917872.1.44687 WP_000917872.1.44702 WP_000917872.1.44705 WP_000917872.1.44747 WP_000917872.1.44762 WP_000917872.1.44781 WP_000917872.1.44791 WP_000917872.1.44795 WP_000917872.1.44815 WP_000917872.1.44828 WP_000917872.1.44831 WP_000917872.1.44833 WP_000917872.1.4485 WP_000917872.1.44877 WP_000917872.1.44879 WP_000917872.1.44917 WP_000917872.1.44927 WP_000917872.1.44933 WP_000917872.1.44943 WP_000917872.1.44950 WP_000917872.1.44966 WP_000917872.1.44971 WP_000917872.1.44978 WP_000917872.1.44985 WP_000917872.1.44996 WP_000917872.1.44997 WP_000917872.1.44998 WP_000917872.1.4500 WP_000917872.1.4501 WP_000917872.1.45027 WP_000917872.1.45038 WP_000917872.1.45045 WP_000917872.1.4505 WP_000917872.1.45067 WP_000917872.1.45072 WP_000917872.1.45074 WP_000917872.1.45079 WP_000917872.1.45093 WP_000917872.1.45098 WP_000917872.1.45123 WP_000917872.1.45134 WP_000917872.1.45136 WP_000917872.1.45138 WP_000917872.1.45145 WP_000917872.1.45154 WP_000917872.1.45173 WP_000917872.1.45177 WP_000917872.1.45184 WP_000917872.1.45229 WP_000917872.1.45241 WP_000917872.1.45251 WP_000917872.1.45259 WP_000917872.1.45268 WP_000917872.1.45302 WP_000917872.1.4531 WP_000917872.1.45322 WP_000917872.1.45344 WP_000917872.1.45349 WP_000917872.1.45351 WP_000917872.1.45365 WP_000917872.1.45402 WP_000917872.1.45432 WP_000917872.1.45434 WP_000917872.1.45435 WP_000917872.1.45462 WP_000917872.1.45468 WP_000917872.1.45522 WP_000917872.1.45523 WP_000917872.1.45535 WP_000917872.1.45544 WP_000917872.1.45549 WP_000917872.1.45550 WP_000917872.1.45566 WP_000917872.1.45569 WP_000917872.1.45571 WP_000917872.1.45582 WP_000917872.1.45583 WP_000917872.1.45585 WP_000917872.1.45596 WP_000917872.1.45622 WP_000917872.1.45648 WP_000917872.1.45660 WP_000917872.1.45690 WP_000917872.1.45706 WP_000917872.1.45797 WP_000917872.1.458 WP_000917872.1.45829 WP_000917872.1.45844 WP_000917872.1.45848 WP_000917872.1.45871 WP_000917872.1.45906 WP_000917872.1.45918 WP_000917872.1.4592 WP_000917872.1.45947 WP_000917872.1.45984 WP_000917872.1.46011 WP_000917872.1.46028 WP_000917872.1.46030 WP_000917872.1.46069 WP_000917872.1.46077 WP_000917872.1.46091 WP_000917872.1.46112 WP_000917872.1.46124 WP_000917872.1.46169 WP_000917872.1.46173 WP_000917872.1.46174 WP_000917872.1.46187 WP_000917872.1.46203 WP_000917872.1.46215 WP_000917872.1.46225 WP_000917872.1.46232 WP_000917872.1.46241 WP_000917872.1.46243 WP_000917872.1.46250 WP_000917872.1.46278 WP_000917872.1.46286 WP_000917872.1.46299 WP_000917872.1.46303 WP_000917872.1.46307 WP_000917872.1.46322 WP_000917872.1.46345 WP_000917872.1.46355 WP_000917872.1.46358 WP_000917872.1.464 WP_000917872.1.46406 WP_000917872.1.46434 WP_000917872.1.46444 WP_000917872.1.46454 WP_000917872.1.46461 WP_000917872.1.46499 WP_000917872.1.46504 WP_000917872.1.46505 WP_000917872.1.46551 WP_000917872.1.46559 WP_000917872.1.46574 WP_000917872.1.46578 WP_000917872.1.46595 WP_000917872.1.46637 WP_000917872.1.46666 WP_000917872.1.46675 WP_000917872.1.46689 WP_000917872.1.46693 WP_000917872.1.46701 WP_000917872.1.4671 WP_000917872.1.46726 WP_000917872.1.46730 WP_000917872.1.4674 WP_000917872.1.46749 WP_000917872.1.46781 WP_000917872.1.46803 WP_000917872.1.46816 WP_000917872.1.46842 WP_000917872.1.4686 WP_000917872.1.4690 WP_000917872.1.46920 WP_000917872.1.46930 WP_000917872.1.46945 WP_000917872.1.46961 WP_000917872.1.46967 WP_000917872.1.46976 WP_000917872.1.47005 WP_000917872.1.47008 WP_000917872.1.47014 WP_000917872.1.47023 WP_000917872.1.47036 WP_000917872.1.47037 WP_000917872.1.47042 WP_000917872.1.47057 WP_000917872.1.47058 WP_000917872.1.47059 WP_000917872.1.47061 WP_000917872.1.47067 WP_000917872.1.47085 WP_000917872.1.47110 WP_000917872.1.47123 WP_000917872.1.47214 WP_000917872.1.47215 WP_000917872.1.47243 WP_000917872.1.47245 WP_000917872.1.47257 WP_000917872.1.47389 WP_000917872.1.47429 WP_000917872.1.47442 WP_000917872.1.47448 WP_000917872.1.47460 WP_000917872.1.4747 WP_000917872.1.47472 WP_000917872.1.47478 WP_000917872.1.47482 WP_000917872.1.47507 WP_000917872.1.47523 WP_000917872.1.47531 WP_000917872.1.47532 WP_000917872.1.47542 WP_000917872.1.47567 WP_000917872.1.47576 WP_000917872.1.47579 WP_000917872.1.4758 WP_000917872.1.47587 WP_000917872.1.47605 WP_000917872.1.47614 WP_000917872.1.47621 WP_000917872.1.47630 WP_000917872.1.47649 WP_000917872.1.47660 WP_000917872.1.4769 WP_000917872.1.47714 WP_000917872.1.4774 WP_000917872.1.4775 WP_000917872.1.47756 WP_000917872.1.47767 WP_000917872.1.47799 WP_000917872.1.4781 WP_000917872.1.47814 WP_000917872.1.47817 WP_000917872.1.47829 WP_000917872.1.47850 WP_000917872.1.47875 WP_000917872.1.47886 WP_000917872.1.47898 WP_000917872.1.47902 WP_000917872.1.47911 WP_000917872.1.47928 WP_000917872.1.4795 WP_000917872.1.47988 WP_000917872.1.47992 WP_000917872.1.48019 WP_000917872.1.48100 WP_000917872.1.48114 WP_000917872.1.48124 WP_000917872.1.48132 WP_000917872.1.48134 WP_000917872.1.48139 WP_000917872.1.48190 WP_000917872.1.48209 WP_000917872.1.48215 WP_000917872.1.48218 WP_000917872.1.48242 WP_000917872.1.48244 WP_000917872.1.48247 WP_000917872.1.48253 WP_000917872.1.48262 WP_000917872.1.48268 WP_000917872.1.48292 WP_000917872.1.483 WP_000917872.1.48324 WP_000917872.1.48342 WP_000917872.1.48367 WP_000917872.1.48377 WP_000917872.1.4839 WP_000917872.1.48399 WP_000917872.1.48426 WP_000917872.1.48430 WP_000917872.1.48436 WP_000917872.1.48455 WP_000917872.1.48493 WP_000917872.1.48510 WP_000917872.1.48524 WP_000917872.1.4853 WP_000917872.1.48570 WP_000917872.1.48586 WP_000917872.1.4859 WP_000917872.1.48591 WP_000917872.1.48610 WP_000917872.1.48631 WP_000917872.1.48647 WP_000917872.1.48651 WP_000917872.1.48663 WP_000917872.1.48690 WP_000917872.1.48734 WP_000917872.1.48751 WP_000917872.1.48755 WP_000917872.1.48756 WP_000917872.1.48768 WP_000917872.1.48774 WP_000917872.1.48778 WP_000917872.1.48788 WP_000917872.1.48797 WP_000917872.1.48841 WP_000917872.1.48849 WP_000917872.1.4885 WP_000917872.1.48876 WP_000917872.1.48886 WP_000917872.1.48894 WP_000917872.1.48896 WP_000917872.1.48908 WP_000917872.1.48918 WP_000917872.1.48919 WP_000917872.1.48931 WP_000917872.1.48955 WP_000917872.1.48963 WP_000917872.1.48973 WP_000917872.1.48985 WP_000917872.1.49004 WP_000917872.1.49005 WP_000917872.1.49041 WP_000917872.1.49084 WP_000917872.1.49090 WP_000917872.1.49102 WP_000917872.1.49106 WP_000917872.1.49113 WP_000917872.1.49117 WP_000917872.1.49121 WP_000917872.1.4914 WP_000917872.1.49140 WP_000917872.1.49153 WP_000917872.1.49155 WP_000917872.1.49162 WP_000917872.1.49166 WP_000917872.1.49175 WP_000917872.1.49204 WP_000917872.1.49214 WP_000917872.1.49226 WP_000917872.1.49233 WP_000917872.1.49239 WP_000917872.1.49256 WP_000917872.1.49262 WP_000917872.1.49276 WP_000917872.1.49290 WP_000917872.1.49304 WP_000917872.1.49309 WP_000917872.1.49311 WP_000917872.1.49334 WP_000917872.1.49340 WP_000917872.1.49355 WP_000917872.1.49358 WP_000917872.1.49366 WP_000917872.1.49429 WP_000917872.1.49430 WP_000917872.1.49434 WP_000917872.1.49450 WP_000917872.1.49472 WP_000917872.1.49490 WP_000917872.1.49494 WP_000917872.1.495 WP_000917872.1.49515 WP_000917872.1.49545 WP_000917872.1.49550 WP_000917872.1.49572 WP_000917872.1.49574 WP_000917872.1.49590 WP_000917872.1.49595 WP_000917872.1.49602 WP_000917872.1.49626 WP_000917872.1.49630 WP_000917872.1.49647 WP_000917872.1.49650 WP_000917872.1.49686 WP_000917872.1.49703 WP_000917872.1.49769 WP_000917872.1.49770 WP_000917872.1.49778 WP_000917872.1.49780 WP_000917872.1.4979 WP_000917872.1.49790 WP_000917872.1.49803 WP_000917872.1.49805 WP_000917872.1.49827 WP_000917872.1.49846 WP_000917872.1.49848 WP_000917872.1.4991 WP_000917872.1.49929 WP_000917872.1.49931 WP_000917872.1.49947 WP_000917872.1.49959 WP_000917872.1.49997 WP_000917872.1.50 WP_000917872.1.50003 WP_000917872.1.50007 WP_000917872.1.50014 WP_000917872.1.50030 WP_000917872.1.50043 WP_000917872.1.50080 WP_000917872.1.5009 WP_000917872.1.50103 WP_000917872.1.50128 WP_000917872.1.50153 WP_000917872.1.50158 WP_000917872.1.50161 WP_000917872.1.50198 WP_000917872.1.50211 WP_000917872.1.50238 WP_000917872.1.50239 WP_000917872.1.50247 WP_000917872.1.50285 WP_000917872.1.50308 WP_000917872.1.50309 WP_000917872.1.50332 WP_000917872.1.50349 WP_000917872.1.50374 WP_000917872.1.50376 WP_000917872.1.50386 WP_000917872.1.50387 WP_000917872.1.50389 WP_000917872.1.50404 WP_000917872.1.50406 WP_000917872.1.50413 WP_000917872.1.50449 WP_000917872.1.50468 WP_000917872.1.50469 WP_000917872.1.50478 WP_000917872.1.50480 WP_000917872.1.50497 WP_000917872.1.5051 WP_000917872.1.50517 WP_000917872.1.50529 WP_000917872.1.50563 WP_000917872.1.50566 WP_000917872.1.50570 WP_000917872.1.50576 WP_000917872.1.5058 WP_000917872.1.50593 WP_000917872.1.50626 WP_000917872.1.50652 WP_000917872.1.50676 WP_000917872.1.50684 WP_000917872.1.50726 WP_000917872.1.50750 WP_000917872.1.50769 WP_000917872.1.50771 WP_000917872.1.50774 WP_000917872.1.50777 WP_000917872.1.50782 WP_000917872.1.50800 WP_000917872.1.50804 WP_000917872.1.50808 WP_000917872.1.50811 WP_000917872.1.50875 WP_000917872.1.5088 WP_000917872.1.50882 WP_000917872.1.50885 WP_000917872.1.50893 WP_000917872.1.509 WP_000917872.1.50905 WP_000917872.1.50908 WP_000917872.1.50929 WP_000917872.1.50941 WP_000917872.1.50954 WP_000917872.1.50960 WP_000917872.1.50970 WP_000917872.1.50999 WP_000917872.1.51014 WP_000917872.1.51022 WP_000917872.1.51025 WP_000917872.1.51036 WP_000917872.1.51040 WP_000917872.1.51048 WP_000917872.1.51066 WP_000917872.1.51100 WP_000917872.1.51131 WP_000917872.1.51134 WP_000917872.1.51139 WP_000917872.1.5114 WP_000917872.1.51162 WP_000917872.1.51178 WP_000917872.1.51179 WP_000917872.1.51182 WP_000917872.1.51186 WP_000917872.1.51224 WP_000917872.1.51227 WP_000917872.1.5125 WP_000917872.1.5127 WP_000917872.1.51285 WP_000917872.1.51305 WP_000917872.1.51308 WP_000917872.1.51315 WP_000917872.1.51331 WP_000917872.1.51338 WP_000917872.1.51356 WP_000917872.1.5136 WP_000917872.1.5138 WP_000917872.1.51412 WP_000917872.1.51414 WP_000917872.1.51419 WP_000917872.1.51451 WP_000917872.1.51464 WP_000917872.1.51474 WP_000917872.1.51487 WP_000917872.1.51488 WP_000917872.1.51502 WP_000917872.1.51506 WP_000917872.1.51514 WP_000917872.1.51518 WP_000917872.1.51519 WP_000917872.1.51555 WP_000917872.1.51594 WP_000917872.1.51598 WP_000917872.1.51611 WP_000917872.1.51615 WP_000917872.1.51634 WP_000917872.1.51642 WP_000917872.1.51644 WP_000917872.1.51649 WP_000917872.1.51686 WP_000917872.1.51700 WP_000917872.1.51704 WP_000917872.1.51724 WP_000917872.1.51734 WP_000917872.1.51756 WP_000917872.1.51764 WP_000917872.1.51810 WP_000917872.1.51831 WP_000917872.1.51838 WP_000917872.1.51841 WP_000917872.1.5185 WP_000917872.1.51863 WP_000917872.1.51868 WP_000917872.1.51888 WP_000917872.1.51900 WP_000917872.1.51910 WP_000917872.1.51911 WP_000917872.1.51914 WP_000917872.1.51930 WP_000917872.1.51932 WP_000917872.1.51935 WP_000917872.1.51989 WP_000917872.1.51994 WP_000917872.1.520 WP_000917872.1.52047 WP_000917872.1.52052 