SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378448573|ref|YP_005235932.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378448573|ref|YP_005235932.1|
Domain Number 1 Region: 7-184
Classification Level Classification E-value
Superfamily Ribonuclease H-like 2.45e-52
Family DnaQ-like 3'-5' exonuclease 0.0000000467
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|378448573|ref|YP_005235932.1|
Sequence length 243
Comment DNA polymerase III subunit epsilon [Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S]
Sequence
MSTAITRQIVLDTETTGMNQIGAHYEGHKIIEIGAVEVINRRLTGNNFHVYLKPDRLVDP
EAFGVHGIADEFLLDKPVFADVVDEFLDYIRGAELVIHNASFDIGFMDYEFGLLKRDIPK
TNTFCKVTDSLALARKMFPGKRNSLDALCSRYEIDNSKRTLHGALLDAQILAEVYLAMTG
GQTSMTFAMEGETQRQQGEATIQRIVRQASRLRVVFASEEELAAHESRLDLVQKKGGSCL
WRA
Download sequence
Identical sequences A0A0F6AX64 A0A0H2WST3 A0A0H3NHP2 A0A1X2UIS9 A0A221YWS6 A0A221ZA77 A0A232R937 A0A265B9Q7 A0A271CQD7 A0A2C6YV11 A0A2C9P743 A0A2G1NNS7 A0A2H9YC30 A0A2I6PAB8 A0A2J5W824 B5R5L4 P0A1G9 P0A1H0 V1XI02 V7UMI6
gi|378448573|ref|YP_005235932.1| gi|56414616|ref|YP_151691.1| gi|525816131|ref|YP_008246149.1| gi|378698237|ref|YP_005180194.1| gi|549722982|ref|YP_008643172.1| gi|378443710|ref|YP_005231342.1| gi|550899679|ref|YP_008668771.1| gi|378987663|ref|YP_005250827.1| gi|205351595|ref|YP_002225396.1| AE006468|CDS_303402-304133 AE014613|CDS_2678854-2678123 AL513382|CDS_301227-301958 AM933172|CDS_308370-309101 AM933173|CDS_305237-305968 CP000026|CDS_2605624-2604893 CP001363|CDS_304102-304833 FM200053|CDS_2601160-2600429 FN424405|CDS_303389-304120 NP_454867.1.84458 NP_459262.1.58477 WP_001670675.1.100002 WP_001670675.1.100007 WP_001670675.1.100008 WP_001670675.1.100010 WP_001670675.1.100017 WP_001670675.1.100031 WP_001670675.1.100036 WP_001670675.1.100077 WP_001670675.1.100079 WP_001670675.1.100115 WP_001670675.1.100129 WP_001670675.1.10013 WP_001670675.1.100149 WP_001670675.1.100165 WP_001670675.1.100191 WP_001670675.1.100196 WP_001670675.1.1002 WP_001670675.1.100234 WP_001670675.1.100258 WP_001670675.1.100266 WP_001670675.1.100284 WP_001670675.1.100288 WP_001670675.1.100313 WP_001670675.1.100314 WP_001670675.1.100321 WP_001670675.1.100354 WP_001670675.1.100376 WP_001670675.1.100392 WP_001670675.1.100412 WP_001670675.1.100413 WP_001670675.1.100421 WP_001670675.1.100424 WP_001670675.1.100432 WP_001670675.1.100436 WP_001670675.1.100446 WP_001670675.1.100450 WP_001670675.1.100457 WP_001670675.1.100472 WP_001670675.1.100484 WP_001670675.1.100488 WP_001670675.1.100502 WP_001670675.1.100519 WP_001670675.1.100521 WP_001670675.1.100541 WP_001670675.1.100557 WP_001670675.1.100584 WP_001670675.1.100589 WP_001670675.1.100592 WP_001670675.1.100597 WP_001670675.1.100605 WP_001670675.1.100610 WP_001670675.1.10065 WP_001670675.1.100650 WP_001670675.1.100707 WP_001670675.1.100711 WP_001670675.1.100721 WP_001670675.1.100730 WP_001670675.1.100732 WP_001670675.1.100733 WP_001670675.1.100739 WP_001670675.1.10074 WP_001670675.1.100750 WP_001670675.1.10076 WP_001670675.1.100764 WP_001670675.1.100773 WP_001670675.1.100776 WP_001670675.1.100781 WP_001670675.1.100790 WP_001670675.1.100793 WP_001670675.1.100799 WP_001670675.1.10081 WP_001670675.1.100857 WP_001670675.1.100865 WP_001670675.1.100869 WP_001670675.1.100871 WP_001670675.1.100882 WP_001670675.1.100895 WP_001670675.1.100932 WP_001670675.1.100941 WP_001670675.1.100944 WP_001670675.1.100948 WP_001670675.1.100953 WP_001670675.1.101007 WP_001670675.1.101011 WP_001670675.1.101020 WP_001670675.1.101042 WP_001670675.1.101074 WP_001670675.1.101078 WP_001670675.1.10108 WP_001670675.1.101091 WP_001670675.1.101094 WP_001670675.1.101112 WP_001670675.1.101123 WP_001670675.1.101126 WP_001670675.1.101180 WP_001670675.1.101185 WP_001670675.1.101199 WP_001670675.1.101223 WP_001670675.1.101226 WP_001670675.1.101239 WP_001670675.1.10124 WP_001670675.1.101259 WP_001670675.1.101271 WP_001670675.1.101284 WP_001670675.1.101291 WP_001670675.1.1013 WP_001670675.1.101312 WP_001670675.1.101320 WP_001670675.1.101322 WP_001670675.1.101353 WP_001670675.1.101374 WP_001670675.1.101386 WP_001670675.1.101404 WP_001670675.1.101420 WP_001670675.1.101454 WP_001670675.1.101473 WP_001670675.1.101519 WP_001670675.1.101520 WP_001670675.1.101541 WP_001670675.1.101589 WP_001670675.1.101609 WP_001670675.1.101612 WP_001670675.1.101616 WP_001670675.1.101634 WP_001670675.1.101636 WP_001670675.1.101639 WP_001670675.1.101674 WP_001670675.1.101707 WP_001670675.1.101724 WP_001670675.1.101734 WP_001670675.1.101740 WP_001670675.1.101741 WP_001670675.1.101744 WP_001670675.1.101759 WP_001670675.1.101776 WP_001670675.1.101832 WP_001670675.1.101839 WP_001670675.1.101841 WP_001670675.1.101878 WP_001670675.1.101890 WP_001670675.1.101904 WP_001670675.1.10191 WP_001670675.1.101917 WP_001670675.1.101927 WP_001670675.1.101941 WP_001670675.1.101949 WP_001670675.1.101953 WP_001670675.1.101975 WP_001670675.1.102009 WP_001670675.1.102050 WP_001670675.1.102087 WP_001670675.1.102103 WP_001670675.1.102111 WP_001670675.1.10220 WP_001670675.1.10231 WP_001670675.1.10237 WP_001670675.1.10266 WP_001670675.1.10276 WP_001670675.1.10300 WP_001670675.1.10310 WP_001670675.1.10338 WP_001670675.1.1038 WP_001670675.1.10394 WP_001670675.1.104 WP_001670675.1.10401 WP_001670675.1.10428 WP_001670675.1.10429 WP_001670675.1.10439 WP_001670675.1.10459 WP_001670675.1.10463 WP_001670675.1.10465 WP_001670675.1.10475 WP_001670675.1.10498 WP_001670675.1.10507 WP_001670675.1.10511 WP_001670675.1.10514 WP_001670675.1.10521 WP_001670675.1.10530 WP_001670675.1.10532 WP_001670675.1.10547 WP_001670675.1.10562 WP_001670675.1.10566 WP_001670675.1.10568 WP_001670675.1.10595 WP_001670675.1.10631 WP_001670675.1.10642 WP_001670675.1.10654 WP_001670675.1.10675 WP_001670675.1.10677 WP_001670675.1.10678 WP_001670675.1.10711 WP_001670675.1.10720 WP_001670675.1.10753 WP_001670675.1.10755 WP_001670675.1.10797 WP_001670675.1.10857 WP_001670675.1.10868 WP_001670675.1.10873 WP_001670675.1.10898 WP_001670675.1.10926 WP_001670675.1.10936 WP_001670675.1.10992 WP_001670675.1.11000 WP_001670675.1.11012 WP_001670675.1.11024 WP_001670675.1.11031 WP_001670675.1.11055 WP_001670675.1.11098 WP_001670675.1.1110 WP_001670675.1.11119 WP_001670675.1.11126 WP_001670675.1.11142 WP_001670675.1.11156 WP_001670675.1.11168 WP_001670675.1.11190 WP_001670675.1.11213 WP_001670675.1.11216 WP_001670675.1.11239 WP_001670675.1.11253 WP_001670675.1.11254 WP_001670675.1.11295 WP_001670675.1.11304 WP_001670675.1.11314 WP_001670675.1.1135 WP_001670675.1.11362 WP_001670675.1.11369 WP_001670675.1.11385 WP_001670675.1.11405 WP_001670675.1.1142 WP_001670675.1.11426 WP_001670675.1.11429 WP_001670675.1.11444 WP_001670675.1.11455 WP_001670675.1.11458 WP_001670675.1.1150 WP_001670675.1.11518 WP_001670675.1.11526 WP_001670675.1.11532 WP_001670675.1.11543 WP_001670675.1.11544 WP_001670675.1.11557 WP_001670675.1.1156 WP_001670675.1.11565 WP_001670675.1.11567 WP_001670675.1.11588 WP_001670675.1.11621 WP_001670675.1.11638 WP_001670675.1.11677 WP_001670675.1.11687 WP_001670675.1.1169 WP_001670675.1.11735 WP_001670675.1.1174 WP_001670675.1.11763 WP_001670675.1.11772 WP_001670675.1.11810 WP_001670675.1.11824 WP_001670675.1.11834 WP_001670675.1.11841 WP_001670675.1.11865 WP_001670675.1.11868 WP_001670675.1.11875 WP_001670675.1.11883 WP_001670675.1.11897 WP_001670675.1.11900 WP_001670675.1.11908 WP_001670675.1.11914 WP_001670675.1.11964 WP_001670675.1.11978 WP_001670675.1.12007 WP_001670675.1.12017 WP_001670675.1.12025 WP_001670675.1.12027 WP_001670675.1.12040 WP_001670675.1.12047 WP_001670675.1.12059 WP_001670675.1.12061 WP_001670675.1.12063 WP_001670675.1.1207 WP_001670675.1.12106 WP_001670675.1.12114 WP_001670675.1.12141 WP_001670675.1.1215 WP_001670675.1.12159 WP_001670675.1.12160 WP_001670675.1.12168 WP_001670675.1.12172 WP_001670675.1.12192 WP_001670675.1.12210 WP_001670675.1.1224 WP_001670675.1.12244 WP_001670675.1.12280 WP_001670675.1.12308 WP_001670675.1.12340 WP_001670675.1.12351 WP_001670675.1.12364 WP_001670675.1.12370 WP_001670675.1.12374 WP_001670675.1.1239 WP_001670675.1.12396 WP_001670675.1.12397 WP_001670675.1.12398 WP_001670675.1.12441 WP_001670675.1.12456 WP_001670675.1.12472 WP_001670675.1.12485 WP_001670675.1.1250 WP_001670675.1.12546 WP_001670675.1.12568 WP_001670675.1.12569 WP_001670675.1.12581 WP_001670675.1.12584 WP_001670675.1.12585 WP_001670675.1.12620 WP_001670675.1.1264 WP_001670675.1.12648 WP_001670675.1.12650 WP_001670675.1.12683 WP_001670675.1.12696 WP_001670675.1.12701 WP_001670675.1.12718 WP_001670675.1.12726 WP_001670675.1.12727 WP_001670675.1.12728 WP_001670675.1.12741 WP_001670675.1.12834 WP_001670675.1.12864 WP_001670675.1.12865 WP_001670675.1.12879 WP_001670675.1.12936 WP_001670675.1.12995 WP_001670675.1.1300 WP_001670675.1.13027 WP_001670675.1.13076 WP_001670675.1.13101 WP_001670675.1.13102 WP_001670675.1.13106 WP_001670675.1.13108 WP_001670675.1.13130 WP_001670675.1.13161 WP_001670675.1.13207 WP_001670675.1.1321 WP_001670675.1.13247 WP_001670675.1.1326 WP_001670675.1.13262 WP_001670675.1.13268 WP_001670675.1.13274 WP_001670675.1.13291 WP_001670675.1.133 WP_001670675.1.13311 WP_001670675.1.13314 WP_001670675.1.13334 WP_001670675.1.13338 WP_001670675.1.13342 WP_001670675.1.13352 WP_001670675.1.13367 WP_001670675.1.13391 WP_001670675.1.13406 WP_001670675.1.13414 WP_001670675.1.13440 WP_001670675.1.13443 WP_001670675.1.13446 WP_001670675.1.1346 WP_001670675.1.13476 WP_001670675.1.13488 WP_001670675.1.13509 WP_001670675.1.13543 WP_001670675.1.13573 WP_001670675.1.13599 WP_001670675.1.13602 WP_001670675.1.13625 WP_001670675.1.13661 WP_001670675.1.13669 WP_001670675.1.13677 WP_001670675.1.13686 WP_001670675.1.1372 WP_001670675.1.13732 WP_001670675.1.13741 WP_001670675.1.13750 WP_001670675.1.13764 WP_001670675.1.13819 WP_001670675.1.1382 WP_001670675.1.13829 WP_001670675.1.13848 WP_001670675.1.13857 WP_001670675.1.1387 WP_001670675.1.13908 WP_001670675.1.13932 WP_001670675.1.13967 WP_001670675.1.13968 WP_001670675.1.1397 WP_001670675.1.13972 WP_001670675.1.140 WP_001670675.1.14001 WP_001670675.1.1401 WP_001670675.1.14041 WP_001670675.1.14050 WP_001670675.1.14056 WP_001670675.1.1408 WP_001670675.1.14089 WP_001670675.1.14099 WP_001670675.1.14111 WP_001670675.1.1412 WP_001670675.1.14120 WP_001670675.1.14123 WP_001670675.1.14150 WP_001670675.1.14151 WP_001670675.1.14191 WP_001670675.1.14197 WP_001670675.1.14212 WP_001670675.1.14239 WP_001670675.1.14280 WP_001670675.1.14286 WP_001670675.1.14320 WP_001670675.1.14333 WP_001670675.1.14369 WP_001670675.1.14379 WP_001670675.1.14399 WP_001670675.1.1440 WP_001670675.1.14406 WP_001670675.1.14410 WP_001670675.1.14436 WP_001670675.1.14444 WP_001670675.1.14446 WP_001670675.1.14458 WP_001670675.1.14466 WP_001670675.1.14467 WP_001670675.1.14474 WP_001670675.1.14495 WP_001670675.1.14500 WP_001670675.1.14505 WP_001670675.1.14516 WP_001670675.1.14519 WP_001670675.1.14524 WP_001670675.1.14526 WP_001670675.1.14528 WP_001670675.1.14550 WP_001670675.1.14554 WP_001670675.1.14575 WP_001670675.1.146 WP_001670675.1.14618 WP_001670675.1.14688 WP_001670675.1.14701 WP_001670675.1.14703 WP_001670675.1.14706 WP_001670675.1.14708 WP_001670675.1.14719 WP_001670675.1.14725 WP_001670675.1.1473 WP_001670675.1.14737 WP_001670675.1.14765 WP_001670675.1.14789 WP_001670675.1.14793 WP_001670675.1.14808 WP_001670675.1.14810 WP_001670675.1.14819 WP_001670675.1.14852 WP_001670675.1.14876 WP_001670675.1.14877 WP_001670675.1.14884 WP_001670675.1.1489 WP_001670675.1.14894 WP_001670675.1.14913 WP_001670675.1.14917 WP_001670675.1.14930 WP_001670675.1.14932 WP_001670675.1.14936 WP_001670675.1.14947 WP_001670675.1.14948 