WP_000917872.1.52057 WP_000917872.1.52101 WP_000917872.1.5211 WP_000917872.1.52114 WP_000917872.1.52121 WP_000917872.1.52123 WP_000917872.1.52129 WP_000917872.1.52148 WP_000917872.1.52156 WP_000917872.1.5216 WP_000917872.1.52170 WP_000917872.1.52191 WP_000917872.1.52202 WP_000917872.1.52209 WP_000917872.1.52255 WP_000917872.1.52321 WP_000917872.1.52336 WP_000917872.1.52339 WP_000917872.1.52346 WP_000917872.1.52353 WP_000917872.1.52356 WP_000917872.1.52361 WP_000917872.1.52438 WP_000917872.1.52446 WP_000917872.1.52456 WP_000917872.1.52469 WP_000917872.1.52527 WP_000917872.1.52528 WP_000917872.1.52571 WP_000917872.1.52582 WP_000917872.1.52586 WP_000917872.1.526 WP_000917872.1.52608 WP_000917872.1.52637 WP_000917872.1.52647 WP_000917872.1.52653 WP_000917872.1.52656 WP_000917872.1.52675 WP_000917872.1.52692 WP_000917872.1.5273 WP_000917872.1.52738 WP_000917872.1.52742 WP_000917872.1.52743 WP_000917872.1.52748 WP_000917872.1.52773 WP_000917872.1.52795 WP_000917872.1.52807 WP_000917872.1.52824 WP_000917872.1.52833 WP_000917872.1.52851 WP_000917872.1.52857 WP_000917872.1.52858 WP_000917872.1.52866 WP_000917872.1.52887 WP_000917872.1.52898 WP_000917872.1.52915 WP_000917872.1.52924 WP_000917872.1.52949 WP_000917872.1.52985 WP_000917872.1.5301 WP_000917872.1.53016 WP_000917872.1.53092 WP_000917872.1.53100 WP_000917872.1.53107 WP_000917872.1.53119 WP_000917872.1.5313 WP_000917872.1.53141 WP_000917872.1.53151 WP_000917872.1.53154 WP_000917872.1.53158 WP_000917872.1.53159 WP_000917872.1.5316 WP_000917872.1.53179 WP_000917872.1.53190 WP_000917872.1.53198 WP_000917872.1.53203 WP_000917872.1.53206 WP_000917872.1.53210 WP_000917872.1.53233 WP_000917872.1.53234 WP_000917872.1.53272 WP_000917872.1.53274 WP_000917872.1.53286 WP_000917872.1.53307 WP_000917872.1.53315 WP_000917872.1.53316 WP_000917872.1.53321 WP_000917872.1.53328 WP_000917872.1.5333 WP_000917872.1.53362 WP_000917872.1.53368 WP_000917872.1.53375 WP_000917872.1.53385 WP_000917872.1.53406 WP_000917872.1.53436 WP_000917872.1.53450 WP_000917872.1.53454 WP_000917872.1.53466 WP_000917872.1.5349 WP_000917872.1.53529 WP_000917872.1.53534 WP_000917872.1.53540 WP_000917872.1.53543 WP_000917872.1.53555 WP_000917872.1.53559 WP_000917872.1.5356 WP_000917872.1.53567 WP_000917872.1.53571 WP_000917872.1.5358 WP_000917872.1.53664 WP_000917872.1.53675 WP_000917872.1.53688 WP_000917872.1.53692 WP_000917872.1.53694 WP_000917872.1.53696 WP_000917872.1.53723 WP_000917872.1.5374 WP_000917872.1.53750 WP_000917872.1.53757 WP_000917872.1.53772 WP_000917872.1.53778 WP_000917872.1.53781 WP_000917872.1.53790 WP_000917872.1.53800 WP_000917872.1.53812 WP_000917872.1.53814 WP_000917872.1.53815 WP_000917872.1.53839 WP_000917872.1.53892 WP_000917872.1.53896 WP_000917872.1.53898 WP_000917872.1.53902 WP_000917872.1.53905 WP_000917872.1.5392 WP_000917872.1.53935 WP_000917872.1.53958 WP_000917872.1.53961 WP_000917872.1.53981 WP_000917872.1.53984 WP_000917872.1.54033 WP_000917872.1.54061 WP_000917872.1.54068 WP_000917872.1.54075 WP_000917872.1.54082 WP_000917872.1.54132 WP_000917872.1.54136 WP_000917872.1.5415 WP_000917872.1.54159 WP_000917872.1.54170 WP_000917872.1.54175 WP_000917872.1.54196 WP_000917872.1.542 WP_000917872.1.54203 WP_000917872.1.54209 WP_000917872.1.54259 WP_000917872.1.54271 WP_000917872.1.54273 WP_000917872.1.54274 WP_000917872.1.54283 WP_000917872.1.5430 WP_000917872.1.54319 WP_000917872.1.54324 WP_000917872.1.54340 WP_000917872.1.54364 WP_000917872.1.54366 WP_000917872.1.54371 WP_000917872.1.54400 WP_000917872.1.54431 WP_000917872.1.54442 WP_000917872.1.54469 WP_000917872.1.54482 WP_000917872.1.54500 WP_000917872.1.54526 WP_000917872.1.54558 WP_000917872.1.54569 WP_000917872.1.54589 WP_000917872.1.5459 WP_000917872.1.54607 WP_000917872.1.54615 WP_000917872.1.5462 WP_000917872.1.54644 WP_000917872.1.54662 WP_000917872.1.54667 WP_000917872.1.54678 WP_000917872.1.54681 WP_000917872.1.54722 WP_000917872.1.54748 WP_000917872.1.54749 WP_000917872.1.54764 WP_000917872.1.54774 WP_000917872.1.5481 WP_000917872.1.54827 WP_000917872.1.54833 WP_000917872.1.5485 WP_000917872.1.54865 WP_000917872.1.54877 WP_000917872.1.5493 WP_000917872.1.54935 WP_000917872.1.54936 WP_000917872.1.54979 WP_000917872.1.54984 WP_000917872.1.55008 WP_000917872.1.55010 WP_000917872.1.55034 WP_000917872.1.55152 WP_000917872.1.55156 WP_000917872.1.55163 WP_000917872.1.55165 WP_000917872.1.55166 WP_000917872.1.5517 WP_000917872.1.55178 WP_000917872.1.55200 WP_000917872.1.55215 WP_000917872.1.55223 WP_000917872.1.55224 WP_000917872.1.5525 WP_000917872.1.5527 WP_000917872.1.55285 WP_000917872.1.55290 WP_000917872.1.55294 WP_000917872.1.55310 WP_000917872.1.55317 WP_000917872.1.55325 WP_000917872.1.55361 WP_000917872.1.55379 WP_000917872.1.5539 WP_000917872.1.55418 WP_000917872.1.55430 WP_000917872.1.55461 WP_000917872.1.55468 WP_000917872.1.55475 WP_000917872.1.55477 WP_000917872.1.55496 WP_000917872.1.55506 WP_000917872.1.5552 WP_000917872.1.55528 WP_000917872.1.55545 WP_000917872.1.5555 WP_000917872.1.55554 WP_000917872.1.55559 WP_000917872.1.5560 WP_000917872.1.55604 WP_000917872.1.55623 WP_000917872.1.55639 WP_000917872.1.55640 WP_000917872.1.55647 WP_000917872.1.55672 WP_000917872.1.55680 WP_000917872.1.55699 WP_000917872.1.55706 WP_000917872.1.55718 WP_000917872.1.5572 WP_000917872.1.55725 WP_000917872.1.55743 WP_000917872.1.55768 WP_000917872.1.5577 WP_000917872.1.55780 WP_000917872.1.55782 WP_000917872.1.55796 WP_000917872.1.55803 WP_000917872.1.55853 WP_000917872.1.55923 WP_000917872.1.55948 WP_000917872.1.55967 WP_000917872.1.55973 WP_000917872.1.55993 WP_000917872.1.55995 WP_000917872.1.56002 WP_000917872.1.56004 WP_000917872.1.56012 WP_000917872.1.56059 WP_000917872.1.56069 WP_000917872.1.56070 WP_000917872.1.56097 WP_000917872.1.56100 WP_000917872.1.56105 WP_000917872.1.56130 WP_000917872.1.56144 WP_000917872.1.56152 WP_000917872.1.56172 WP_000917872.1.5621 WP_000917872.1.56222 WP_000917872.1.56226 WP_000917872.1.56235 WP_000917872.1.56238 WP_000917872.1.56244 WP_000917872.1.56247 WP_000917872.1.56261 WP_000917872.1.56263 WP_000917872.1.56286 WP_000917872.1.56303 WP_000917872.1.56304 WP_000917872.1.56305 WP_000917872.1.56311 WP_000917872.1.5633 WP_000917872.1.56354 WP_000917872.1.56368 WP_000917872.1.56370 WP_000917872.1.56374 WP_000917872.1.56385 WP_000917872.1.56389 WP_000917872.1.56393 WP_000917872.1.56396 WP_000917872.1.56413 WP_000917872.1.56414 WP_000917872.1.56419 WP_000917872.1.56420 WP_000917872.1.56423 WP_000917872.1.56438 WP_000917872.1.56468 WP_000917872.1.56512 WP_000917872.1.56514 WP_000917872.1.56535 WP_000917872.1.56559 WP_000917872.1.56560 WP_000917872.1.56585 WP_000917872.1.56597 WP_000917872.1.56601 WP_000917872.1.56614 WP_000917872.1.56615 WP_000917872.1.56640 WP_000917872.1.56660 WP_000917872.1.56671 WP_000917872.1.5668 WP_000917872.1.56682 WP_000917872.1.56724 WP_000917872.1.56791 WP_000917872.1.56824 WP_000917872.1.56825 WP_000917872.1.56851 WP_000917872.1.56853 WP_000917872.1.56861 WP_000917872.1.56875 WP_000917872.1.56877 WP_000917872.1.56887 WP_000917872.1.56889 WP_000917872.1.56893 WP_000917872.1.56898 WP_000917872.1.56905 WP_000917872.1.56942 WP_000917872.1.56950 WP_000917872.1.56981 WP_000917872.1.57026 WP_000917872.1.57039 WP_000917872.1.57056 WP_000917872.1.57076 WP_000917872.1.57084 WP_000917872.1.57101 WP_000917872.1.5711 WP_000917872.1.57125 WP_000917872.1.57137 WP_000917872.1.57143 WP_000917872.1.57147 WP_000917872.1.57149 WP_000917872.1.57168 WP_000917872.1.57179 WP_000917872.1.57186 WP_000917872.1.57187 WP_000917872.1.57232 WP_000917872.1.57233 WP_000917872.1.57244 WP_000917872.1.57246 WP_000917872.1.57296 WP_000917872.1.57307 WP_000917872.1.57342 WP_000917872.1.57344 WP_000917872.1.57356 WP_000917872.1.57357 WP_000917872.1.57362 WP_000917872.1.57377 WP_000917872.1.57418 WP_000917872.1.57433 WP_000917872.1.57494 WP_000917872.1.57495 WP_000917872.1.57510 WP_000917872.1.57515 WP_000917872.1.57521 WP_000917872.1.57529 WP_000917872.1.5753 WP_000917872.1.57534 WP_000917872.1.57555 WP_000917872.1.57559 WP_000917872.1.57576 WP_000917872.1.57601 WP_000917872.1.57607 WP_000917872.1.5761 WP_000917872.1.57631 WP_000917872.1.57641 WP_000917872.1.57684 WP_000917872.1.57699 WP_000917872.1.57709 WP_000917872.1.57710 WP_000917872.1.57735 WP_000917872.1.5774 WP_000917872.1.57763 WP_000917872.1.57778 WP_000917872.1.57781 WP_000917872.1.57785 WP_000917872.1.57797 WP_000917872.1.57800 WP_000917872.1.5781 WP_000917872.1.57835 WP_000917872.1.57857 WP_000917872.1.57862 WP_000917872.1.57873 WP_000917872.1.57890 WP_000917872.1.57891 WP_000917872.1.57893 WP_000917872.1.57902 WP_000917872.1.57965 WP_000917872.1.57972 WP_000917872.1.57978 WP_000917872.1.58008 WP_000917872.1.5801 WP_000917872.1.58040 WP_000917872.1.58041 WP_000917872.1.58044 WP_000917872.1.58081 WP_000917872.1.5809 WP_000917872.1.58090 WP_000917872.1.58131 WP_000917872.1.58132 WP_000917872.1.58144 WP_000917872.1.58153 WP_000917872.1.58157 WP_000917872.1.58173 WP_000917872.1.58191 WP_000917872.1.58194 WP_000917872.1.58239 WP_000917872.1.58249 WP_000917872.1.58251 WP_000917872.1.58252 WP_000917872.1.58261 WP_000917872.1.58274 WP_000917872.1.5828 WP_000917872.1.58282 WP_000917872.1.58290 WP_000917872.1.58301 WP_000917872.1.58324 WP_000917872.1.58326 WP_000917872.1.58334 WP_000917872.1.58357 WP_000917872.1.58358 WP_000917872.1.5836 WP_000917872.1.58372 WP_000917872.1.58407 WP_000917872.1.58416 WP_000917872.1.58418 WP_000917872.1.58442 WP_000917872.1.58443 WP_000917872.1.58451 WP_000917872.1.5846 WP_000917872.1.58467 WP_000917872.1.58485 WP_000917872.1.58486 WP_000917872.1.58489 WP_000917872.1.58537 WP_000917872.1.5854 WP_000917872.1.58548 WP_000917872.1.58564 WP_000917872.1.58568 WP_000917872.1.5858 WP_000917872.1.58583 WP_000917872.1.58604 WP_000917872.1.58633 WP_000917872.1.58652 WP_000917872.1.58662 WP_000917872.1.58663 WP_000917872.1.58669 WP_000917872.1.58675 WP_000917872.1.58698 WP_000917872.1.587 WP_000917872.1.58724 WP_000917872.1.58729 WP_000917872.1.58744 WP_000917872.1.58745 WP_000917872.1.58749 WP_000917872.1.5875 WP_000917872.1.5878 WP_000917872.1.58796 WP_000917872.1.58803 WP_000917872.1.58807 WP_000917872.1.58831 WP_000917872.1.58834 WP_000917872.1.58836 WP_000917872.1.58847 WP_000917872.1.5886 WP_000917872.1.58861 WP_000917872.1.58883 WP_000917872.1.58884 WP_000917872.1.58898 WP_000917872.1.58926 WP_000917872.1.58932 WP_000917872.1.58949 WP_000917872.1.58963 WP_000917872.1.58970 WP_000917872.1.58974 WP_000917872.1.59006 WP_000917872.1.59012 WP_000917872.1.59020 WP_000917872.1.59043 WP_000917872.1.59056 WP_000917872.1.59061 WP_000917872.1.59064 WP_000917872.1.59068 WP_000917872.1.5907 WP_000917872.1.59084 WP_000917872.1.59094 WP_000917872.1.59097 WP_000917872.1.59125 WP_000917872.1.59142 WP_000917872.1.59148 WP_000917872.1.59163 WP_000917872.1.59204 WP_000917872.1.59224 WP_000917872.1.59236 WP_000917872.1.59276 WP_000917872.1.59282 WP_000917872.1.5929 