WP_001670675.1.14964 WP_001670675.1.15046 WP_001670675.1.15055 WP_001670675.1.15059 WP_001670675.1.15067 WP_001670675.1.15079 WP_001670675.1.15102 WP_001670675.1.15124 WP_001670675.1.15184 WP_001670675.1.15214 WP_001670675.1.15223 WP_001670675.1.15226 WP_001670675.1.15244 WP_001670675.1.15265 WP_001670675.1.15276 WP_001670675.1.15316 WP_001670675.1.15318 WP_001670675.1.15353 WP_001670675.1.15362 WP_001670675.1.15369 WP_001670675.1.1540 WP_001670675.1.15415 WP_001670675.1.15423 WP_001670675.1.15433 WP_001670675.1.15439 WP_001670675.1.15479 WP_001670675.1.15483 WP_001670675.1.15487 WP_001670675.1.15508 WP_001670675.1.1551 WP_001670675.1.15535 WP_001670675.1.15581 WP_001670675.1.15585 WP_001670675.1.15597 WP_001670675.1.15612 WP_001670675.1.15625 WP_001670675.1.15627 WP_001670675.1.15644 WP_001670675.1.1568 WP_001670675.1.15708 WP_001670675.1.15710 WP_001670675.1.15717 WP_001670675.1.15775 WP_001670675.1.15777 WP_001670675.1.15784 WP_001670675.1.158 WP_001670675.1.15830 WP_001670675.1.15835 WP_001670675.1.15862 WP_001670675.1.15881 WP_001670675.1.15905 WP_001670675.1.15909 WP_001670675.1.15910 WP_001670675.1.15912 WP_001670675.1.15922 WP_001670675.1.15938 WP_001670675.1.15970 WP_001670675.1.15978 WP_001670675.1.15986 WP_001670675.1.15995 WP_001670675.1.16000 WP_001670675.1.16004 WP_001670675.1.16006 WP_001670675.1.1601 WP_001670675.1.16028 WP_001670675.1.16032 WP_001670675.1.16046 WP_001670675.1.16047 WP_001670675.1.16051 WP_001670675.1.16052 WP_001670675.1.16058 WP_001670675.1.16062 WP_001670675.1.16063 WP_001670675.1.16103 WP_001670675.1.1611 WP_001670675.1.16125 WP_001670675.1.16150 WP_001670675.1.16155 WP_001670675.1.16158 WP_001670675.1.16166 WP_001670675.1.16172 WP_001670675.1.16226 WP_001670675.1.16233 WP_001670675.1.16244 WP_001670675.1.1626 WP_001670675.1.16264 WP_001670675.1.16273 WP_001670675.1.16284 WP_001670675.1.16328 WP_001670675.1.16331 WP_001670675.1.16344 WP_001670675.1.1635 WP_001670675.1.16361 WP_001670675.1.16363 WP_001670675.1.16365 WP_001670675.1.16366 WP_001670675.1.16394 WP_001670675.1.16452 WP_001670675.1.16453 WP_001670675.1.16461 WP_001670675.1.16462 WP_001670675.1.16465 WP_001670675.1.16468 WP_001670675.1.16474 WP_001670675.1.16508 WP_001670675.1.16522 WP_001670675.1.16525 WP_001670675.1.16551 WP_001670675.1.16565 WP_001670675.1.16588 WP_001670675.1.16614 WP_001670675.1.16650 WP_001670675.1.16656 WP_001670675.1.16658 WP_001670675.1.16666 WP_001670675.1.16673 WP_001670675.1.16686 WP_001670675.1.16691 WP_001670675.1.167 WP_001670675.1.16710 WP_001670675.1.16729 WP_001670675.1.16732 WP_001670675.1.16735 WP_001670675.1.16736 WP_001670675.1.1674 WP_001670675.1.16767 WP_001670675.1.16781 WP_001670675.1.16786 WP_001670675.1.16819 WP_001670675.1.16826 WP_001670675.1.16846 WP_001670675.1.16855 WP_001670675.1.16858 WP_001670675.1.16873 WP_001670675.1.16879 WP_001670675.1.1689 WP_001670675.1.16893 WP_001670675.1.16896 WP_001670675.1.16903 WP_001670675.1.16905 WP_001670675.1.16910 WP_001670675.1.16916 WP_001670675.1.16941 WP_001670675.1.16944 WP_001670675.1.16948 WP_001670675.1.16949 WP_001670675.1.16965 WP_001670675.1.16972 WP_001670675.1.16998 WP_001670675.1.1700 WP_001670675.1.17031 WP_001670675.1.17049 WP_001670675.1.17058 WP_001670675.1.17060 WP_001670675.1.17078 WP_001670675.1.17093 WP_001670675.1.17096 WP_001670675.1.17098 WP_001670675.1.17105 WP_001670675.1.17188 WP_001670675.1.17202 WP_001670675.1.17219 WP_001670675.1.1722 WP_001670675.1.17285 WP_001670675.1.17302 WP_001670675.1.17307 WP_001670675.1.17308 WP_001670675.1.1733 WP_001670675.1.17368 WP_001670675.1.1737 WP_001670675.1.174 WP_001670675.1.17405 WP_001670675.1.17406 WP_001670675.1.17439 WP_001670675.1.17447 WP_001670675.1.17480 WP_001670675.1.17482 WP_001670675.1.1749 WP_001670675.1.17504 WP_001670675.1.17513 WP_001670675.1.17525 WP_001670675.1.17543 WP_001670675.1.17546 WP_001670675.1.17560 WP_001670675.1.17563 WP_001670675.1.1757 WP_001670675.1.17578 WP_001670675.1.17583 WP_001670675.1.17622 WP_001670675.1.17629 WP_001670675.1.17659 WP_001670675.1.17667 WP_001670675.1.17686 WP_001670675.1.17693 WP_001670675.1.17702 WP_001670675.1.17705 WP_001670675.1.17732 WP_001670675.1.17741 WP_001670675.1.17743 WP_001670675.1.17747 WP_001670675.1.17755 WP_001670675.1.17840 WP_001670675.1.17865 WP_001670675.1.17886 WP_001670675.1.17891 WP_001670675.1.17901 WP_001670675.1.17914 WP_001670675.1.17919 WP_001670675.1.17936 WP_001670675.1.17949 WP_001670675.1.17956 WP_001670675.1.1798 WP_001670675.1.17991 WP_001670675.1.18005 WP_001670675.1.1801 WP_001670675.1.18019 WP_001670675.1.18021 WP_001670675.1.18056 WP_001670675.1.18061 WP_001670675.1.1807 WP_001670675.1.18089 WP_001670675.1.18092 WP_001670675.1.18099 WP_001670675.1.18109 WP_001670675.1.18111 WP_001670675.1.18122 WP_001670675.1.18124 WP_001670675.1.1814 WP_001670675.1.18144 WP_001670675.1.18149 WP_001670675.1.18163 WP_001670675.1.18173 WP_001670675.1.18177 WP_001670675.1.18178 WP_001670675.1.1818 WP_001670675.1.18249 WP_001670675.1.1825 WP_001670675.1.18254 WP_001670675.1.18265 WP_001670675.1.18267 WP_001670675.1.18270 WP_001670675.1.18280 WP_001670675.1.18281 WP_001670675.1.18282 WP_001670675.1.18328 WP_001670675.1.18355 WP_001670675.1.18358 WP_001670675.1.18370 WP_001670675.1.18384 WP_001670675.1.18406 WP_001670675.1.18426 WP_001670675.1.18441 WP_001670675.1.18445 WP_001670675.1.18468 WP_001670675.1.18474 WP_001670675.1.18485 WP_001670675.1.18513 WP_001670675.1.18607 WP_001670675.1.18610 WP_001670675.1.18641 WP_001670675.1.18678 WP_001670675.1.18686 WP_001670675.1.18692 WP_001670675.1.18705 WP_001670675.1.18715 WP_001670675.1.18722 WP_001670675.1.18737 WP_001670675.1.18776 WP_001670675.1.1880 WP_001670675.1.18822 WP_001670675.1.18847 WP_001670675.1.1885 WP_001670675.1.18860 WP_001670675.1.18881 WP_001670675.1.18886 WP_001670675.1.18919 