WP_000917872.1.59294 WP_000917872.1.59295 WP_000917872.1.59299 WP_000917872.1.59313 WP_000917872.1.59321 WP_000917872.1.59335 WP_000917872.1.59336 WP_000917872.1.59375 WP_000917872.1.59381 WP_000917872.1.59412 WP_000917872.1.59420 WP_000917872.1.59427 WP_000917872.1.59439 WP_000917872.1.59458 WP_000917872.1.59486 WP_000917872.1.5949 WP_000917872.1.59490 WP_000917872.1.59501 WP_000917872.1.59508 WP_000917872.1.59510 WP_000917872.1.59512 WP_000917872.1.59521 WP_000917872.1.5953 WP_000917872.1.59538 WP_000917872.1.59548 WP_000917872.1.59562 WP_000917872.1.59587 WP_000917872.1.59604 WP_000917872.1.59636 WP_000917872.1.59641 WP_000917872.1.59646 WP_000917872.1.59648 WP_000917872.1.59684 WP_000917872.1.5969 WP_000917872.1.59694 WP_000917872.1.59709 WP_000917872.1.59710 WP_000917872.1.59751 WP_000917872.1.59755 WP_000917872.1.59771 WP_000917872.1.5979 WP_000917872.1.59827 WP_000917872.1.59829 WP_000917872.1.59830 WP_000917872.1.59847 WP_000917872.1.59848 WP_000917872.1.59863 WP_000917872.1.59928 WP_000917872.1.5993 WP_000917872.1.59933 WP_000917872.1.59953 WP_000917872.1.59969 WP_000917872.1.59979 WP_000917872.1.59994 WP_000917872.1.60004 WP_000917872.1.60008 WP_000917872.1.60015 WP_000917872.1.60021 WP_000917872.1.60045 WP_000917872.1.60052 WP_000917872.1.60069 WP_000917872.1.60076 WP_000917872.1.60106 WP_000917872.1.60114 WP_000917872.1.60126 WP_000917872.1.60137 WP_000917872.1.60140 WP_000917872.1.60154 WP_000917872.1.60155 WP_000917872.1.60168 WP_000917872.1.60192 WP_000917872.1.60199 WP_000917872.1.60212 WP_000917872.1.60213 WP_000917872.1.60226 WP_000917872.1.60231 WP_000917872.1.60253 WP_000917872.1.60285 WP_000917872.1.60320 WP_000917872.1.60322 WP_000917872.1.60324 WP_000917872.1.6033 WP_000917872.1.60330 WP_000917872.1.60356 WP_000917872.1.60379 WP_000917872.1.6038 WP_000917872.1.60380 WP_000917872.1.6041 WP_000917872.1.60424 WP_000917872.1.60425 WP_000917872.1.60464 WP_000917872.1.60469 WP_000917872.1.60481 WP_000917872.1.60486 WP_000917872.1.605 WP_000917872.1.60503 WP_000917872.1.60507 WP_000917872.1.6052 WP_000917872.1.60545 WP_000917872.1.60560 WP_000917872.1.60561 WP_000917872.1.6058 WP_000917872.1.60584 WP_000917872.1.60597 WP_000917872.1.6060 WP_000917872.1.60608 WP_000917872.1.60622 WP_000917872.1.60643 WP_000917872.1.60661 WP_000917872.1.60676 WP_000917872.1.60708 WP_000917872.1.60713 WP_000917872.1.60725 WP_000917872.1.60746 WP_000917872.1.60760 WP_000917872.1.60772 WP_000917872.1.60783 WP_000917872.1.60792 WP_000917872.1.60794 WP_000917872.1.608 WP_000917872.1.60807 WP_000917872.1.60809 WP_000917872.1.60838 WP_000917872.1.60851 WP_000917872.1.60855 WP_000917872.1.60857 WP_000917872.1.6086 WP_000917872.1.60863 WP_000917872.1.60866 WP_000917872.1.60874 WP_000917872.1.60882 WP_000917872.1.60889 WP_000917872.1.60897 WP_000917872.1.6090 WP_000917872.1.60918 WP_000917872.1.60919 WP_000917872.1.60926 WP_000917872.1.60941 WP_000917872.1.60950 WP_000917872.1.60976 WP_000917872.1.60988 WP_000917872.1.60990 WP_000917872.1.6104 WP_000917872.1.61044 WP_000917872.1.61045 WP_000917872.1.61076 WP_000917872.1.61078 WP_000917872.1.6108 WP_000917872.1.61087 WP_000917872.1.61114 WP_000917872.1.61123 WP_000917872.1.6114 WP_000917872.1.61146 WP_000917872.1.61147 WP_000917872.1.61168 WP_000917872.1.61184 WP_000917872.1.61200 WP_000917872.1.61201 WP_000917872.1.61210 WP_000917872.1.61218 WP_000917872.1.61232 WP_000917872.1.61233 WP_000917872.1.6129 WP_000917872.1.61296 WP_000917872.1.61309 WP_000917872.1.61345 WP_000917872.1.61356 WP_000917872.1.61357 WP_000917872.1.61381 WP_000917872.1.61417 WP_000917872.1.6143 WP_000917872.1.61434 WP_000917872.1.61497 WP_000917872.1.61501 WP_000917872.1.61509 WP_000917872.1.61511 WP_000917872.1.61519 WP_000917872.1.61539 WP_000917872.1.61542 WP_000917872.1.61553 WP_000917872.1.61574 WP_000917872.1.61582 WP_000917872.1.61594 WP_000917872.1.61595 WP_000917872.1.61609 WP_000917872.1.6164 WP_000917872.1.61649 WP_000917872.1.61652 WP_000917872.1.61667 WP_000917872.1.61671 WP_000917872.1.61694 WP_000917872.1.61697 WP_000917872.1.61712 WP_000917872.1.61714 WP_000917872.1.61730 WP_000917872.1.61732 WP_000917872.1.61737 WP_000917872.1.61743 WP_000917872.1.61783 WP_000917872.1.61809 WP_000917872.1.61857 WP_000917872.1.61877 WP_000917872.1.6190 WP_000917872.1.61908 WP_000917872.1.61918 WP_000917872.1.61920 WP_000917872.1.61922 WP_000917872.1.61924 WP_000917872.1.61952 WP_000917872.1.61968 WP_000917872.1.62007 WP_000917872.1.62020 WP_000917872.1.62025 WP_000917872.1.62063 WP_000917872.1.62076 WP_000917872.1.6209 WP_000917872.1.6210 WP_000917872.1.62108 WP_000917872.1.62120 WP_000917872.1.62122 WP_000917872.1.62124 WP_000917872.1.62142 WP_000917872.1.62144 WP_000917872.1.62158 WP_000917872.1.62184 WP_000917872.1.62195 WP_000917872.1.62199 WP_000917872.1.62201 WP_000917872.1.62204 WP_000917872.1.62210 WP_000917872.1.62219 WP_000917872.1.62222 WP_000917872.1.62223 WP_000917872.1.62241 WP_000917872.1.62245 WP_000917872.1.62257 WP_000917872.1.62302 WP_000917872.1.62304 WP_000917872.1.62310 WP_000917872.1.62314 WP_000917872.1.62323 WP_000917872.1.62333 WP_000917872.1.62338 WP_000917872.1.62344 WP_000917872.1.62361 WP_000917872.1.62364 WP_000917872.1.62374 WP_000917872.1.62380 WP_000917872.1.62403 WP_000917872.1.62404 WP_000917872.1.62411 WP_000917872.1.62412 WP_000917872.1.62436 WP_000917872.1.62475 WP_000917872.1.62486 WP_000917872.1.62488 WP_000917872.1.62504 WP_000917872.1.62522 WP_000917872.1.6253 WP_000917872.1.62536 WP_000917872.1.62564 WP_000917872.1.62570 WP_000917872.1.62619 WP_000917872.1.62640 WP_000917872.1.62648 WP_000917872.1.62677 WP_000917872.1.62686 WP_000917872.1.62693 WP_000917872.1.627 WP_000917872.1.62725 WP_000917872.1.62745 WP_000917872.1.62751 WP_000917872.1.62757 WP_000917872.1.62798 WP_000917872.1.62825 WP_000917872.1.62828 WP_000917872.1.62853 WP_000917872.1.62910 WP_000917872.1.62913 WP_000917872.1.6292 WP_000917872.1.62932 WP_000917872.1.62955 WP_000917872.1.62960 WP_000917872.1.62976 WP_000917872.1.62983 WP_000917872.1.62988 WP_000917872.1.63016 WP_000917872.1.63025 WP_000917872.1.63043 WP_000917872.1.63045 WP_000917872.1.63063 WP_000917872.1.63069 WP_000917872.1.63087 WP_000917872.1.63102 WP_000917872.1.63118 WP_000917872.1.63129 WP_000917872.1.63135 WP_000917872.1.63150 WP_000917872.1.63155 WP_000917872.1.63169 WP_000917872.1.63181 WP_000917872.1.63203 WP_000917872.1.63229 WP_000917872.1.63234 WP_000917872.1.63250 WP_000917872.1.63256 WP_000917872.1.63290 WP_000917872.1.63297 WP_000917872.1.63358 WP_000917872.1.63382 WP_000917872.1.63422 WP_000917872.1.63432 WP_000917872.1.63448 WP_000917872.1.63455 WP_000917872.1.63461 WP_000917872.1.63479 WP_000917872.1.63497 WP_000917872.1.63499 WP_000917872.1.63509 WP_000917872.1.63513 WP_000917872.1.63514 WP_000917872.1.63525 WP_000917872.1.63529 WP_000917872.1.63532 WP_000917872.1.63568 WP_000917872.1.6357 WP_000917872.1.63577 WP_000917872.1.63583 WP_000917872.1.63585 WP_000917872.1.63592 WP_000917872.1.63603 WP_000917872.1.63633 WP_000917872.1.63663 WP_000917872.1.63664 WP_000917872.1.6367 WP_000917872.1.63677 WP_000917872.1.63690 WP_000917872.1.6370 WP_000917872.1.63718 WP_000917872.1.63731 WP_000917872.1.63736 WP_000917872.1.63748 WP_000917872.1.6375 WP_000917872.1.63757 WP_000917872.1.63766 WP_000917872.1.63781 WP_000917872.1.63782 WP_000917872.1.63797 WP_000917872.1.63816 WP_000917872.1.63824 WP_000917872.1.63831 WP_000917872.1.63834 WP_000917872.1.63851 WP_000917872.1.63860 WP_000917872.1.63863 WP_000917872.1.63864 WP_000917872.1.63866 WP_000917872.1.63876 WP_000917872.1.6389 WP_000917872.1.63901 WP_000917872.1.63903 WP_000917872.1.63912 WP_000917872.1.63934 WP_000917872.1.63955 WP_000917872.1.63958 WP_000917872.1.63963 WP_000917872.1.63977 WP_000917872.1.6399 WP_000917872.1.63992 WP_000917872.1.64007 WP_000917872.1.64010 WP_000917872.1.64018 WP_000917872.1.64032 WP_000917872.1.64034 WP_000917872.1.64036 WP_000917872.1.64046 WP_000917872.1.64072 WP_000917872.1.64085 WP_000917872.1.64087 WP_000917872.1.64109 WP_000917872.1.64121 WP_000917872.1.6415 WP_000917872.1.64157 WP_000917872.1.64217 WP_000917872.1.64229 WP_000917872.1.6423 WP_000917872.1.64242 WP_000917872.1.64244 WP_000917872.1.64266 WP_000917872.1.64293 WP_000917872.1.64294 WP_000917872.1.64332 WP_000917872.1.64350 WP_000917872.1.6437 WP_000917872.1.64374 WP_000917872.1.64376 WP_000917872.1.64385 WP_000917872.1.64387 WP_000917872.1.64389 WP_000917872.1.644 WP_000917872.1.64403 WP_000917872.1.64412 WP_000917872.1.64462 WP_000917872.1.64471 WP_000917872.1.64500 WP_000917872.1.64501 WP_000917872.1.6451 WP_000917872.1.64538 WP_000917872.1.64569 WP_000917872.1.64597 WP_000917872.1.64632 WP_000917872.1.64648 WP_000917872.1.64649 WP_000917872.1.64654 WP_000917872.1.64662 WP_000917872.1.64663 WP_000917872.1.64667 WP_000917872.1.64674 WP_000917872.1.64702 WP_000917872.1.64709 WP_000917872.1.64710 WP_000917872.1.64711 WP_000917872.1.64715 WP_000917872.1.64744 WP_000917872.1.64757 WP_000917872.1.64758 WP_000917872.1.64763 WP_000917872.1.64771 WP_000917872.1.64781 WP_000917872.1.64798 WP_000917872.1.64817 WP_000917872.1.64831 WP_000917872.1.64847 WP_000917872.1.6487 WP_000917872.1.6489 WP_000917872.1.64891 WP_000917872.1.64894 WP_000917872.1.64919 WP_000917872.1.64920 WP_000917872.1.64944 WP_000917872.1.64972 WP_000917872.1.64974 WP_000917872.1.64977 WP_000917872.1.65011 WP_000917872.1.65016 WP_000917872.1.65018 WP_000917872.1.65022 WP_000917872.1.65027 WP_000917872.1.65028 WP_000917872.1.65052 WP_000917872.1.65054 WP_000917872.1.65075 WP_000917872.1.6514 WP_000917872.1.65163 WP_000917872.1.65171 WP_000917872.1.65172 WP_000917872.1.65185 WP_000917872.1.65191 WP_000917872.1.65200 WP_000917872.1.65211 WP_000917872.1.65218 WP_000917872.1.65226 WP_000917872.1.65248 WP_000917872.1.65249 WP_000917872.1.6525 WP_000917872.1.65266 WP_000917872.1.65269 WP_000917872.1.65308 WP_000917872.1.65348 WP_000917872.1.6535 WP_000917872.1.65357 WP_000917872.1.65363 WP_000917872.1.65394 WP_000917872.1.65395 WP_000917872.1.65437 WP_000917872.1.65459 WP_000917872.1.65463 WP_000917872.1.65474 WP_000917872.1.65475 WP_000917872.1.65487 WP_000917872.1.6549 WP_000917872.1.65499 WP_000917872.1.6550 WP_000917872.1.65508 WP_000917872.1.65538 WP_000917872.1.6554 WP_000917872.1.65558 WP_000917872.1.65572 WP_000917872.1.6558 WP_000917872.1.6560 WP_000917872.1.65601 WP_000917872.1.6561 WP_000917872.1.65633 WP_000917872.1.6565 WP_000917872.1.65650 WP_000917872.1.65687 WP_000917872.1.65696 WP_000917872.1.65697 WP_000917872.1.65698 WP_000917872.1.65699 WP_000917872.1.6572 WP_000917872.1.65737 WP_000917872.1.6575 WP_000917872.1.65755 WP_000917872.1.65771 WP_000917872.1.65782 WP_000917872.1.65790 WP_000917872.1.65795 WP_000917872.1.65812 WP_000917872.1.65818 WP_000917872.1.65838 WP_000917872.1.65846 WP_000917872.1.65849 WP_000917872.1.65863 WP_000917872.1.65876 WP_000917872.1.65881 WP_000917872.1.65883 WP_000917872.1.65901 WP_000917872.1.6594 WP_000917872.1.65940 