WP_001670675.1.18922 WP_001670675.1.18940 WP_001670675.1.18949 WP_001670675.1.1895 WP_001670675.1.18959 WP_001670675.1.1897 WP_001670675.1.18972 WP_001670675.1.19001 WP_001670675.1.19006 WP_001670675.1.19044 WP_001670675.1.19053 WP_001670675.1.19055 WP_001670675.1.19084 WP_001670675.1.19093 WP_001670675.1.19163 WP_001670675.1.19187 WP_001670675.1.19228 WP_001670675.1.19240 WP_001670675.1.19273 WP_001670675.1.19288 WP_001670675.1.19291 WP_001670675.1.19300 WP_001670675.1.19320 WP_001670675.1.19373 WP_001670675.1.19422 WP_001670675.1.19433 WP_001670675.1.19454 WP_001670675.1.19456 WP_001670675.1.19458 WP_001670675.1.19460 WP_001670675.1.19461 WP_001670675.1.19469 WP_001670675.1.19496 WP_001670675.1.19535 WP_001670675.1.19538 WP_001670675.1.1955 WP_001670675.1.19588 WP_001670675.1.19589 WP_001670675.1.19614 WP_001670675.1.19616 WP_001670675.1.19642 WP_001670675.1.19656 WP_001670675.1.19660 WP_001670675.1.19663 WP_001670675.1.1968 WP_001670675.1.19686 WP_001670675.1.19702 WP_001670675.1.19706 WP_001670675.1.19723 WP_001670675.1.19724 WP_001670675.1.19731 WP_001670675.1.19740 WP_001670675.1.19749 WP_001670675.1.19784 WP_001670675.1.19794 WP_001670675.1.19802 WP_001670675.1.19809 WP_001670675.1.19823 WP_001670675.1.19834 WP_001670675.1.19851 WP_001670675.1.19867 WP_001670675.1.19882 WP_001670675.1.1990 WP_001670675.1.1992 WP_001670675.1.19938 WP_001670675.1.19975 WP_001670675.1.1998 WP_001670675.1.19999 WP_001670675.1.20 WP_001670675.1.20023 WP_001670675.1.20081 WP_001670675.1.20086 WP_001670675.1.20089 WP_001670675.1.2010 WP_001670675.1.20119 WP_001670675.1.20212 WP_001670675.1.20218 WP_001670675.1.20254 WP_001670675.1.20255 WP_001670675.1.20261 WP_001670675.1.20266 WP_001670675.1.20271 WP_001670675.1.20296 WP_001670675.1.20330 WP_001670675.1.20339 WP_001670675.1.20349 WP_001670675.1.2036 WP_001670675.1.20362 WP_001670675.1.20376 WP_001670675.1.20391 WP_001670675.1.2041 WP_001670675.1.20415 WP_001670675.1.20418 WP_001670675.1.20419 WP_001670675.1.20425 WP_001670675.1.20437 WP_001670675.1.20443 WP_001670675.1.20446 WP_001670675.1.20465 WP_001670675.1.2047 WP_001670675.1.20488 WP_001670675.1.20492 WP_001670675.1.20503 WP_001670675.1.20525 WP_001670675.1.2053 WP_001670675.1.2054 WP_001670675.1.20553 WP_001670675.1.20573 WP_001670675.1.20614 WP_001670675.1.20626 WP_001670675.1.20631 WP_001670675.1.20635 WP_001670675.1.20646 WP_001670675.1.20695 WP_001670675.1.20700 WP_001670675.1.20718 WP_001670675.1.20721 WP_001670675.1.2073 WP_001670675.1.20740 WP_001670675.1.20767 WP_001670675.1.20789 WP_001670675.1.20795 WP_001670675.1.20828 WP_001670675.1.20839 WP_001670675.1.20862 WP_001670675.1.2087 WP_001670675.1.20883 WP_001670675.1.20886 WP_001670675.1.20894 WP_001670675.1.20900 WP_001670675.1.20908 WP_001670675.1.2091 WP_001670675.1.20947 WP_001670675.1.20953 WP_001670675.1.2101 WP_001670675.1.21010 WP_001670675.1.2106 WP_001670675.1.21062 WP_001670675.1.2107 WP_001670675.1.21075 WP_001670675.1.21079 WP_001670675.1.21086 WP_001670675.1.21103 WP_001670675.1.21136 WP_001670675.1.21144 WP_001670675.1.21146 WP_001670675.1.2116 WP_001670675.1.21162 WP_001670675.1.21165 WP_001670675.1.21184 WP_001670675.1.21185 WP_001670675.1.21194 WP_001670675.1.21202 WP_001670675.1.21241 WP_001670675.1.21245 WP_001670675.1.21246 WP_001670675.1.21269 WP_001670675.1.21286 WP_001670675.1.21309 WP_001670675.1.21326 WP_001670675.1.21332 WP_001670675.1.21351 WP_001670675.1.21366 WP_001670675.1.2139 WP_001670675.1.21399 WP_001670675.1.21400 WP_001670675.1.21404 WP_001670675.1.21443 WP_001670675.1.21453 WP_001670675.1.2146 WP_001670675.1.21492 WP_001670675.1.21497 WP_001670675.1.21499 WP_001670675.1.21534 WP_001670675.1.21548 WP_001670675.1.21603 WP_001670675.1.21616 WP_001670675.1.2166 WP_001670675.1.21674 WP_001670675.1.21681 WP_001670675.1.21715 WP_001670675.1.21750 WP_001670675.1.21751 WP_001670675.1.21757 WP_001670675.1.21792 WP_001670675.1.21825 WP_001670675.1.21845 WP_001670675.1.21886 WP_001670675.1.21909 WP_001670675.1.21910 WP_001670675.1.21940 WP_001670675.1.21946 WP_001670675.1.21950 WP_001670675.1.21966 WP_001670675.1.21991 WP_001670675.1.22019 WP_001670675.1.22024 WP_001670675.1.22030 WP_001670675.1.2205 WP_001670675.1.22051 WP_001670675.1.22062 WP_001670675.1.22064 WP_001670675.1.22067 WP_001670675.1.22096 WP_001670675.1.22117 WP_001670675.1.22118 WP_001670675.1.22126 WP_001670675.1.22136 WP_001670675.1.22158 WP_001670675.1.2216 WP_001670675.1.22162 WP_001670675.1.22169 WP_001670675.1.22205 WP_001670675.1.22208 WP_001670675.1.2221 WP_001670675.1.22235 WP_001670675.1.22240 WP_001670675.1.2227 WP_001670675.1.22296 WP_001670675.1.22315 WP_001670675.1.22323 WP_001670675.1.22337 WP_001670675.1.22346 WP_001670675.1.2235 WP_001670675.1.22373 WP_001670675.1.22379 WP_001670675.1.22427 WP_001670675.1.22449 WP_001670675.1.22451 WP_001670675.1.22453 WP_001670675.1.22454 WP_001670675.1.2246 WP_001670675.1.22476 WP_001670675.1.22485 WP_001670675.1.22514 WP_001670675.1.22537 WP_001670675.1.22565 WP_001670675.1.22566 WP_001670675.1.22575 WP_001670675.1.22582 WP_001670675.1.22590 WP_001670675.1.22595 WP_001670675.1.22604 WP_001670675.1.22605 WP_001670675.1.22614 WP_001670675.1.22620 WP_001670675.1.22623 WP_001670675.1.22652 WP_001670675.1.22683 WP_001670675.1.22692 WP_001670675.1.22758 WP_001670675.1.22760 WP_001670675.1.2284 WP_001670675.1.22845 WP_001670675.1.22857 WP_001670675.1.22864 WP_001670675.1.22870 WP_001670675.1.22880 WP_001670675.1.22895 WP_001670675.1.22902 WP_001670675.1.22926 WP_001670675.1.22943 WP_001670675.1.22947 WP_001670675.1.22967 WP_001670675.1.22979 WP_001670675.1.23010 WP_001670675.1.23040 WP_001670675.1.23058 WP_001670675.1.23080 WP_001670675.1.23102 WP_001670675.1.23114 WP_001670675.1.2314 WP_001670675.1.23148 WP_001670675.1.23155 WP_001670675.1.23169 WP_001670675.1.23172 WP_001670675.1.23175 WP_001670675.1.23192 WP_001670675.1.23218 WP_001670675.1.2324 WP_001670675.1.23246 WP_001670675.1.23258 WP_001670675.1.23259 WP_001670675.1.23279 WP_001670675.1.23309 WP_001670675.1.2331 WP_001670675.1.23311 WP_001670675.1.2332 WP_001670675.1.23329 WP_001670675.1.23340 WP_001670675.1.23343 WP_001670675.1.2336 WP_001670675.1.23365 WP_001670675.1.23379 WP_001670675.1.23412 WP_001670675.1.2342 WP_001670675.1.23426 WP_001670675.1.23442 WP_001670675.1.23460 WP_001670675.1.23472 WP_001670675.1.23482 WP_001670675.1.23485 WP_001670675.1.23492 WP_001670675.1.23500 WP_001670675.1.23503 WP_001670675.1.23509 WP_001670675.1.23513 WP_001670675.1.23515 WP_001670675.1.23529 WP_001670675.1.23548 WP_001670675.1.23571 WP_001670675.1.2358 WP_001670675.1.23587 WP_001670675.1.23604 WP_001670675.1.23621 WP_001670675.1.23629 WP_001670675.1.23631 WP_001670675.1.23634 WP_001670675.1.23639 WP_001670675.1.2364 WP_001670675.1.23643 WP_001670675.1.23646 WP_001670675.1.23670 WP_001670675.1.23675 WP_001670675.1.23679 WP_001670675.1.23685 WP_001670675.1.237 WP_001670675.1.23707 WP_001670675.1.23720 WP_001670675.1.23728 WP_001670675.1.23736 WP_001670675.1.23746 WP_001670675.1.2375 WP_001670675.1.23755 WP_001670675.1.2376 WP_001670675.1.23783 WP_001670675.1.23786 WP_001670675.1.23787 WP_001670675.1.2380 WP_001670675.1.23801 WP_001670675.1.23819 WP_001670675.1.23932 WP_001670675.1.23959 WP_001670675.1.24017 WP_001670675.1.24028 WP_001670675.1.24061 WP_001670675.1.24082 WP_001670675.1.24083 WP_001670675.1.24117 WP_001670675.1.24125 WP_001670675.1.24138 WP_001670675.1.24145 WP_001670675.1.2415 WP_001670675.1.24153 WP_001670675.1.24158 WP_001670675.1.24163 WP_001670675.1.24206 WP_001670675.1.24214 WP_001670675.1.24250 WP_001670675.1.24259 WP_001670675.1.24291 WP_001670675.1.24297 WP_001670675.1.24308 WP_001670675.1.24322 WP_001670675.1.24355 WP_001670675.1.24361 WP_001670675.1.24375 WP_001670675.1.24392 WP_001670675.1.24394 WP_001670675.1.24400 WP_001670675.1.24408 WP_001670675.1.24409 WP_001670675.1.24419 WP_001670675.1.24420 WP_001670675.1.24433 WP_001670675.1.24444 WP_001670675.1.24476 WP_001670675.1.24494 WP_001670675.1.24567 WP_001670675.1.24578 WP_001670675.1.24619 WP_001670675.1.24643 WP_001670675.1.2467 WP_001670675.1.24673 WP_001670675.1.24686 WP_001670675.1.24688 WP_001670675.1.24689 WP_001670675.1.24696 WP_001670675.1.24716 WP_001670675.1.24723 WP_001670675.1.24737 WP_001670675.1.24779 WP_001670675.1.24803 WP_001670675.1.2481 WP_001670675.1.24832 WP_001670675.1.24837 WP_001670675.1.24839 WP_001670675.1.24873 WP_001670675.1.24901 WP_001670675.1.24944 WP_001670675.1.24964 WP_001670675.1.24995 WP_001670675.1.25008 WP_001670675.1.25015 WP_001670675.1.25017 WP_001670675.1.25032 WP_001670675.1.25036 WP_001670675.1.25041 WP_001670675.1.25053 WP_001670675.1.25064 WP_001670675.1.25072 WP_001670675.1.25119 WP_001670675.1.25130 WP_001670675.1.25140 WP_001670675.1.25159 WP_001670675.1.25175 WP_001670675.1.25185 WP_001670675.1.25196 WP_001670675.1.25205 WP_001670675.1.25206 WP_001670675.1.25210 WP_001670675.1.25219 WP_001670675.1.2525 WP_001670675.1.25304 WP_001670675.1.25354 WP_001670675.1.25374 WP_001670675.1.25405 WP_001670675.1.25421 WP_001670675.1.25426 WP_001670675.1.25454 WP_001670675.1.25475 WP_001670675.1.25490 WP_001670675.1.25493 WP_001670675.1.25498 WP_001670675.1.25508 WP_001670675.1.25512 WP_001670675.1.25514 WP_001670675.1.2554 WP_001670675.1.25546 WP_001670675.1.25564 WP_001670675.1.25603 WP_001670675.1.25618 WP_001670675.1.2562 WP_001670675.1.25666 WP_001670675.1.25668 WP_001670675.1.2568 WP_001670675.1.25690 WP_001670675.1.2570 WP_001670675.1.25700 WP_001670675.1.25703 WP_001670675.1.25709 WP_001670675.1.25722 WP_001670675.1.25740 WP_001670675.1.25780 WP_001670675.1.25793 WP_001670675.1.25807 WP_001670675.1.25809 WP_001670675.1.25814 WP_001670675.1.25821 WP_001670675.1.25825 WP_001670675.1.25833 WP_001670675.1.25835 WP_001670675.1.25846 WP_001670675.1.25882 WP_001670675.1.25911 WP_001670675.1.25928 WP_001670675.1.25932 WP_001670675.1.25944 WP_001670675.1.25951 WP_001670675.1.25962 WP_001670675.1.25963 WP_001670675.1.25988 WP_001670675.1.26001 WP_001670675.1.26027 WP_001670675.1.26030 WP_001670675.1.26083 WP_001670675.1.26093 WP_001670675.1.26107 WP_001670675.1.26122 WP_001670675.1.26123 WP_001670675.1.26129 WP_001670675.1.2615 WP_001670675.1.26194 WP_001670675.1.26199 WP_001670675.1.26217 WP_001670675.1.26224 WP_001670675.1.26230 WP_001670675.1.26232 WP_001670675.1.26269 WP_001670675.1.26272 WP_001670675.1.26282 WP_001670675.1.26286 WP_001670675.1.26288 WP_001670675.1.26311 WP_001670675.1.26319 WP_001670675.1.2634 WP_001670675.1.26363 WP_001670675.1.26384 WP_001670675.1.26394 WP_001670675.1.26426 WP_001670675.1.26429 WP_001670675.1.26440 WP_001670675.1.26441 WP_001670675.1.26491 WP_001670675.1.26493 WP_001670675.1.26512 WP_001670675.1.26532 WP_001670675.1.2654 WP_001670675.1.26551 WP_001670675.1.26554 WP_001670675.1.26567 WP_001670675.1.26576 WP_001670675.1.26582 WP_001670675.1.26587 WP_001670675.1.2660 WP_001670675.1.26636 WP_001670675.1.26646 WP_001670675.1.26687 WP_001670675.1.26689 WP_001670675.1.26709 WP_001670675.1.2672 WP_001670675.1.26741 WP_001670675.1.26750 WP_001670675.1.26787 WP_001670675.1.2679 WP_001670675.1.26794 WP_001670675.1.26856 WP_001670675.1.26882 WP_001670675.1.26883 WP_001670675.1.26892 WP_001670675.1.26908 WP_001670675.1.26919 WP_001670675.1.2692 WP_001670675.1.26924 WP_001670675.1.26928 WP_001670675.1.26936 WP_001670675.1.26980 WP_001670675.1.270 WP_001670675.1.27008 WP_001670675.1.27010 WP_001670675.1.27027 WP_001670675.1.27051 WP_001670675.1.27070 WP_001670675.1.27072 WP_001670675.1.27077 WP_001670675.1.27084 WP_001670675.1.27086 WP_001670675.1.27087 WP_001670675.1.27111 WP_001670675.1.27115 WP_001670675.1.2713 WP_001670675.1.2717 WP_001670675.1.27173 