WP_000917872.1.6595 WP_000917872.1.65956 WP_000917872.1.65968 WP_000917872.1.65985 WP_000917872.1.66021 WP_000917872.1.66031 WP_000917872.1.66049 WP_000917872.1.66052 WP_000917872.1.66064 WP_000917872.1.66074 WP_000917872.1.66082 WP_000917872.1.66085 WP_000917872.1.66109 WP_000917872.1.66122 WP_000917872.1.66145 WP_000917872.1.66167 WP_000917872.1.66171 WP_000917872.1.66183 WP_000917872.1.6620 WP_000917872.1.66216 WP_000917872.1.66234 WP_000917872.1.66235 WP_000917872.1.66250 WP_000917872.1.66270 WP_000917872.1.66272 WP_000917872.1.66273 WP_000917872.1.66289 WP_000917872.1.6630 WP_000917872.1.66314 WP_000917872.1.66315 WP_000917872.1.66324 WP_000917872.1.66330 WP_000917872.1.6634 WP_000917872.1.66358 WP_000917872.1.66361 WP_000917872.1.66362 WP_000917872.1.66368 WP_000917872.1.6638 WP_000917872.1.66385 WP_000917872.1.6640 WP_000917872.1.66400 WP_000917872.1.66428 WP_000917872.1.66446 WP_000917872.1.66462 WP_000917872.1.66480 WP_000917872.1.66492 WP_000917872.1.66506 WP_000917872.1.66534 WP_000917872.1.66539 WP_000917872.1.66630 WP_000917872.1.66665 WP_000917872.1.66678 WP_000917872.1.66681 WP_000917872.1.66684 WP_000917872.1.66698 WP_000917872.1.66702 WP_000917872.1.66733 WP_000917872.1.66755 WP_000917872.1.66759 WP_000917872.1.66779 WP_000917872.1.6680 WP_000917872.1.66800 WP_000917872.1.66801 WP_000917872.1.66807 WP_000917872.1.66820 WP_000917872.1.66824 WP_000917872.1.66825 WP_000917872.1.66834 WP_000917872.1.66860 WP_000917872.1.66876 WP_000917872.1.66901 WP_000917872.1.6692 WP_000917872.1.66937 WP_000917872.1.66953 WP_000917872.1.66955 WP_000917872.1.66959 WP_000917872.1.66962 WP_000917872.1.66981 WP_000917872.1.67 WP_000917872.1.67024 WP_000917872.1.67037 WP_000917872.1.67042 WP_000917872.1.67045 WP_000917872.1.67075 WP_000917872.1.6710 WP_000917872.1.67100 WP_000917872.1.67101 WP_000917872.1.67143 WP_000917872.1.67173 WP_000917872.1.67175 WP_000917872.1.67181 WP_000917872.1.67184 WP_000917872.1.67201 WP_000917872.1.67211 WP_000917872.1.67228 WP_000917872.1.67235 WP_000917872.1.67237 WP_000917872.1.67268 WP_000917872.1.67279 WP_000917872.1.67288 WP_000917872.1.67336 WP_000917872.1.67339 WP_000917872.1.67347 WP_000917872.1.67374 WP_000917872.1.67387 WP_000917872.1.6739 WP_000917872.1.67394 WP_000917872.1.67397 WP_000917872.1.67403 WP_000917872.1.67405 WP_000917872.1.67424 WP_000917872.1.67430 WP_000917872.1.67442 WP_000917872.1.67465 WP_000917872.1.67539 WP_000917872.1.67552 WP_000917872.1.67556 WP_000917872.1.67576 WP_000917872.1.6760 WP_000917872.1.67603 WP_000917872.1.67604 WP_000917872.1.67617 WP_000917872.1.67619 WP_000917872.1.67625 WP_000917872.1.67627 WP_000917872.1.67633 WP_000917872.1.67641 WP_000917872.1.67657 WP_000917872.1.67673 WP_000917872.1.67682 WP_000917872.1.67700 WP_000917872.1.67707 WP_000917872.1.67718 WP_000917872.1.67729 WP_000917872.1.67731 WP_000917872.1.67772 WP_000917872.1.67774 WP_000917872.1.67776 WP_000917872.1.67814 WP_000917872.1.6782 WP_000917872.1.67820 WP_000917872.1.67825 WP_000917872.1.67829 WP_000917872.1.6785 WP_000917872.1.67887 WP_000917872.1.67905 WP_000917872.1.67910 WP_000917872.1.67924 WP_000917872.1.67932 WP_000917872.1.67942 WP_000917872.1.67954 WP_000917872.1.67969 WP_000917872.1.67970 WP_000917872.1.67977 WP_000917872.1.67988 WP_000917872.1.68 WP_000917872.1.68036 WP_000917872.1.68043 WP_000917872.1.68073 WP_000917872.1.68075 WP_000917872.1.68105 WP_000917872.1.68113 WP_000917872.1.68115 WP_000917872.1.68131 WP_000917872.1.68140 WP_000917872.1.68147 WP_000917872.1.68159 WP_000917872.1.68167 WP_000917872.1.68182 WP_000917872.1.6819 WP_000917872.1.68201 WP_000917872.1.68206 WP_000917872.1.68210 WP_000917872.1.6827 WP_000917872.1.68275 WP_000917872.1.68285 WP_000917872.1.6833 WP_000917872.1.68359 WP_000917872.1.68401 WP_000917872.1.68420 WP_000917872.1.68477 WP_000917872.1.68478 WP_000917872.1.6849 WP_000917872.1.685 WP_000917872.1.68514 WP_000917872.1.68532 WP_000917872.1.68547 WP_000917872.1.68564 WP_000917872.1.6857 WP_000917872.1.6858 WP_000917872.1.68589 WP_000917872.1.68591 WP_000917872.1.68629 WP_000917872.1.68652 WP_000917872.1.68655 WP_000917872.1.68656 WP_000917872.1.68658 WP_000917872.1.68677 WP_000917872.1.68688 WP_000917872.1.6869 WP_000917872.1.68690 WP_000917872.1.68742 WP_000917872.1.6875 WP_000917872.1.68770 WP_000917872.1.68778 WP_000917872.1.68787 WP_000917872.1.6879 WP_000917872.1.68809 WP_000917872.1.68816 WP_000917872.1.68818 WP_000917872.1.6882 WP_000917872.1.6883 WP_000917872.1.68893 WP_000917872.1.68894 WP_000917872.1.68895 WP_000917872.1.68914 WP_000917872.1.68928 WP_000917872.1.68958 WP_000917872.1.68966 WP_000917872.1.68975 WP_000917872.1.68999 WP_000917872.1.69001 WP_000917872.1.69006 WP_000917872.1.69011 WP_000917872.1.69029 WP_000917872.1.6904 WP_000917872.1.69042 WP_000917872.1.6905 WP_000917872.1.69053 WP_000917872.1.69058 WP_000917872.1.6907 WP_000917872.1.69080 WP_000917872.1.69086 WP_000917872.1.6913 WP_000917872.1.69131 WP_000917872.1.69146 WP_000917872.1.69151 WP_000917872.1.69170 WP_000917872.1.69210 WP_000917872.1.69236 WP_000917872.1.69255 WP_000917872.1.69270 WP_000917872.1.69273 WP_000917872.1.69282 WP_000917872.1.69288 WP_000917872.1.69296 WP_000917872.1.69346 WP_000917872.1.69357 WP_000917872.1.69359 WP_000917872.1.69371 WP_000917872.1.69376 WP_000917872.1.69385 WP_000917872.1.69396 WP_000917872.1.69397 WP_000917872.1.69433 WP_000917872.1.69465 WP_000917872.1.69466 WP_000917872.1.69485 WP_000917872.1.69515 WP_000917872.1.6954 WP_000917872.1.69554 WP_000917872.1.69564 WP_000917872.1.69575 WP_000917872.1.69588 WP_000917872.1.69592 WP_000917872.1.69597 WP_000917872.1.69611 WP_000917872.1.69616 WP_000917872.1.69636 WP_000917872.1.69642 WP_000917872.1.69644 WP_000917872.1.69656 WP_000917872.1.69657 WP_000917872.1.69690 WP_000917872.1.69696 WP_000917872.1.69704 WP_000917872.1.69710 WP_000917872.1.69754 WP_000917872.1.69758 WP_000917872.1.69760 WP_000917872.1.69767 WP_000917872.1.69785 WP_000917872.1.69787 WP_000917872.1.69790 WP_000917872.1.69817 WP_000917872.1.69839 WP_000917872.1.69890 WP_000917872.1.69923 WP_000917872.1.69948 WP_000917872.1.69953 WP_000917872.1.69965 WP_000917872.1.69977 WP_000917872.1.69982 WP_000917872.1.70003 WP_000917872.1.70010 WP_000917872.1.70028 WP_000917872.1.70047 WP_000917872.1.70049 WP_000917872.1.70058 WP_000917872.1.70061 WP_000917872.1.70087 WP_000917872.1.70088 WP_000917872.1.7010 WP_000917872.1.7014 WP_000917872.1.7016 WP_000917872.1.70169 WP_000917872.1.70183 WP_000917872.1.70205 WP_000917872.1.7021 WP_000917872.1.70240 WP_000917872.1.70241 WP_000917872.1.70248 WP_000917872.1.70249 WP_000917872.1.70261 WP_000917872.1.70262 WP_000917872.1.70269 WP_000917872.1.70272 WP_000917872.1.70281 WP_000917872.1.70289 WP_000917872.1.70290 WP_000917872.1.70303 WP_000917872.1.70314 WP_000917872.1.70321 WP_000917872.1.70326 WP_000917872.1.70327 WP_000917872.1.7033 WP_000917872.1.70355 WP_000917872.1.70427 WP_000917872.1.70433 WP_000917872.1.7044 WP_000917872.1.70440 WP_000917872.1.70447 WP_000917872.1.70485 WP_000917872.1.70488 WP_000917872.1.70491 WP_000917872.1.70523 WP_000917872.1.70531 WP_000917872.1.70545 WP_000917872.1.70547 WP_000917872.1.7055 WP_000917872.1.70580 WP_000917872.1.70596 WP_000917872.1.7060 WP_000917872.1.70623 WP_000917872.1.70643 WP_000917872.1.70644 WP_000917872.1.70662 WP_000917872.1.70671 WP_000917872.1.70678 WP_000917872.1.70679 WP_000917872.1.70683 WP_000917872.1.70685 WP_000917872.1.70692 WP_000917872.1.70708 WP_000917872.1.70712 WP_000917872.1.70717 WP_000917872.1.70731 WP_000917872.1.70732 WP_000917872.1.70733 WP_000917872.1.70761 WP_000917872.1.70772 WP_000917872.1.70785 WP_000917872.1.70792 WP_000917872.1.70797 WP_000917872.1.70837 WP_000917872.1.70845 WP_000917872.1.70846 WP_000917872.1.70869 WP_000917872.1.70883 WP_000917872.1.70899 WP_000917872.1.70914 WP_000917872.1.70922 WP_000917872.1.70929 WP_000917872.1.7093 WP_000917872.1.70948 WP_000917872.1.70959 WP_000917872.1.70969 WP_000917872.1.70971 WP_000917872.1.70977 WP_000917872.1.70981 WP_000917872.1.70985 WP_000917872.1.70986 WP_000917872.1.70995 WP_000917872.1.71007 WP_000917872.1.71010 WP_000917872.1.71023 WP_000917872.1.71039 WP_000917872.1.71057 WP_000917872.1.71069 WP_000917872.1.71081 WP_000917872.1.71088 WP_000917872.1.7110 WP_000917872.1.71116 WP_000917872.1.71117 WP_000917872.1.71120 WP_000917872.1.71146 WP_000917872.1.71150 WP_000917872.1.71165 WP_000917872.1.71171 WP_000917872.1.71172 WP_000917872.1.71184 WP_000917872.1.71186 WP_000917872.1.71188 WP_000917872.1.71201 WP_000917872.1.71202 WP_000917872.1.71243 WP_000917872.1.71248 WP_000917872.1.71268 WP_000917872.1.71299 WP_000917872.1.71305 WP_000917872.1.71306 WP_000917872.1.71337 WP_000917872.1.7134 WP_000917872.1.71363 WP_000917872.1.71368 WP_000917872.1.71378 WP_000917872.1.714 WP_000917872.1.71401 WP_000917872.1.71407 WP_000917872.1.71418 WP_000917872.1.7142 WP_000917872.1.71446 WP_000917872.1.71450 WP_000917872.1.71452 WP_000917872.1.71455 WP_000917872.1.71456 WP_000917872.1.71487 WP_000917872.1.71500 WP_000917872.1.71523 WP_000917872.1.71542 WP_000917872.1.71566 WP_000917872.1.71583 WP_000917872.1.71600 WP_000917872.1.71626 WP_000917872.1.71636 WP_000917872.1.71640 WP_000917872.1.71649 WP_000917872.1.71651 WP_000917872.1.71653 WP_000917872.1.71656 WP_000917872.1.71658 WP_000917872.1.71691 WP_000917872.1.71702 WP_000917872.1.71716 WP_000917872.1.7174 WP_000917872.1.71746 WP_000917872.1.71750 WP_000917872.1.71756 WP_000917872.1.71798 WP_000917872.1.71845 WP_000917872.1.71848 WP_000917872.1.71872 WP_000917872.1.71881 WP_000917872.1.71908 WP_000917872.1.71923 WP_000917872.1.71941 WP_000917872.1.71950 WP_000917872.1.71952 WP_000917872.1.71954 WP_000917872.1.71973 WP_000917872.1.71979 WP_000917872.1.71984 WP_000917872.1.71985 WP_000917872.1.720 WP_000917872.1.72003 WP_000917872.1.72065 WP_000917872.1.72068 WP_000917872.1.72073 WP_000917872.1.72100 WP_000917872.1.72107 WP_000917872.1.72119 WP_000917872.1.72121 WP_000917872.1.72182 WP_000917872.1.72188 WP_000917872.1.72190 WP_000917872.1.72203 WP_000917872.1.72220 WP_000917872.1.72221 WP_000917872.1.72226 WP_000917872.1.72234 WP_000917872.1.72243 WP_000917872.1.72254 WP_000917872.1.72269 WP_000917872.1.72277 WP_000917872.1.72281 WP_000917872.1.72283 WP_000917872.1.72300 WP_000917872.1.72325 WP_000917872.1.72339 WP_000917872.1.72350 WP_000917872.1.72351 WP_000917872.1.72372 WP_000917872.1.72376 WP_000917872.1.72382 WP_000917872.1.72383 WP_000917872.1.72412 WP_000917872.1.7243 WP_000917872.1.72438 WP_000917872.1.72461 WP_000917872.1.72470 WP_000917872.1.72527 WP_000917872.1.72532 WP_000917872.1.7255 WP_000917872.1.72594 WP_000917872.1.72602 WP_000917872.1.72625 WP_000917872.1.72629 WP_000917872.1.72631 WP_000917872.1.72638 WP_000917872.1.72667 WP_000917872.1.72671 WP_000917872.1.72674 WP_000917872.1.72689 WP_000917872.1.72716 WP_000917872.1.72718 WP_000917872.1.72724 WP_000917872.1.72728 WP_000917872.1.72789 WP_000917872.1.72793 WP_000917872.1.72797 