WP_001670675.1.272 WP_001670675.1.27206 WP_001670675.1.27223 WP_001670675.1.27228 WP_001670675.1.2723 WP_001670675.1.27255 WP_001670675.1.27272 WP_001670675.1.27282 WP_001670675.1.27285 WP_001670675.1.27309 WP_001670675.1.27314 WP_001670675.1.27329 WP_001670675.1.27342 WP_001670675.1.27361 WP_001670675.1.27383 WP_001670675.1.27419 WP_001670675.1.27423 WP_001670675.1.27452 WP_001670675.1.27513 WP_001670675.1.27522 WP_001670675.1.27523 WP_001670675.1.27535 WP_001670675.1.27544 WP_001670675.1.27547 WP_001670675.1.27556 WP_001670675.1.27561 WP_001670675.1.27565 WP_001670675.1.27595 WP_001670675.1.27598 WP_001670675.1.27616 WP_001670675.1.2763 WP_001670675.1.27632 WP_001670675.1.27638 WP_001670675.1.27658 WP_001670675.1.27665 WP_001670675.1.27679 WP_001670675.1.27706 WP_001670675.1.27707 WP_001670675.1.27713 WP_001670675.1.27755 WP_001670675.1.27761 WP_001670675.1.2777 WP_001670675.1.27775 WP_001670675.1.27785 WP_001670675.1.27798 WP_001670675.1.27800 WP_001670675.1.27815 WP_001670675.1.27833 WP_001670675.1.27857 WP_001670675.1.27883 WP_001670675.1.27900 WP_001670675.1.27928 WP_001670675.1.27945 WP_001670675.1.27969 WP_001670675.1.27977 WP_001670675.1.27995 WP_001670675.1.27997 WP_001670675.1.28002 WP_001670675.1.28004 WP_001670675.1.28032 WP_001670675.1.28037 WP_001670675.1.28056 WP_001670675.1.28073 WP_001670675.1.2809 WP_001670675.1.28094 WP_001670675.1.28126 WP_001670675.1.28139 WP_001670675.1.28155 WP_001670675.1.28170 WP_001670675.1.28198 WP_001670675.1.28200 WP_001670675.1.2822 WP_001670675.1.28225 WP_001670675.1.28229 WP_001670675.1.28232 WP_001670675.1.28233 WP_001670675.1.28235 WP_001670675.1.2825 WP_001670675.1.28267 WP_001670675.1.2829 WP_001670675.1.28301 WP_001670675.1.28302 WP_001670675.1.28303 WP_001670675.1.2835 WP_001670675.1.28370 WP_001670675.1.28384 WP_001670675.1.28386 WP_001670675.1.28395 WP_001670675.1.284 WP_001670675.1.2845 WP_001670675.1.28462 WP_001670675.1.28479 WP_001670675.1.28504 WP_001670675.1.28514 WP_001670675.1.2853 WP_001670675.1.28538 WP_001670675.1.28570 WP_001670675.1.28575 WP_001670675.1.28612 WP_001670675.1.28620 WP_001670675.1.28625 WP_001670675.1.28627 WP_001670675.1.28655 WP_001670675.1.28673 WP_001670675.1.28692 WP_001670675.1.28694 WP_001670675.1.287 WP_001670675.1.2873 WP_001670675.1.28733 WP_001670675.1.28773 WP_001670675.1.28776 WP_001670675.1.2879 WP_001670675.1.28811 WP_001670675.1.28830 WP_001670675.1.2890 WP_001670675.1.28902 WP_001670675.1.28917 WP_001670675.1.28938 WP_001670675.1.28946 WP_001670675.1.28948 WP_001670675.1.28962 WP_001670675.1.28977 WP_001670675.1.29006 WP_001670675.1.29010 WP_001670675.1.29023 WP_001670675.1.29042 WP_001670675.1.2905 WP_001670675.1.2907 WP_001670675.1.29081 WP_001670675.1.29089 WP_001670675.1.29099 WP_001670675.1.2910 WP_001670675.1.29113 WP_001670675.1.29130 WP_001670675.1.29153 WP_001670675.1.29168 WP_001670675.1.29174 WP_001670675.1.29190 WP_001670675.1.29203 WP_001670675.1.29218 WP_001670675.1.29237 WP_001670675.1.2924 WP_001670675.1.29248 WP_001670675.1.29255 WP_001670675.1.29274 WP_001670675.1.29288 WP_001670675.1.2932 WP_001670675.1.29349 WP_001670675.1.29379 WP_001670675.1.29389 WP_001670675.1.29422 WP_001670675.1.29436 WP_001670675.1.29439 WP_001670675.1.29454 WP_001670675.1.2946 WP_001670675.1.29462 WP_001670675.1.29509 WP_001670675.1.29530 WP_001670675.1.29563 WP_001670675.1.29576 WP_001670675.1.29588 WP_001670675.1.29601 WP_001670675.1.29606 WP_001670675.1.29615 WP_001670675.1.29619 WP_001670675.1.29682 WP_001670675.1.29704 WP_001670675.1.29711 WP_001670675.1.29727 WP_001670675.1.29732 WP_001670675.1.29743 WP_001670675.1.29768 WP_001670675.1.29774 WP_001670675.1.29775 WP_001670675.1.29782 WP_001670675.1.29827 WP_001670675.1.29833 WP_001670675.1.2984 WP_001670675.1.29845 WP_001670675.1.29851 WP_001670675.1.29865 WP_001670675.1.29886 WP_001670675.1.29898 WP_001670675.1.29919 WP_001670675.1.29923 WP_001670675.1.29924 WP_001670675.1.2994 WP_001670675.1.29964 WP_001670675.1.29969 WP_001670675.1.29983 WP_001670675.1.29990 WP_001670675.1.30006 WP_001670675.1.30009 WP_001670675.1.30013 WP_001670675.1.3002 WP_001670675.1.30022 WP_001670675.1.30027 WP_001670675.1.30034 WP_001670675.1.30049 WP_001670675.1.3005 WP_001670675.1.30058 WP_001670675.1.30059 WP_001670675.1.30086 WP_001670675.1.30093 WP_001670675.1.30165 WP_001670675.1.3017 WP_001670675.1.30170 WP_001670675.1.30172 WP_001670675.1.30179 WP_001670675.1.30180 WP_001670675.1.30185 WP_001670675.1.30195 WP_001670675.1.30202 WP_001670675.1.30210 WP_001670675.1.30238 WP_001670675.1.30246 WP_001670675.1.30278 WP_001670675.1.30331 WP_001670675.1.30354 WP_001670675.1.30356 WP_001670675.1.30357 WP_001670675.1.30362 WP_001670675.1.30386 WP_001670675.1.3042 WP_001670675.1.30421 WP_001670675.1.30425 WP_001670675.1.30437 WP_001670675.1.30440 WP_001670675.1.30448 WP_001670675.1.30469 WP_001670675.1.30489 WP_001670675.1.30492 WP_001670675.1.30505 WP_001670675.1.30507 WP_001670675.1.30517 WP_001670675.1.30535 WP_001670675.1.30542 WP_001670675.1.30544 WP_001670675.1.30547 WP_001670675.1.30548 WP_001670675.1.30555 WP_001670675.1.30556 WP_001670675.1.30572 WP_001670675.1.30585 WP_001670675.1.30589 WP_001670675.1.30602 WP_001670675.1.30618 WP_001670675.1.30619 WP_001670675.1.30627 WP_001670675.1.30664 WP_001670675.1.3067 WP_001670675.1.3068 WP_001670675.1.30688 WP_001670675.1.30696 WP_001670675.1.30752 WP_001670675.1.3076 WP_001670675.1.30794 WP_001670675.1.3080 WP_001670675.1.30803 WP_001670675.1.30806 WP_001670675.1.30819 WP_001670675.1.30823 WP_001670675.1.30833 WP_001670675.1.30835 WP_001670675.1.30909 WP_001670675.1.30951 WP_001670675.1.30967 WP_001670675.1.30968 WP_001670675.1.30972 WP_001670675.1.31 WP_001670675.1.31001 WP_001670675.1.31011 WP_001670675.1.31046 WP_001670675.1.31066 WP_001670675.1.31069 WP_001670675.1.31078 WP_001670675.1.31086 