WP_000917872.1.72827 WP_000917872.1.72828 WP_000917872.1.72843 WP_000917872.1.72850 WP_000917872.1.72865 WP_000917872.1.72871 WP_000917872.1.72872 WP_000917872.1.72887 WP_000917872.1.72892 WP_000917872.1.72894 WP_000917872.1.72896 WP_000917872.1.72897 WP_000917872.1.72944 WP_000917872.1.72946 WP_000917872.1.7295 WP_000917872.1.72968 WP_000917872.1.72969 WP_000917872.1.72975 WP_000917872.1.72987 WP_000917872.1.7304 WP_000917872.1.73052 WP_000917872.1.73062 WP_000917872.1.73068 WP_000917872.1.73102 WP_000917872.1.7311 WP_000917872.1.73114 WP_000917872.1.73125 WP_000917872.1.73144 WP_000917872.1.7315 WP_000917872.1.7316 WP_000917872.1.73164 WP_000917872.1.73177 WP_000917872.1.73180 WP_000917872.1.73200 WP_000917872.1.73242 WP_000917872.1.73258 WP_000917872.1.73270 WP_000917872.1.73285 WP_000917872.1.7332 WP_000917872.1.73328 WP_000917872.1.7333 WP_000917872.1.7334 WP_000917872.1.73352 WP_000917872.1.73362 WP_000917872.1.73377 WP_000917872.1.73379 WP_000917872.1.73389 WP_000917872.1.73425 WP_000917872.1.73461 WP_000917872.1.73481 WP_000917872.1.73488 WP_000917872.1.73504 WP_000917872.1.73512 WP_000917872.1.7353 WP_000917872.1.73535 WP_000917872.1.73544 WP_000917872.1.7356 WP_000917872.1.73561 WP_000917872.1.73581 WP_000917872.1.73596 WP_000917872.1.73598 WP_000917872.1.7361 WP_000917872.1.73617 WP_000917872.1.73648 WP_000917872.1.73667 WP_000917872.1.73669 WP_000917872.1.73701 WP_000917872.1.73708 WP_000917872.1.7374 WP_000917872.1.73753 WP_000917872.1.73758 WP_000917872.1.73764 WP_000917872.1.73768 WP_000917872.1.73794 WP_000917872.1.73804 WP_000917872.1.73831 WP_000917872.1.73847 WP_000917872.1.73849 WP_000917872.1.7386 WP_000917872.1.7387 WP_000917872.1.73901 WP_000917872.1.73924 WP_000917872.1.73926 WP_000917872.1.7394 WP_000917872.1.73945 WP_000917872.1.73948 WP_000917872.1.73956 WP_000917872.1.73958 WP_000917872.1.73965 WP_000917872.1.73999 WP_000917872.1.74024 WP_000917872.1.74028 WP_000917872.1.74030 WP_000917872.1.74038 WP_000917872.1.74040 WP_000917872.1.74043 WP_000917872.1.74049 WP_000917872.1.7405 WP_000917872.1.74058 WP_000917872.1.74070 WP_000917872.1.74077 WP_000917872.1.74089 WP_000917872.1.74117 WP_000917872.1.74135 WP_000917872.1.74174 WP_000917872.1.74181 WP_000917872.1.74191 WP_000917872.1.74207 WP_000917872.1.74214 WP_000917872.1.74228 WP_000917872.1.74241 WP_000917872.1.74248 WP_000917872.1.74285 WP_000917872.1.743 WP_000917872.1.7430 WP_000917872.1.74300 WP_000917872.1.74317 WP_000917872.1.7433 WP_000917872.1.74379 WP_000917872.1.74402 WP_000917872.1.74410 WP_000917872.1.74414 WP_000917872.1.74415 WP_000917872.1.74418 WP_000917872.1.74428 WP_000917872.1.7444 WP_000917872.1.74454 WP_000917872.1.74466 WP_000917872.1.74469 WP_000917872.1.74481 WP_000917872.1.745 WP_000917872.1.74500 WP_000917872.1.74529 WP_000917872.1.74545 WP_000917872.1.74570 WP_000917872.1.74578 WP_000917872.1.7458 WP_000917872.1.74616 WP_000917872.1.74620 WP_000917872.1.74621 WP_000917872.1.74632 WP_000917872.1.74639 WP_000917872.1.74644 WP_000917872.1.74647 WP_000917872.1.74673 WP_000917872.1.74677 WP_000917872.1.74699 WP_000917872.1.74702 WP_000917872.1.74741 WP_000917872.1.74745 WP_000917872.1.74757 WP_000917872.1.74806 WP_000917872.1.74807 WP_000917872.1.74826 WP_000917872.1.74831 WP_000917872.1.74876 WP_000917872.1.74884 WP_000917872.1.74894 WP_000917872.1.7491 WP_000917872.1.74929 WP_000917872.1.74939 WP_000917872.1.74946 WP_000917872.1.74972 WP_000917872.1.74973 WP_000917872.1.74992 WP_000917872.1.74996 WP_000917872.1.75051 WP_000917872.1.75056 WP_000917872.1.75058 WP_000917872.1.7507 WP_000917872.1.75089 WP_000917872.1.75114 WP_000917872.1.75116 WP_000917872.1.75129 WP_000917872.1.75134 WP_000917872.1.75148 WP_000917872.1.75150 WP_000917872.1.75159 WP_000917872.1.75168 WP_000917872.1.75177 WP_000917872.1.75180 WP_000917872.1.75187 WP_000917872.1.75237 WP_000917872.1.75273 WP_000917872.1.75288 WP_000917872.1.75296 WP_000917872.1.75301 WP_000917872.1.7531 WP_000917872.1.75334 WP_000917872.1.75362 WP_000917872.1.75371 WP_000917872.1.75385 WP_000917872.1.75392 WP_000917872.1.75400 WP_000917872.1.75402 WP_000917872.1.75413 WP_000917872.1.7543 WP_000917872.1.75433 WP_000917872.1.75450 WP_000917872.1.75494 WP_000917872.1.75532 WP_000917872.1.75565 WP_000917872.1.7558 WP_000917872.1.75585 WP_000917872.1.75593 WP_000917872.1.75607 WP_000917872.1.75609 WP_000917872.1.75610 WP_000917872.1.75626 WP_000917872.1.75633 WP_000917872.1.75664 WP_000917872.1.75703 WP_000917872.1.75716 WP_000917872.1.75718 WP_000917872.1.75740 WP_000917872.1.75745 WP_000917872.1.75751 WP_000917872.1.75760 WP_000917872.1.75764 WP_000917872.1.75793 WP_000917872.1.75794 WP_000917872.1.75810 WP_000917872.1.75837 WP_000917872.1.75844 WP_000917872.1.75863 WP_000917872.1.75873 WP_000917872.1.75874 WP_000917872.1.75884 WP_000917872.1.75886 WP_000917872.1.75898 WP_000917872.1.75902 WP_000917872.1.75932 WP_000917872.1.75945 WP_000917872.1.76 WP_000917872.1.76020 WP_000917872.1.76024 WP_000917872.1.76055 WP_000917872.1.76081 WP_000917872.1.76097 WP_000917872.1.76102 WP_000917872.1.76108 WP_000917872.1.76115 WP_000917872.1.76116 WP_000917872.1.76122 WP_000917872.1.76137 WP_000917872.1.76156 WP_000917872.1.76162 WP_000917872.1.76164 WP_000917872.1.76170 WP_000917872.1.76186 WP_000917872.1.76197 WP_000917872.1.76208 WP_000917872.1.76252 WP_000917872.1.76256 WP_000917872.1.7629 WP_000917872.1.76301 WP_000917872.1.76327 WP_000917872.1.7633 WP_000917872.1.76339 WP_000917872.1.7634 WP_000917872.1.76345 WP_000917872.1.76346 WP_000917872.1.76364 WP_000917872.1.76366 WP_000917872.1.76417 WP_000917872.1.76434 WP_000917872.1.76445 WP_000917872.1.76451 WP_000917872.1.7646 WP_000917872.1.76471 WP_000917872.1.76495 WP_000917872.1.76510 WP_000917872.1.76529 WP_000917872.1.76532 WP_000917872.1.7655 WP_000917872.1.76558 WP_000917872.1.7657 WP_000917872.1.76572 WP_000917872.1.7660 WP_000917872.1.76611 WP_000917872.1.76641 WP_000917872.1.76651 WP_000917872.1.76653 WP_000917872.1.76673 WP_000917872.1.76706 WP_000917872.1.7672 WP_000917872.1.76721 WP_000917872.1.76738 WP_000917872.1.76756 WP_000917872.1.76760 WP_000917872.1.76776 WP_000917872.1.76788 WP_000917872.1.76799 WP_000917872.1.76806 WP_000917872.1.7684 WP_000917872.1.76854 WP_000917872.1.76866 WP_000917872.1.76875 WP_000917872.1.76880 WP_000917872.1.76899 WP_000917872.1.76913 WP_000917872.1.76916 WP_000917872.1.76932 WP_000917872.1.76968 WP_000917872.1.76973 WP_000917872.1.76988 WP_000917872.1.77016 WP_000917872.1.77017 WP_000917872.1.77033 WP_000917872.1.77038 WP_000917872.1.77047 WP_000917872.1.77067 WP_000917872.1.77080 WP_000917872.1.77087 WP_000917872.1.77090 WP_000917872.1.77111 WP_000917872.1.7712 WP_000917872.1.77177 WP_000917872.1.77180 WP_000917872.1.77184 WP_000917872.1.77241 WP_000917872.1.77244 WP_000917872.1.77267 WP_000917872.1.77271 WP_000917872.1.77292 WP_000917872.1.77299 WP_000917872.1.77306 WP_000917872.1.77313 WP_000917872.1.77349 WP_000917872.1.77356 WP_000917872.1.77384 WP_000917872.1.77414 WP_000917872.1.77431 WP_000917872.1.77436 WP_000917872.1.77440 WP_000917872.1.77475 WP_000917872.1.77496 WP_000917872.1.77501 WP_000917872.1.77512 WP_000917872.1.77513 WP_000917872.1.77514 WP_000917872.1.77529 WP_000917872.1.77543 WP_000917872.1.77549 WP_000917872.1.77555 WP_000917872.1.77563 WP_000917872.1.77565 WP_000917872.1.77575 WP_000917872.1.77596 WP_000917872.1.77629 WP_000917872.1.77646 WP_000917872.1.77653 WP_000917872.1.77692 WP_000917872.1.77702 WP_000917872.1.77710 WP_000917872.1.77713 WP_000917872.1.7772 WP_000917872.1.77729 WP_000917872.1.77754 WP_000917872.1.77761 WP_000917872.1.7782 WP_000917872.1.77825 WP_000917872.1.77837 WP_000917872.1.7784 WP_000917872.1.77846 WP_000917872.1.77851 WP_000917872.1.77861 WP_000917872.1.77871 WP_000917872.1.77898 WP_000917872.1.77900 WP_000917872.1.77918 WP_000917872.1.7792 WP_000917872.1.77923 WP_000917872.1.7793 WP_000917872.1.77951 WP_000917872.1.77960 WP_000917872.1.77971 WP_000917872.1.77975 WP_000917872.1.77983 WP_000917872.1.77987 WP_000917872.1.77989 WP_000917872.1.78 WP_000917872.1.78016 WP_000917872.1.7802 WP_000917872.1.78033 WP_000917872.1.78035 WP_000917872.1.78048 WP_000917872.1.78051 WP_000917872.1.78053 WP_000917872.1.78076 WP_000917872.1.78096 WP_000917872.1.78100 WP_000917872.1.78107 WP_000917872.1.78110 WP_000917872.1.78120 WP_000917872.1.7814 WP_000917872.1.78166 WP_000917872.1.78168 WP_000917872.1.78170 WP_000917872.1.78180 WP_000917872.1.78192 WP_000917872.1.78195 WP_000917872.1.78201 WP_000917872.1.78245 WP_000917872.1.78259 WP_000917872.1.78291 WP_000917872.1.78309 WP_000917872.1.78320 WP_000917872.1.78339 WP_000917872.1.78352 WP_000917872.1.78366 WP_000917872.1.78372 WP_000917872.1.78382 WP_000917872.1.78383 WP_000917872.1.78388 WP_000917872.1.78407 WP_000917872.1.78410 WP_000917872.1.78443 WP_000917872.1.78495 WP_000917872.1.78496 WP_000917872.1.78501 WP_000917872.1.78502 WP_000917872.1.78602 WP_000917872.1.78603 WP_000917872.1.7861 WP_000917872.1.78618 WP_000917872.1.7862 WP_000917872.1.78626 WP_000917872.1.78632 WP_000917872.1.78658 WP_000917872.1.78661 WP_000917872.1.78673 WP_000917872.1.78674 WP_000917872.1.78676 WP_000917872.1.78697 WP_000917872.1.78715 WP_000917872.1.78734 WP_000917872.1.78735 WP_000917872.1.78761 WP_000917872.1.7877 WP_000917872.1.78771 WP_000917872.1.78789 WP_000917872.1.78802 WP_000917872.1.78815 WP_000917872.1.78830 WP_000917872.1.78835 WP_000917872.1.78838 WP_000917872.1.78871 WP_000917872.1.78874 WP_000917872.1.78877 WP_000917872.1.78881 WP_000917872.1.78896 WP_000917872.1.789 WP_000917872.1.78913 WP_000917872.1.78918 WP_000917872.1.78928 WP_000917872.1.7893 WP_000917872.1.78930 WP_000917872.1.78951 WP_000917872.1.78959 WP_000917872.1.78993 WP_000917872.1.79011 WP_000917872.1.79012 WP_000917872.1.79032 WP_000917872.1.79069 WP_000917872.1.79074 WP_000917872.1.79081 WP_000917872.1.79098 WP_000917872.1.79099 WP_000917872.1.79151 WP_000917872.1.79155 WP_000917872.1.79164 WP_000917872.1.79167 WP_000917872.1.79189 WP_000917872.1.79203 WP_000917872.1.79204 WP_000917872.1.79235 WP_000917872.1.79280 WP_000917872.1.79289 WP_000917872.1.79297 WP_000917872.1.79300 WP_000917872.1.79302 WP_000917872.1.79335 WP_000917872.1.79370 WP_000917872.1.79397 WP_000917872.1.794 WP_000917872.1.79427 WP_000917872.1.79456 WP_000917872.1.79462 WP_000917872.1.79466 WP_000917872.1.79468 WP_000917872.1.79472 WP_000917872.1.79490 WP_000917872.1.79495 WP_000917872.1.79529 WP_000917872.1.79531 WP_000917872.1.79532 WP_000917872.1.79547 WP_000917872.1.7956 WP_000917872.1.79570 WP_000917872.1.79580 WP_000917872.1.79586 WP_000917872.1.79635 WP_000917872.1.7964 WP_000917872.1.79642 WP_000917872.1.79645 WP_000917872.1.79654 WP_000917872.1.79659 WP_000917872.1.79668 WP_000917872.1.7970 WP_000917872.1.79708 WP_000917872.1.7972 WP_000917872.1.79722 WP_000917872.1.79734 WP_000917872.1.79738 WP_000917872.1.79757 WP_000917872.1.79772 WP_000917872.1.79778 WP_000917872.1.7979 WP_000917872.1.7982 WP_000917872.1.79845 WP_000917872.1.79867 WP_000917872.1.79880 WP_000917872.1.79892 WP_000917872.1.7991 WP_000917872.1.79910 WP_000917872.1.79914 WP_000917872.1.79916 WP_000917872.1.79934 WP_000917872.1.7994 WP_000917872.1.79942 WP_000917872.1.79945 WP_000917872.1.79951 WP_000917872.1.79966 WP_000917872.1.79974 WP_000917872.1.79977 WP_000917872.1.79996 WP_000917872.1.80065 WP_000917872.1.80077 WP_000917872.1.80103 WP_000917872.1.80137 WP_000917872.1.80149 WP_000917872.1.80182 WP_000917872.1.80229 WP_000917872.1.80236 WP_000917872.1.8024 WP_000917872.1.80249 WP_000917872.1.80250 WP_000917872.1.80254 WP_000917872.1.80273 WP_000917872.1.80282 WP_000917872.1.80293 WP_000917872.1.80296 WP_000917872.1.80307 WP_000917872.1.80333 WP_000917872.1.80354 WP_000917872.1.80363 WP_000917872.1.80366 WP_000917872.1.80368 WP_000917872.1.80380 WP_000917872.1.80386 WP_000917872.1.80400 WP_000917872.1.80441 WP_000917872.1.80443 WP_000917872.1.80462 WP_000917872.1.80473 WP_000917872.1.80479 WP_000917872.1.8049 WP_000917872.1.80492 WP_000917872.1.80496 WP_000917872.1.80529 WP_000917872.1.80542 WP_000917872.1.80569 WP_000917872.1.80586 WP_000917872.1.80609 WP_000917872.1.80629 WP_000917872.1.80638 WP_000917872.1.80664 WP_000917872.1.80667 WP_000917872.1.80674 WP_000917872.1.80696 WP_000917872.1.80707 WP_000917872.1.80723 WP_000917872.1.80725 WP_000917872.1.80741 WP_000917872.1.80750 WP_000917872.1.80757 WP_000917872.1.80760 WP_000917872.1.80780 WP_000917872.1.80803 WP_000917872.1.80819 WP_000917872.1.80827 WP_000917872.1.80831 WP_000917872.1.80840 WP_000917872.1.80857 WP_000917872.1.80868 WP_000917872.1.80874 WP_000917872.1.80876 WP_000917872.1.80881 WP_000917872.1.80913 WP_000917872.1.80927 WP_000917872.1.80939 WP_000917872.1.80959 WP_000917872.1.8096 WP_000917872.1.80973 WP_000917872.1.80984 WP_000917872.1.81037 WP_000917872.1.81041 WP_000917872.1.8106 WP_000917872.1.81062 WP_000917872.1.81067 WP_000917872.1.81069 WP_000917872.1.81084 WP_000917872.1.81107 WP_000917872.1.81109 WP_000917872.1.81110 WP_000917872.1.81118 WP_000917872.1.81131 WP_000917872.1.81149 WP_000917872.1.81175 WP_000917872.1.81187 WP_000917872.1.8119 WP_000917872.1.81193 WP_000917872.1.81197 WP_000917872.1.81225 WP_000917872.1.81231 WP_000917872.1.81262 WP_000917872.1.81268 WP_000917872.1.81269 WP_000917872.1.8127 WP_000917872.1.81271 WP_000917872.1.81275 WP_000917872.1.8130 WP_000917872.1.81302 WP_000917872.1.81305 WP_000917872.1.8131 WP_000917872.1.81320 WP_000917872.1.81321 WP_000917872.1.81328 WP_000917872.1.81333 WP_000917872.1.8134 WP_000917872.1.81342 WP_000917872.1.81354 WP_000917872.1.81364 WP_000917872.1.81388 WP_000917872.1.81404 WP_000917872.1.81409 WP_000917872.1.81410 WP_000917872.1.81425 WP_000917872.1.81455 WP_000917872.1.81472 WP_000917872.1.81494 WP_000917872.1.81528 WP_000917872.1.81548 WP_000917872.1.81557 WP_000917872.1.81568 WP_000917872.1.81612 WP_000917872.1.81667 WP_000917872.1.81668 WP_000917872.1.81676 WP_000917872.1.8168 WP_000917872.1.81681 WP_000917872.1.8170 WP_000917872.1.81727 WP_000917872.1.81735 WP_000917872.1.81736 WP_000917872.1.81743 WP_000917872.1.81746 WP_000917872.1.81750 WP_000917872.1.81760 WP_000917872.1.81763 WP_000917872.1.81768 WP_000917872.1.81785 WP_000917872.1.81795 WP_000917872.1.81798 WP_000917872.1.81855 WP_000917872.1.81902 WP_000917872.1.81921 WP_000917872.1.81931 WP_000917872.1.81936 WP_000917872.1.81941 WP_000917872.1.81949 WP_000917872.1.8196 WP_000917872.1.81965 WP_000917872.1.81974 WP_000917872.1.81977 WP_000917872.1.81995 WP_000917872.1.82037 WP_000917872.1.82070 WP_000917872.1.82076 WP_000917872.1.82131 WP_000917872.1.82141 WP_000917872.1.82144 WP_000917872.1.82149 WP_000917872.1.82156 WP_000917872.1.8218 WP_000917872.1.82180 WP_000917872.1.82192 WP_000917872.1.82201 WP_000917872.1.82214 WP_000917872.1.82225 WP_000917872.1.82232 WP_000917872.1.82258 WP_000917872.1.82337 WP_000917872.1.82347 WP_000917872.1.82352 WP_000917872.1.8236 WP_000917872.1.82369 WP_000917872.1.82395 WP_000917872.1.8240 WP_000917872.1.82401 WP_000917872.1.82408 WP_000917872.1.82416 WP_000917872.1.8242 WP_000917872.1.82420 WP_000917872.1.82434 WP_000917872.1.82456 WP_000917872.1.82464 WP_000917872.1.82465 WP_000917872.1.8247 WP_000917872.1.82473 WP_000917872.1.82474 WP_000917872.1.82479 WP_000917872.1.82503 WP_000917872.1.82515 WP_000917872.1.82529 WP_000917872.1.82530 WP_000917872.1.82553 WP_000917872.1.82562 WP_000917872.1.82569 WP_000917872.1.82570 WP_000917872.1.82584 WP_000917872.1.82636 WP_000917872.1.82637 WP_000917872.1.82646 WP_000917872.1.82648 WP_000917872.1.82670 WP_000917872.1.82676 WP_000917872.1.82692 WP_000917872.1.82731 WP_000917872.1.82761 WP_000917872.1.82763 WP_000917872.1.82812 WP_000917872.1.8282 WP_000917872.1.82841 WP_000917872.1.82843 WP_000917872.1.82850 WP_000917872.1.82867 WP_000917872.1.82872 WP_000917872.1.82895 WP_000917872.1.82899 WP_000917872.1.82908 WP_000917872.1.82937 WP_000917872.1.8294 WP_000917872.1.82944 WP_000917872.1.82956 WP_000917872.1.82959 WP_000917872.1.82964 WP_000917872.1.82992 WP_000917872.1.83005 WP_000917872.1.83006 WP_000917872.1.83007 WP_000917872.1.8304 WP_000917872.1.83061 WP_000917872.1.83092 WP_000917872.1.83119 WP_000917872.1.83139 WP_000917872.1.83163 WP_000917872.1.83180 WP_000917872.1.83204 WP_000917872.1.8322 WP_000917872.1.83221 WP_000917872.1.83229 WP_000917872.1.83235 WP_000917872.1.83247 WP_000917872.1.83252 WP_000917872.1.83258 WP_000917872.1.83280 WP_000917872.1.83290 WP_000917872.1.83301 WP_000917872.1.83305 WP_000917872.1.83331 WP_000917872.1.83333 WP_000917872.1.83354 WP_000917872.1.83356 WP_000917872.1.83360 WP_000917872.1.83365 WP_000917872.1.83382 WP_000917872.1.83388 WP_000917872.1.83407 WP_000917872.1.83413 WP_000917872.1.83491 WP_000917872.1.83510 WP_000917872.1.83516 WP_000917872.1.83523 WP_000917872.1.8354 WP_000917872.1.83558 WP_000917872.1.83572 WP_000917872.1.83598 WP_000917872.1.83650 WP_000917872.1.83657 WP_000917872.1.83677 WP_000917872.1.83710 WP_000917872.1.83721 WP_000917872.1.83739 WP_000917872.1.8375 WP_000917872.1.83759 WP_000917872.1.83760 WP_000917872.1.83806 WP_000917872.1.83854 WP_000917872.1.83897 WP_000917872.1.83923 WP_000917872.1.83960 WP_000917872.1.83979 WP_000917872.1.8399 WP_000917872.1.83994 WP_000917872.1.83995 WP_000917872.1.84 WP_000917872.1.84000 WP_000917872.1.84001 WP_000917872.1.84011 WP_000917872.1.84031 WP_000917872.1.8406 WP_000917872.1.84075 WP_000917872.1.84076 WP_000917872.1.84083 WP_000917872.1.84086 WP_000917872.1.84100 WP_000917872.1.84103 WP_000917872.1.84106 WP_000917872.1.84110 WP_000917872.1.84115 WP_000917872.1.84127 WP_000917872.1.84150 WP_000917872.1.84154 WP_000917872.1.84179 WP_000917872.1.84198 WP_000917872.1.84205 WP_000917872.1.84209 WP_000917872.1.84229 WP_000917872.1.84230 WP_000917872.1.8425 WP_000917872.1.84252 WP_000917872.1.84283 WP_000917872.1.84291 WP_000917872.1.84300 WP_000917872.1.8431 WP_000917872.1.84325 WP_000917872.1.84345 WP_000917872.1.84355 WP_000917872.1.84359 WP_000917872.1.84369 WP_000917872.1.84373 WP_000917872.1.84392 WP_000917872.1.84397 WP_000917872.1.84401 WP_000917872.1.84403 WP_000917872.1.8441 WP_000917872.1.84435 WP_000917872.1.84459 WP_000917872.1.84497 WP_000917872.1.84515 WP_000917872.1.84523 WP_000917872.1.84532 WP_000917872.1.84551 WP_000917872.1.84554 WP_000917872.1.84567 WP_000917872.1.84572 WP_000917872.1.84598 WP_000917872.1.84631 WP_000917872.1.84644 WP_000917872.1.84659 WP_000917872.1.84683 WP_000917872.1.84693 WP_000917872.1.84711 WP_000917872.1.84721 WP_000917872.1.84727 WP_000917872.1.84744 WP_000917872.1.84745 WP_000917872.1.84773 WP_000917872.1.84814 WP_000917872.1.84872 WP_000917872.1.84876 WP_000917872.1.84879 WP_000917872.1.84899 WP_000917872.1.84945 WP_000917872.1.84967 WP_000917872.1.8497 WP_000917872.1.84983 WP_000917872.1.850 WP_000917872.1.85004 WP_000917872.1.85014 WP_000917872.1.8502 WP_000917872.1.85031 WP_000917872.1.85039 WP_000917872.1.85040 WP_000917872.1.85079 WP_000917872.1.85094 WP_000917872.1.85120 WP_000917872.1.85126 WP_000917872.1.85134 WP_000917872.1.85147 WP_000917872.1.85153 WP_000917872.1.85178 WP_000917872.1.85180 WP_000917872.1.85190 WP_000917872.1.85217 WP_000917872.1.8526 WP_000917872.1.85271 WP_000917872.1.85273 WP_000917872.1.85301 WP_000917872.1.8533 WP_000917872.1.85338 WP_000917872.1.85339 WP_000917872.1.8537 WP_000917872.1.85408 WP_000917872.1.85433 WP_000917872.1.8545 WP_000917872.1.85456 WP_000917872.1.85469 WP_000917872.1.85481 WP_000917872.1.85483 WP_000917872.1.85511 WP_000917872.1.85512 WP_000917872.1.8552 WP_000917872.1.85541 WP_000917872.1.8556 WP_000917872.1.85568 WP_000917872.1.8557 WP_000917872.1.85606 WP_000917872.1.85615 WP_000917872.1.85617 WP_000917872.1.85635 WP_000917872.1.85646 WP_000917872.1.85654 WP_000917872.1.85663 WP_000917872.1.85665 WP_000917872.1.85669 WP_000917872.1.85671 WP_000917872.1.85672 WP_000917872.1.85688 WP_000917872.1.85703 WP_000917872.1.85723 WP_000917872.1.85728 WP_000917872.1.85742 WP_000917872.1.85746 WP_000917872.1.85759 WP_000917872.1.85777 WP_000917872.1.85780 WP_000917872.1.85784 WP_000917872.1.85797 WP_000917872.1.85811 WP_000917872.1.85854 WP_000917872.1.85855 WP_000917872.1.85864 WP_000917872.1.85886 WP_000917872.1.859 WP_000917872.1.85900 WP_000917872.1.85904 WP_000917872.1.8591 WP_000917872.1.85917 WP_000917872.1.8594 WP_000917872.1.85943 WP_000917872.1.85976 WP_000917872.1.85977 WP_000917872.1.85982 WP_000917872.1.860 WP_000917872.1.86010 WP_000917872.1.86017 WP_000917872.1.86043 WP_000917872.1.8605 WP_000917872.1.86084 WP_000917872.1.86092 WP_000917872.1.8610 WP_000917872.1.86120 WP_000917872.1.86126 WP_000917872.1.86138 WP_000917872.1.8614 WP_000917872.1.86156 WP_000917872.1.86157 WP_000917872.1.86159 WP_000917872.1.8616 WP_000917872.1.86173 WP_000917872.1.86206 WP_000917872.1.86224 WP_000917872.1.86240 WP_000917872.1.86259 WP_000917872.1.86284 WP_000917872.1.86306 WP_000917872.1.86310 WP_000917872.1.86316 WP_000917872.1.86323 WP_000917872.1.86335 WP_000917872.1.86342 WP_000917872.1.86347 WP_000917872.1.86356 WP_000917872.1.86380 WP_000917872.1.86389 WP_000917872.1.8640 WP_000917872.1.8642 WP_000917872.1.86426 WP_000917872.1.86442 WP_000917872.1.86450 WP_000917872.1.86453 WP_000917872.1.86466 WP_000917872.1.86469 WP_000917872.1.8647 WP_000917872.1.86489 WP_000917872.1.86514 WP_000917872.1.86530 WP_000917872.1.86580 WP_000917872.1.86588 WP_000917872.1.86593 WP_000917872.1.86601 WP_000917872.1.86610 WP_000917872.1.86634 WP_000917872.1.86656 WP_000917872.1.86658 WP_000917872.1.86661 WP_000917872.1.86663 WP_000917872.1.86676 WP_000917872.1.86699 WP_000917872.1.8671 WP_000917872.1.8672 WP_000917872.1.86735 WP_000917872.1.86744 WP_000917872.1.86770 WP_000917872.1.8678 WP_000917872.1.86794 WP_000917872.1.86800 WP_000917872.1.86807 WP_000917872.1.86810 WP_000917872.1.86811 WP_000917872.1.86815 WP_000917872.1.8684 WP_000917872.1.86859 WP_000917872.1.86860 WP_000917872.1.86895 WP_000917872.1.86902 WP_000917872.1.86906 WP_000917872.1.8691 