WP_001670675.1.31092 WP_001670675.1.31111 WP_001670675.1.31122 WP_001670675.1.3113 WP_001670675.1.31139 WP_001670675.1.3114 WP_001670675.1.31145 WP_001670675.1.31156 WP_001670675.1.31167 WP_001670675.1.31171 WP_001670675.1.31182 WP_001670675.1.31185 WP_001670675.1.3119 WP_001670675.1.31190 WP_001670675.1.31195 WP_001670675.1.31196 WP_001670675.1.31198 WP_001670675.1.31205 WP_001670675.1.3121 WP_001670675.1.31210 WP_001670675.1.31214 WP_001670675.1.31219 WP_001670675.1.31222 WP_001670675.1.31223 WP_001670675.1.3124 WP_001670675.1.31251 WP_001670675.1.3127 WP_001670675.1.31272 WP_001670675.1.31281 WP_001670675.1.31303 WP_001670675.1.3131 WP_001670675.1.31335 WP_001670675.1.31352 WP_001670675.1.31362 WP_001670675.1.31389 WP_001670675.1.31413 WP_001670675.1.31435 WP_001670675.1.31446 WP_001670675.1.31451 WP_001670675.1.31476 WP_001670675.1.31504 WP_001670675.1.31515 WP_001670675.1.31533 WP_001670675.1.31578 WP_001670675.1.31585 WP_001670675.1.31658 WP_001670675.1.31665 WP_001670675.1.3167 WP_001670675.1.3170 WP_001670675.1.31720 WP_001670675.1.31725 WP_001670675.1.31762 WP_001670675.1.31782 WP_001670675.1.31799 WP_001670675.1.31836 WP_001670675.1.31845 WP_001670675.1.31854 WP_001670675.1.31895 WP_001670675.1.31901 WP_001670675.1.31940 WP_001670675.1.31951 WP_001670675.1.31952 WP_001670675.1.31967 WP_001670675.1.31972 WP_001670675.1.31983 WP_001670675.1.32006 WP_001670675.1.32041 WP_001670675.1.32042 WP_001670675.1.32056 WP_001670675.1.3207 WP_001670675.1.32109 WP_001670675.1.32116 WP_001670675.1.32170 WP_001670675.1.32189 WP_001670675.1.32192 WP_001670675.1.32202 WP_001670675.1.32206 WP_001670675.1.32252 WP_001670675.1.32255 WP_001670675.1.32260 WP_001670675.1.32263 WP_001670675.1.32274 WP_001670675.1.32277 WP_001670675.1.32293 WP_001670675.1.32299 WP_001670675.1.32309 WP_001670675.1.32368 WP_001670675.1.32408 WP_001670675.1.32422 WP_001670675.1.32423 WP_001670675.1.32425 WP_001670675.1.32434 WP_001670675.1.32438 WP_001670675.1.32458 WP_001670675.1.32460 WP_001670675.1.32491 WP_001670675.1.32515 WP_001670675.1.32519 WP_001670675.1.32527 WP_001670675.1.32529 WP_001670675.1.32545 WP_001670675.1.32563 WP_001670675.1.32578 WP_001670675.1.32617 WP_001670675.1.32624 WP_001670675.1.32629 WP_001670675.1.32660 WP_001670675.1.32668 WP_001670675.1.3270 WP_001670675.1.32702 WP_001670675.1.32714 WP_001670675.1.32725 WP_001670675.1.32740 WP_001670675.1.32750 WP_001670675.1.3278 WP_001670675.1.32786 WP_001670675.1.32804 WP_001670675.1.32832 WP_001670675.1.32838 WP_001670675.1.32848 WP_001670675.1.32860 WP_001670675.1.32868 WP_001670675.1.32881 WP_001670675.1.32899 WP_001670675.1.329 WP_001670675.1.3290 WP_001670675.1.32900 WP_001670675.1.32902 WP_001670675.1.32907 WP_001670675.1.32930 WP_001670675.1.32940 WP_001670675.1.32941 WP_001670675.1.3296 WP_001670675.1.32961 WP_001670675.1.32966 WP_001670675.1.32977 WP_001670675.1.32985 WP_001670675.1.33010 WP_001670675.1.33030 WP_001670675.1.33037 WP_001670675.1.3305 WP_001670675.1.33051 WP_001670675.1.33065 WP_001670675.1.33078 WP_001670675.1.33106 WP_001670675.1.33114 WP_001670675.1.33122 WP_001670675.1.33127 WP_001670675.1.33143 WP_001670675.1.3315 WP_001670675.1.33160 WP_001670675.1.33208 WP_001670675.1.33214 WP_001670675.1.33247 WP_001670675.1.33248 WP_001670675.1.33253 WP_001670675.1.33261 WP_001670675.1.33270 WP_001670675.1.33280 WP_001670675.1.33283 WP_001670675.1.333 WP_001670675.1.33313 WP_001670675.1.33339 WP_001670675.1.33382 WP_001670675.1.33392 WP_001670675.1.33409 WP_001670675.1.33420 WP_001670675.1.33486 WP_001670675.1.33490 WP_001670675.1.33492 WP_001670675.1.33499 WP_001670675.1.335 WP_001670675.1.33501 WP_001670675.1.33504 WP_001670675.1.33529 WP_001670675.1.33553 WP_001670675.1.3356 WP_001670675.1.33580 WP_001670675.1.33586 WP_001670675.1.33592 WP_001670675.1.33629 WP_001670675.1.3364 WP_001670675.1.33659 WP_001670675.1.33689 WP_001670675.1.33693 WP_001670675.1.3370 WP_001670675.1.33730 WP_001670675.1.33741 WP_001670675.1.33817 WP_001670675.1.33840 WP_001670675.1.33865 WP_001670675.1.33894 WP_001670675.1.3392 WP_001670675.1.33926 WP_001670675.1.3394 WP_001670675.1.3395 WP_001670675.1.33957 WP_001670675.1.3396 WP_001670675.1.33969 WP_001670675.1.33986 WP_001670675.1.34 WP_001670675.1.34001 WP_001670675.1.34043 WP_001670675.1.34059 WP_001670675.1.34075 WP_001670675.1.34081 WP_001670675.1.34084 WP_001670675.1.34091 WP_001670675.1.34107 WP_001670675.1.34118 WP_001670675.1.34126 WP_001670675.1.34185 WP_001670675.1.34211 WP_001670675.1.34214 WP_001670675.1.34234 WP_001670675.1.34257 WP_001670675.1.34259 WP_001670675.1.34279 WP_001670675.1.34284 WP_001670675.1.34292 WP_001670675.1.34304 WP_001670675.1.34319 WP_001670675.1.34330 WP_001670675.1.34376 WP_001670675.1.3438 WP_001670675.1.34382 WP_001670675.1.34417 WP_001670675.1.34424 WP_001670675.1.34431 WP_001670675.1.3445 WP_001670675.1.34453 WP_001670675.1.34454 WP_001670675.1.34458 WP_001670675.1.34484 WP_001670675.1.34496 WP_001670675.1.34517 WP_001670675.1.34530 WP_001670675.1.34610 WP_001670675.1.34614 WP_001670675.1.34659 WP_001670675.1.34665 WP_001670675.1.34667 WP_001670675.1.34684 WP_001670675.1.34694 WP_001670675.1.34703 WP_001670675.1.34704 WP_001670675.1.34707 WP_001670675.1.34711 WP_001670675.1.34751 WP_001670675.1.3476 WP_001670675.1.34801 WP_001670675.1.34808 WP_001670675.1.34817 WP_001670675.1.34820 WP_001670675.1.34824 WP_001670675.1.34834 WP_001670675.1.34854 WP_001670675.1.34856 WP_001670675.1.34881 WP_001670675.1.3489 WP_001670675.1.34932 WP_001670675.1.34962 WP_001670675.1.34972 WP_001670675.1.34975 WP_001670675.1.34977 WP_001670675.1.35001 WP_001670675.1.35040 WP_001670675.1.35045 WP_001670675.1.35074 WP_001670675.1.35129 WP_001670675.1.35175 WP_001670675.1.35184 WP_001670675.1.35193 WP_001670675.1.35219 WP_001670675.1.35240 WP_001670675.1.35274 