WP_000917872.1.86915 WP_000917872.1.86921 WP_000917872.1.86945 WP_000917872.1.86982 WP_000917872.1.86989 WP_000917872.1.87023 WP_000917872.1.87034 WP_000917872.1.87038 WP_000917872.1.87041 WP_000917872.1.87095 WP_000917872.1.87136 WP_000917872.1.87143 WP_000917872.1.87155 WP_000917872.1.87187 WP_000917872.1.87219 WP_000917872.1.8722 WP_000917872.1.87220 WP_000917872.1.87258 WP_000917872.1.87265 WP_000917872.1.87276 WP_000917872.1.87282 WP_000917872.1.87283 WP_000917872.1.87293 WP_000917872.1.87323 WP_000917872.1.87346 WP_000917872.1.8736 WP_000917872.1.87365 WP_000917872.1.87370 WP_000917872.1.87376 WP_000917872.1.87420 WP_000917872.1.87460 WP_000917872.1.87484 WP_000917872.1.87493 WP_000917872.1.87500 WP_000917872.1.87528 WP_000917872.1.87552 WP_000917872.1.87560 WP_000917872.1.87583 WP_000917872.1.87584 WP_000917872.1.8760 WP_000917872.1.87600 WP_000917872.1.87609 WP_000917872.1.87612 WP_000917872.1.87615 WP_000917872.1.87618 WP_000917872.1.87626 WP_000917872.1.87651 WP_000917872.1.87653 WP_000917872.1.87659 WP_000917872.1.8767 WP_000917872.1.87695 WP_000917872.1.87698 WP_000917872.1.87706 WP_000917872.1.87712 WP_000917872.1.87739 WP_000917872.1.87741 WP_000917872.1.87742 WP_000917872.1.87760 WP_000917872.1.87779 WP_000917872.1.87813 WP_000917872.1.87852 WP_000917872.1.87875 WP_000917872.1.87891 WP_000917872.1.87899 WP_000917872.1.87905 WP_000917872.1.8792 WP_000917872.1.87933 WP_000917872.1.87936 WP_000917872.1.87945 WP_000917872.1.87949 WP_000917872.1.87999 WP_000917872.1.8800 WP_000917872.1.88014 WP_000917872.1.88019 WP_000917872.1.88025 WP_000917872.1.88026 WP_000917872.1.8805 WP_000917872.1.88052 WP_000917872.1.8806 WP_000917872.1.88073 WP_000917872.1.8809 WP_000917872.1.88092 WP_000917872.1.881 WP_000917872.1.88136 WP_000917872.1.88145 WP_000917872.1.88165 WP_000917872.1.88185 WP_000917872.1.88199 WP_000917872.1.88214 WP_000917872.1.88244 WP_000917872.1.88264 WP_000917872.1.88275 WP_000917872.1.88291 WP_000917872.1.88293 WP_000917872.1.88299 WP_000917872.1.88303 WP_000917872.1.88313 WP_000917872.1.88356 WP_000917872.1.88359 WP_000917872.1.8837 WP_000917872.1.88393 WP_000917872.1.88407 WP_000917872.1.88414 WP_000917872.1.88444 WP_000917872.1.88446 WP_000917872.1.88458 WP_000917872.1.88474 WP_000917872.1.88483 WP_000917872.1.88501 WP_000917872.1.88508 WP_000917872.1.88538 WP_000917872.1.88547 WP_000917872.1.88597 WP_000917872.1.886 WP_000917872.1.88609 WP_000917872.1.88620 WP_000917872.1.88624 WP_000917872.1.88647 WP_000917872.1.88648 WP_000917872.1.88651 WP_000917872.1.88675 WP_000917872.1.88683 WP_000917872.1.88692 WP_000917872.1.88698 WP_000917872.1.88703 WP_000917872.1.88707 WP_000917872.1.88727 WP_000917872.1.88731 WP_000917872.1.88762 WP_000917872.1.88772 WP_000917872.1.88776 WP_000917872.1.88792 WP_000917872.1.88817 WP_000917872.1.88845 WP_000917872.1.88850 WP_000917872.1.88854 WP_000917872.1.8889 WP_000917872.1.88892 WP_000917872.1.88894 WP_000917872.1.88902 WP_000917872.1.8891 WP_000917872.1.88942 WP_000917872.1.88957 WP_000917872.1.88966 WP_000917872.1.88968 WP_000917872.1.88970 WP_000917872.1.88980 WP_000917872.1.88981 WP_000917872.1.88982 WP_000917872.1.88995 WP_000917872.1.88998 WP_000917872.1.89008 WP_000917872.1.89114 WP_000917872.1.89116 WP_000917872.1.89119 WP_000917872.1.89120 WP_000917872.1.89138 WP_000917872.1.89169 WP_000917872.1.89174 WP_000917872.1.89177 WP_000917872.1.89182 WP_000917872.1.89221 WP_000917872.1.89291 WP_000917872.1.89298 WP_000917872.1.89304 WP_000917872.1.89308 WP_000917872.1.89311 WP_000917872.1.89314 WP_000917872.1.89328 WP_000917872.1.89332 WP_000917872.1.89343 WP_000917872.1.89354 WP_000917872.1.89355 WP_000917872.1.89362 WP_000917872.1.89395 WP_000917872.1.8940 WP_000917872.1.89408 WP_000917872.1.89425 WP_000917872.1.89449 WP_000917872.1.89452 WP_000917872.1.8947 WP_000917872.1.89503 WP_000917872.1.89512 WP_000917872.1.89527 WP_000917872.1.89570 WP_000917872.1.8958 WP_000917872.1.89580 WP_000917872.1.89591 WP_000917872.1.89604 WP_000917872.1.89606 WP_000917872.1.8961 WP_000917872.1.89612 WP_000917872.1.89622 WP_000917872.1.89632 WP_000917872.1.89634 WP_000917872.1.89647 WP_000917872.1.89657 WP_000917872.1.89659 WP_000917872.1.89668 WP_000917872.1.89680 WP_000917872.1.89706 WP_000917872.1.89713 WP_000917872.1.89733 WP_000917872.1.89746 WP_000917872.1.89764 WP_000917872.1.89765 WP_000917872.1.89777 WP_000917872.1.89789 WP_000917872.1.89796 WP_000917872.1.89804 WP_000917872.1.89815 WP_000917872.1.89817 WP_000917872.1.89832 WP_000917872.1.89845 WP_000917872.1.89870 WP_000917872.1.89888 WP_000917872.1.89902 WP_000917872.1.89911 WP_000917872.1.89914 WP_000917872.1.89940 WP_000917872.1.8995 WP_000917872.1.89952 WP_000917872.1.8996 WP_000917872.1.89965 WP_000917872.1.89975 WP_000917872.1.90007 WP_000917872.1.9002 WP_000917872.1.9003 WP_000917872.1.90084 WP_000917872.1.90097 WP_000917872.1.90108 WP_000917872.1.9011 WP_000917872.1.90193 WP_000917872.1.90196 WP_000917872.1.90211 WP_000917872.1.90220 WP_000917872.1.90240 WP_000917872.1.90248 WP_000917872.1.90252 WP_000917872.1.90274 WP_000917872.1.90280 WP_000917872.1.90293 WP_000917872.1.90302 WP_000917872.1.90311 WP_000917872.1.90330 WP_000917872.1.90338 WP_000917872.1.90348 WP_000917872.1.90363 WP_000917872.1.90365 WP_000917872.1.90409 WP_000917872.1.90417 WP_000917872.1.90421 WP_000917872.1.90428 WP_000917872.1.90453 WP_000917872.1.90458 WP_000917872.1.90472 WP_000917872.1.90489 WP_000917872.1.90513 WP_000917872.1.90521 WP_000917872.1.90522 WP_000917872.1.90540 WP_000917872.1.90557 WP_000917872.1.90563 WP_000917872.1.90566 WP_000917872.1.90582 WP_000917872.1.90585 WP_000917872.1.90617 WP_000917872.1.90620 WP_000917872.1.90625 WP_000917872.1.90641 WP_000917872.1.90686 WP_000917872.1.90701 WP_000917872.1.90713 WP_000917872.1.90734 WP_000917872.1.90748 WP_000917872.1.90752 WP_000917872.1.90759 WP_000917872.1.90792 WP_000917872.1.90794 WP_000917872.1.90796 WP_000917872.1.90811 WP_000917872.1.90814 WP_000917872.1.90859 WP_000917872.1.90866 WP_000917872.1.90876 WP_000917872.1.90878 WP_000917872.1.9089 WP_000917872.1.9091 WP_000917872.1.9093 WP_000917872.1.90959 WP_000917872.1.90973 WP_000917872.1.90983 WP_000917872.1.90984 WP_000917872.1.90991 WP_000917872.1.91003 WP_000917872.1.91023 WP_000917872.1.91042 WP_000917872.1.91049 WP_000917872.1.91056 WP_000917872.1.91067 WP_000917872.1.91069 WP_000917872.1.91107 WP_000917872.1.91156 WP_000917872.1.91164 WP_000917872.1.91179 WP_000917872.1.91189 WP_000917872.1.91205 WP_000917872.1.91215 WP_000917872.1.91239 WP_000917872.1.91278 WP_000917872.1.91282 WP_000917872.1.91291 WP_000917872.1.9131 WP_000917872.1.91312 WP_000917872.1.91313 WP_000917872.1.91331 WP_000917872.1.91334 WP_000917872.1.9135 WP_000917872.1.9137 WP_000917872.1.91372 WP_000917872.1.91381 WP_000917872.1.91405 WP_000917872.1.91424 WP_000917872.1.91453 WP_000917872.1.91470 WP_000917872.1.91473 WP_000917872.1.91474 WP_000917872.1.91493 WP_000917872.1.91505 WP_000917872.1.91506 WP_000917872.1.91512 WP_000917872.1.91528 WP_000917872.1.91557 WP_000917872.1.91564 WP_000917872.1.91579 WP_000917872.1.91580 WP_000917872.1.91597 WP_000917872.1.91621 WP_000917872.1.91628 WP_000917872.1.91655 WP_000917872.1.9166 WP_000917872.1.91702 WP_000917872.1.91715 WP_000917872.1.91724 WP_000917872.1.91732 WP_000917872.1.91736 WP_000917872.1.91742 WP_000917872.1.91772 WP_000917872.1.91776 WP_000917872.1.91788 WP_000917872.1.91795 WP_000917872.1.91806 WP_000917872.1.91864 WP_000917872.1.9187 WP_000917872.1.91870 WP_000917872.1.91880 WP_000917872.1.91898 WP_000917872.1.91903 WP_000917872.1.91904 WP_000917872.1.91914 WP_000917872.1.91974 WP_000917872.1.91984 WP_000917872.1.92013 WP_000917872.1.92018 WP_000917872.1.92044 WP_000917872.1.92047 WP_000917872.1.92060 WP_000917872.1.92067 WP_000917872.1.92068 WP_000917872.1.92082 WP_000917872.1.92087 WP_000917872.1.92093 WP_000917872.1.92098 WP_000917872.1.92099 WP_000917872.1.92108 WP_000917872.1.92122 WP_000917872.1.92129 WP_000917872.1.92149 WP_000917872.1.92156 WP_000917872.1.92165 WP_000917872.1.92171 WP_000917872.1.92172 WP_000917872.1.92183 WP_000917872.1.92208 WP_000917872.1.9222 WP_000917872.1.92240 WP_000917872.1.92243 WP_000917872.1.92268 WP_000917872.1.92270 WP_000917872.1.92299 WP_000917872.1.92310 WP_000917872.1.92318 WP_000917872.1.92327 WP_000917872.1.92375 WP_000917872.1.92394 WP_000917872.1.92399 WP_000917872.1.92408 WP_000917872.1.92439 WP_000917872.1.92443 WP_000917872.1.92452 WP_000917872.1.92470 WP_000917872.1.92477 WP_000917872.1.92482 WP_000917872.1.92529 WP_000917872.1.9253 WP_000917872.1.92531 WP_000917872.1.92545 WP_000917872.1.92557 WP_000917872.1.92562 WP_000917872.1.92570 WP_000917872.1.92588 WP_000917872.1.926 WP_000917872.1.92628 WP_000917872.1.92633 WP_000917872.1.92646 WP_000917872.1.92649 WP_000917872.1.92659 WP_000917872.1.92669 WP_000917872.1.92671 WP_000917872.1.92676 WP_000917872.1.92705 WP_000917872.1.9271 WP_000917872.1.92729 WP_000917872.1.92734 WP_000917872.1.92738 WP_000917872.1.92754 WP_000917872.1.92758 WP_000917872.1.9276 WP_000917872.1.92786 WP_000917872.1.92806 WP_000917872.1.92810 WP_000917872.1.92823 WP_000917872.1.92827 WP_000917872.1.92832 WP_000917872.1.92836 WP_000917872.1.92842 WP_000917872.1.92843 WP_000917872.1.92883 WP_000917872.1.92890 WP_000917872.1.92893 WP_000917872.1.92895 WP_000917872.1.92926 WP_000917872.1.92929 WP_000917872.1.92936 WP_000917872.1.92939 WP_000917872.1.92947 WP_000917872.1.92975 WP_000917872.1.92987 WP_000917872.1.92988 WP_000917872.1.93007 WP_000917872.1.93022 WP_000917872.1.93059 WP_000917872.1.93061 WP_000917872.1.93076 WP_000917872.1.93086 WP_000917872.1.93101 WP_000917872.1.93103 WP_000917872.1.93105 WP_000917872.1.93111 WP_000917872.1.93118 WP_000917872.1.93121 WP_000917872.1.93136 WP_000917872.1.93155 WP_000917872.1.93168 WP_000917872.1.93184 WP_000917872.1.93213 WP_000917872.1.93215 WP_000917872.1.93221 WP_000917872.1.93223 WP_000917872.1.93239 WP_000917872.1.93275 WP_000917872.1.93302 WP_000917872.1.93339 WP_000917872.1.93350 WP_000917872.1.9336 WP_000917872.1.93365 WP_000917872.1.93376 WP_000917872.1.93387 WP_000917872.1.93410 WP_000917872.1.93469 WP_000917872.1.93511 WP_000917872.1.93512 WP_000917872.1.93524 WP_000917872.1.93543 WP_000917872.1.93577 WP_000917872.1.93596 WP_000917872.1.93604 WP_000917872.1.93635 WP_000917872.1.93648 WP_000917872.1.93650 WP_000917872.1.93656 WP_000917872.1.93657 WP_000917872.1.93662 WP_000917872.1.93671 WP_000917872.1.93691 WP_000917872.1.937 WP_000917872.1.93705 WP_000917872.1.9374 WP_000917872.1.9375 WP_000917872.1.93754 WP_000917872.1.93761 WP_000917872.1.93767 WP_000917872.1.93780 WP_000917872.1.9380 WP_000917872.1.93803 WP_000917872.1.93804 WP_000917872.1.93809 WP_000917872.1.93828 WP_000917872.1.93837 WP_000917872.1.93842 WP_000917872.1.93843 WP_000917872.1.93875 WP_000917872.1.9389 WP_000917872.1.93909 WP_000917872.1.93919 WP_000917872.1.93937 WP_000917872.1.93938 WP_000917872.1.93956 WP_000917872.1.93984 WP_000917872.1.93986 WP_000917872.1.9399 WP_000917872.1.93994 WP_000917872.1.94017 WP_000917872.1.94039 WP_000917872.1.94056 WP_000917872.1.94064 WP_000917872.1.94070 WP_000917872.1.94071 WP_000917872.1.94072 WP_000917872.1.94079 WP_000917872.1.94097 WP_000917872.1.94107 WP_000917872.1.94132 WP_000917872.1.94142 WP_000917872.1.94162 WP_000917872.1.94167 WP_000917872.1.94168 WP_000917872.1.94181 WP_000917872.1.94198 WP_000917872.1.94215 WP_000917872.1.94303 WP_000917872.1.9432 WP_000917872.1.94352 WP_000917872.1.94354 WP_000917872.1.94365 WP_000917872.1.94379 WP_000917872.1.94380 WP_000917872.1.94383 WP_000917872.1.94390 WP_000917872.1.9440 WP_000917872.1.94412 WP_000917872.1.94415 WP_000917872.1.94458 WP_000917872.1.94461 WP_000917872.1.94473 WP_000917872.1.94492 WP_000917872.1.94510 WP_000917872.1.94527 WP_000917872.1.94557 WP_000917872.1.94562 WP_000917872.1.94565 WP_000917872.1.94573 WP_000917872.1.94579 WP_000917872.1.94584 WP_000917872.1.94586 WP_000917872.1.94588 WP_000917872.1.94593 WP_000917872.1.94598 WP_000917872.1.94622 WP_000917872.1.9463 WP_000917872.1.94649 WP_000917872.1.94650 WP_000917872.1.94655 WP_000917872.1.94659 WP_000917872.1.94662 WP_000917872.1.94669 WP_000917872.1.94670 WP_000917872.1.94674 WP_000917872.1.94700 WP_000917872.1.94717 WP_000917872.1.94722 WP_000917872.1.94745 WP_000917872.1.94782 WP_000917872.1.94785 WP_000917872.1.94796 WP_000917872.1.94798 WP_000917872.1.9481 WP_000917872.1.94815 WP_000917872.1.94817 WP_000917872.1.94820 WP_000917872.1.94835 WP_000917872.1.94849 WP_000917872.1.94850 WP_000917872.1.94851 WP_000917872.1.94862 WP_000917872.1.94864 WP_000917872.1.94921 WP_000917872.1.94947 WP_000917872.1.94952 WP_000917872.1.94959 WP_000917872.1.94971 WP_000917872.1.94982 WP_000917872.1.94983 WP_000917872.1.94986 WP_000917872.1.94987 WP_000917872.1.95006 WP_000917872.1.95051 WP_000917872.1.95055 WP_000917872.1.95076 WP_000917872.1.95085 WP_000917872.1.95094 WP_000917872.1.95099 WP_000917872.1.95121 WP_000917872.1.95133 WP_000917872.1.95136 WP_000917872.1.9516 WP_000917872.1.95165 WP_000917872.1.95171 WP_000917872.1.95235 WP_000917872.1.95239 WP_000917872.1.95246 WP_000917872.1.95248 WP_000917872.1.9525 WP_000917872.1.95255 WP_000917872.1.95265 WP_000917872.1.9527 WP_000917872.1.95277 WP_000917872.1.95282 WP_000917872.1.95298 WP_000917872.1.9530 WP_000917872.1.95320 WP_000917872.1.95338 WP_000917872.1.95388 WP_000917872.1.95412 WP_000917872.1.95434 WP_000917872.1.95447 WP_000917872.1.95456 WP_000917872.1.95465 WP_000917872.1.95530 WP_000917872.1.95546 WP_000917872.1.95547 WP_000917872.1.95558 WP_000917872.1.95579 WP_000917872.1.95590 WP_000917872.1.95607 WP_000917872.1.95623 WP_000917872.1.95625 WP_000917872.1.95630 WP_000917872.1.95641 WP_000917872.1.95656 WP_000917872.1.95670 WP_000917872.1.95675 WP_000917872.1.95691 WP_000917872.1.95703 WP_000917872.1.95716 WP_000917872.1.95729 WP_000917872.1.9574 WP_000917872.1.95744 WP_000917872.1.95757 WP_000917872.1.95776 WP_000917872.1.95803 WP_000917872.1.95805 WP_000917872.1.95840 WP_000917872.1.9586 WP_000917872.1.95866 WP_000917872.1.95884 WP_000917872.1.95890 WP_000917872.1.95901 WP_000917872.1.95906 WP_000917872.1.95911 WP_000917872.1.95939 WP_000917872.1.95940 WP_000917872.1.95963 WP_000917872.1.96004 WP_000917872.1.96025 WP_000917872.1.96042 WP_000917872.1.96044 WP_000917872.1.96045 WP_000917872.1.96054 WP_000917872.1.9609 WP_000917872.1.96094 WP_000917872.1.96107 WP_000917872.1.96127 WP_000917872.1.96139 WP_000917872.1.96141 WP_000917872.1.96144 WP_000917872.1.96162 WP_000917872.1.96172 WP_000917872.1.96188 WP_000917872.1.96190 WP_000917872.1.96203 WP_000917872.1.96206 WP_000917872.1.96211 WP_000917872.1.96212 WP_000917872.1.9624 WP_000917872.1.96260 WP_000917872.1.9627 WP_000917872.1.9628 WP_000917872.1.96317 WP_000917872.1.96319 WP_000917872.1.9633 WP_000917872.1.96335 WP_000917872.1.96340 WP_000917872.1.96343 WP_000917872.1.96348 WP_000917872.1.96349 WP_000917872.1.96359 WP_000917872.1.96380 WP_000917872.1.96404 WP_000917872.1.9644 WP_000917872.1.96469 WP_000917872.1.96490 WP_000917872.1.96497 WP_000917872.1.96500 WP_000917872.1.96521 WP_000917872.1.96533 WP_000917872.1.96537 WP_000917872.1.96539 WP_000917872.1.96552 WP_000917872.1.96555 WP_000917872.1.96563 WP_000917872.1.96584 WP_000917872.1.96588 WP_000917872.1.96590 WP_000917872.1.96600 WP_000917872.1.96610 WP_000917872.1.96625 WP_000917872.1.96635 WP_000917872.1.9664 WP_000917872.1.96640 WP_000917872.1.96642 WP_000917872.1.96662 WP_000917872.1.96675 WP_000917872.1.9670 WP_000917872.1.96721 WP_000917872.1.96731 WP_000917872.1.96732 WP_000917872.1.96735 WP_000917872.1.9674 WP_000917872.1.96750 WP_000917872.1.96758 WP_000917872.1.96761 WP_000917872.1.96771 WP_000917872.1.96792 WP_000917872.1.96798 WP_000917872.1.96801 WP_000917872.1.96803 WP_000917872.1.96810 WP_000917872.1.9686 WP_000917872.1.96876 WP_000917872.1.96902 WP_000917872.1.96917 WP_000917872.1.96925 WP_000917872.1.96938 WP_000917872.1.96946 WP_000917872.1.96957 WP_000917872.1.96978 WP_000917872.1.96993 WP_000917872.1.97005 WP_000917872.1.97015 WP_000917872.1.97026 WP_000917872.1.97028 WP_000917872.1.97043 WP_000917872.1.97047 WP_000917872.1.97079 WP_000917872.1.97103 WP_000917872.1.97109 WP_000917872.1.97143 WP_000917872.1.97145 WP_000917872.1.97154 WP_000917872.1.97184 WP_000917872.1.97185 WP_000917872.1.97190 WP_000917872.1.97224 WP_000917872.1.97260 WP_000917872.1.97287 WP_000917872.1.97291 WP_000917872.1.97297 WP_000917872.1.97318 WP_000917872.1.97322 WP_000917872.1.97328 WP_000917872.1.97337 WP_000917872.1.97368 WP_000917872.1.97369 WP_000917872.1.97422 WP_000917872.1.97441 WP_000917872.1.97477 WP_000917872.1.97480 WP_000917872.1.97487 WP_000917872.1.97496 WP_000917872.1.97497 WP_000917872.1.97505 WP_000917872.1.97534 WP_000917872.1.97547 WP_000917872.1.97594 WP_000917872.1.97597 WP_000917872.1.97599 WP_000917872.1.97606 WP_000917872.1.97613 WP_000917872.1.97615 WP_000917872.1.97620 WP_000917872.1.97626 WP_000917872.1.97628 WP_000917872.1.97631 WP_000917872.1.97640 WP_000917872.1.97646 WP_000917872.1.97648 WP_000917872.1.97656 WP_000917872.1.97690 WP_000917872.1.97691 WP_000917872.1.97693 WP_000917872.1.97704 WP_000917872.1.97725 WP_000917872.1.97726 WP_000917872.1.97727 WP_000917872.1.97736 WP_000917872.1.9774 WP_000917872.1.9775 WP_000917872.1.97768 WP_000917872.1.97772 WP_000917872.1.97800 WP_000917872.1.97819 WP_000917872.1.97840 WP_000917872.1.97846 WP_000917872.1.97873 WP_000917872.1.97907 WP_000917872.1.9793 WP_000917872.1.97938 WP_000917872.1.97981 WP_000917872.1.97983 WP_000917872.1.97986 WP_000917872.1.9799 WP_000917872.1.97991 WP_000917872.1.98006 WP_000917872.1.98019 WP_000917872.1.98022 WP_000917872.1.98036 WP_000917872.1.9805 WP_000917872.1.98080 WP_000917872.1.98086 WP_000917872.1.9811 WP_000917872.1.98110 WP_000917872.1.98119 WP_000917872.1.98124 WP_000917872.1.98146 WP_000917872.1.98158 WP_000917872.1.98170 WP_000917872.1.98201 WP_000917872.1.98219 WP_000917872.1.98236 WP_000917872.1.98250 WP_000917872.1.9826 WP_000917872.1.98263 WP_000917872.1.98266 WP_000917872.1.98314 WP_000917872.1.98338 WP_000917872.1.98392 WP_000917872.1.98402 WP_000917872.1.98403 WP_000917872.1.9841 WP_000917872.1.98418 WP_000917872.1.98438 WP_000917872.1.98440 WP_000917872.1.98446 WP_000917872.1.98448 WP_000917872.1.98457 WP_000917872.1.98472 WP_000917872.1.98483 WP_000917872.1.98495 WP_000917872.1.9850 WP_000917872.1.98502 WP_000917872.1.98513 WP_000917872.1.98531 WP_000917872.1.98551 WP_000917872.1.98558 WP_000917872.1.98570 WP_000917872.1.98577 WP_000917872.1.98607 WP_000917872.1.98608 WP_000917872.1.98627 WP_000917872.1.9863 WP_000917872.1.98634 WP_000917872.1.98676 WP_000917872.1.98677 WP_000917872.1.98726 WP_000917872.1.98731 WP_000917872.1.98751 WP_000917872.1.98760 WP_000917872.1.98762 WP_000917872.1.98763 WP_000917872.1.9877 WP_000917872.1.98779 WP_000917872.1.98801 WP_000917872.1.98818 WP_000917872.1.98843 WP_000917872.1.9887 WP_000917872.1.98899 WP_000917872.1.98931 WP_000917872.1.98947 WP_000917872.1.9898 WP_000917872.1.9899 WP_000917872.1.99040 WP_000917872.1.99057 WP_000917872.1.99071 WP_000917872.1.99073 WP_000917872.1.99083 WP_000917872.1.99097 WP_000917872.1.99098 WP_000917872.1.99107 WP_000917872.1.99163 WP_000917872.1.99164 WP_000917872.1.99184 WP_000917872.1.9919 WP_000917872.1.99198 WP_000917872.1.99215 WP_000917872.1.99219 WP_000917872.1.99255 WP_000917872.1.99267 WP_000917872.1.99276 WP_000917872.1.99278 WP_000917872.1.99327 WP_000917872.1.99335 WP_000917872.1.99350 WP_000917872.1.99360 WP_000917872.1.99363 WP_000917872.1.99369 WP_000917872.1.99370 WP_000917872.1.99388 WP_000917872.1.99397 WP_000917872.1.99426 WP_000917872.1.99456 WP_000917872.1.99463 WP_000917872.1.99469 WP_000917872.1.99483 WP_000917872.1.99490 WP_000917872.1.99493 WP_000917872.1.99531 WP_000917872.1.9954 WP_000917872.1.99546 WP_000917872.1.99561 WP_000917872.1.99577 WP_000917872.1.99579 WP_000917872.1.99595 WP_000917872.1.99613 WP_000917872.1.99626 WP_000917872.1.99630 WP_000917872.1.99637 WP_000917872.1.99646 WP_000917872.1.99657 WP_000917872.1.99660 WP_000917872.1.99671 WP_000917872.1.99676 WP_000917872.1.99712 WP_000917872.1.99725 WP_000917872.1.99747 WP_000917872.1.99764 WP_000917872.1.99783 WP_000917872.1.99813 WP_000917872.1.99824 WP_000917872.1.99829 WP_000917872.1.99837 WP_000917872.1.99841 WP_000917872.1.99858 WP_000917872.1.99889 WP_000917872.1.9992 WP_000917872.1.99924 WP_000917872.1.99958 WP_000917872.1.99961 WP_000917872.1.99996 gi|378698236|ref|YP_005180193.1| gi|549722981|ref|YP_008643171.1| gi|198242273|ref|YP_002214219.1| gi|56414617|ref|YP_151692.1| gi|386590149|ref|YP_006086549.1| gi|452121436|ref|YP_007471684.1| gi|194447817|ref|YP_002044247.1| gi|488655088|ref|YP_007926891.1| ABAK02000001|CDS_4455808-4455341 ABAM02000001|CDS_804534-804067 ABAO01000059|CDS_8682-8215 ABEH02000001|CDS_700916-700449 ABEI01000010|CDS_8369-7902 ABEJ01000020|CDS_75846-76313 ABEL01000001|CDS_8750-8283 ABEW01000005|CDS_8686-8219 ABFH02000002|CDS_1824779-1825246 AE006468|CDS_303338-302871 AE014613|CDS_2678918-2679385 AL513382|CDS_301163-300696 AM933172|CDS_308306-307839 AM933173|CDS_305173-304706 CP000026|CDS_2605688-2606155 CP000880|CDS_2652630-2653097 CP000886|CDS_2801468-2801935 CP001113|CDS_305318-304851 CP001120|CDS_311105-310638 CP001127|CDS_305345-304878 CP001138|CDS_312971-312504 CP001144|CDS_304174-303707 CP001363|CDS_304038-303571 FM200053|CDS_2601224-2601691 FN424405|CDS_303325-302858 NZ_ACBF01000032|CDS_29932-30399 gi|378956355|ref|YP_005213842.1| gi|207855775|ref|YP_002242426.1| gi|378982800|ref|YP_005245955.1| gi|525948291|ref|YP_008309888.1| gi|563651869|ref|YP_008859924.1| gi|550899678|ref|YP_008668770.1| gi|194442619|ref|YP_002039497.1| gi|526219200|ref|YP_008264517.1| gi|537437920|ref|YP_008482297.1| gi|528817968|ref|YP_008359171.1| gi|379699479|ref|YP_005241207.1| gi|194736767|ref|YP_002113280.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]