WP_001670675.1.35298 WP_001670675.1.35321 WP_001670675.1.35331 WP_001670675.1.35332 WP_001670675.1.35404 WP_001670675.1.35408 WP_001670675.1.3541 WP_001670675.1.35425 WP_001670675.1.35429 WP_001670675.1.35446 WP_001670675.1.35460 WP_001670675.1.35463 WP_001670675.1.35494 WP_001670675.1.35503 WP_001670675.1.35507 WP_001670675.1.35509 WP_001670675.1.35532 WP_001670675.1.3556 WP_001670675.1.35560 WP_001670675.1.35563 WP_001670675.1.3557 WP_001670675.1.35570 WP_001670675.1.35590 WP_001670675.1.35594 WP_001670675.1.35619 WP_001670675.1.35624 WP_001670675.1.35628 WP_001670675.1.35648 WP_001670675.1.3566 WP_001670675.1.3570 WP_001670675.1.35712 WP_001670675.1.35713 WP_001670675.1.3572 WP_001670675.1.35736 WP_001670675.1.35777 WP_001670675.1.35791 WP_001670675.1.35795 WP_001670675.1.35809 WP_001670675.1.35835 WP_001670675.1.35868 WP_001670675.1.35870 WP_001670675.1.35887 WP_001670675.1.35892 WP_001670675.1.35916 WP_001670675.1.35936 WP_001670675.1.35938 WP_001670675.1.35940 WP_001670675.1.35961 WP_001670675.1.35966 WP_001670675.1.36000 WP_001670675.1.36003 WP_001670675.1.3601 WP_001670675.1.36011 WP_001670675.1.36017 WP_001670675.1.36034 WP_001670675.1.36036 WP_001670675.1.36037 WP_001670675.1.36057 WP_001670675.1.36063 WP_001670675.1.36069 WP_001670675.1.36157 WP_001670675.1.36172 WP_001670675.1.36229 WP_001670675.1.36232 WP_001670675.1.36286 WP_001670675.1.36291 WP_001670675.1.36298 WP_001670675.1.36308 WP_001670675.1.36323 WP_001670675.1.36343 WP_001670675.1.36409 WP_001670675.1.36445 WP_001670675.1.36460 WP_001670675.1.3649 WP_001670675.1.36495 WP_001670675.1.36512 WP_001670675.1.36526 WP_001670675.1.36542 WP_001670675.1.36547 WP_001670675.1.36567 WP_001670675.1.36579 WP_001670675.1.36584 WP_001670675.1.36586 WP_001670675.1.36609 WP_001670675.1.36617 WP_001670675.1.36618 WP_001670675.1.36643 WP_001670675.1.36663 WP_001670675.1.36685 WP_001670675.1.36690 WP_001670675.1.3670 WP_001670675.1.36701 WP_001670675.1.36705 WP_001670675.1.36721 WP_001670675.1.36725 WP_001670675.1.36751 WP_001670675.1.36764 WP_001670675.1.36779 WP_001670675.1.36798 WP_001670675.1.36802 WP_001670675.1.36821 WP_001670675.1.36839 WP_001670675.1.36853 WP_001670675.1.36875 WP_001670675.1.36885 WP_001670675.1.36889 WP_001670675.1.36899 WP_001670675.1.36918 WP_001670675.1.36931 WP_001670675.1.36949 WP_001670675.1.36950 WP_001670675.1.36978 WP_001670675.1.37013 WP_001670675.1.37014 WP_001670675.1.37021 WP_001670675.1.37029 WP_001670675.1.37063 WP_001670675.1.37073 WP_001670675.1.37111 WP_001670675.1.37112 WP_001670675.1.37114 WP_001670675.1.37133 WP_001670675.1.37147 WP_001670675.1.37158 WP_001670675.1.37176 WP_001670675.1.37190 WP_001670675.1.37191 WP_001670675.1.37199 WP_001670675.1.37200 WP_001670675.1.37256 WP_001670675.1.37258 WP_001670675.1.3726 WP_001670675.1.37267 WP_001670675.1.3728 WP_001670675.1.37293 WP_001670675.1.37297 WP_001670675.1.37303 WP_001670675.1.37320 WP_001670675.1.3734 WP_001670675.1.37351 WP_001670675.1.37370 WP_001670675.1.37376 WP_001670675.1.37405 WP_001670675.1.3744 WP_001670675.1.37478 WP_001670675.1.3748 WP_001670675.1.37498 WP_001670675.1.37504 WP_001670675.1.3751 WP_001670675.1.37513 WP_001670675.1.37521 WP_001670675.1.37558 WP_001670675.1.3756 WP_001670675.1.37584 WP_001670675.1.37590 WP_001670675.1.37593 WP_001670675.1.37600 WP_001670675.1.37610 WP_001670675.1.37613 WP_001670675.1.37618 WP_001670675.1.37659 WP_001670675.1.37662 WP_001670675.1.37666 WP_001670675.1.37675 WP_001670675.1.37687 WP_001670675.1.37691 WP_001670675.1.3771 WP_001670675.1.37761 WP_001670675.1.37775 WP_001670675.1.37777 WP_001670675.1.3778 WP_001670675.1.378 WP_001670675.1.37848 WP_001670675.1.37864 WP_001670675.1.379 WP_001670675.1.3790 WP_001670675.1.37911 WP_001670675.1.37941 WP_001670675.1.37965 WP_001670675.1.37968 WP_001670675.1.37978 WP_001670675.1.37985 WP_001670675.1.38001 WP_001670675.1.38026 WP_001670675.1.38037 WP_001670675.1.38047 WP_001670675.1.38055 WP_001670675.1.38061 WP_001670675.1.38064 WP_001670675.1.38108 WP_001670675.1.38113 WP_001670675.1.38125 WP_001670675.1.38145 WP_001670675.1.3816 WP_001670675.1.38199 WP_001670675.1.38207 WP_001670675.1.38261 WP_001670675.1.38266 WP_001670675.1.38273 WP_001670675.1.3828 WP_001670675.1.383 WP_001670675.1.38310 WP_001670675.1.38322 WP_001670675.1.3834 WP_001670675.1.38341 WP_001670675.1.38344 WP_001670675.1.38349 WP_001670675.1.38351 WP_001670675.1.3838 WP_001670675.1.38381 WP_001670675.1.38393 WP_001670675.1.38408 WP_001670675.1.38440 WP_001670675.1.38452 WP_001670675.1.3848 WP_001670675.1.38486 WP_001670675.1.38512 WP_001670675.1.38515 WP_001670675.1.38569 WP_001670675.1.38595 WP_001670675.1.3860 WP_001670675.1.38609 WP_001670675.1.38613 WP_001670675.1.38620 WP_001670675.1.38622 WP_001670675.1.38642 WP_001670675.1.38673 WP_001670675.1.3869 WP_001670675.1.38693 WP_001670675.1.38734 WP_001670675.1.38740 WP_001670675.1.38773 WP_001670675.1.38781 WP_001670675.1.38830 WP_001670675.1.38877 WP_001670675.1.38881 WP_001670675.1.38882 WP_001670675.1.38895 WP_001670675.1.3891 WP_001670675.1.38913 WP_001670675.1.38942 WP_001670675.1.38983 WP_001670675.1.38995 WP_001670675.1.38996 WP_001670675.1.39003 WP_001670675.1.39038 WP_001670675.1.39048 WP_001670675.1.39055 WP_001670675.1.39056 WP_001670675.1.39065 WP_001670675.1.3907 WP_001670675.1.39105 WP_001670675.1.39112 WP_001670675.1.39113 WP_001670675.1.39128 WP_001670675.1.39136 WP_001670675.1.3914 WP_001670675.1.39140 WP_001670675.1.39147 WP_001670675.1.39161 WP_001670675.1.39197 WP_001670675.1.39210 WP_001670675.1.39229 WP_001670675.1.39235 WP_001670675.1.39265 WP_001670675.1.39275 WP_001670675.1.3931 WP_001670675.1.39312 WP_001670675.1.39385 WP_001670675.1.39395 WP_001670675.1.39405 WP_001670675.1.39414 WP_001670675.1.39420 WP_001670675.1.39435 WP_001670675.1.39449 WP_001670675.1.39466 WP_001670675.1.39471 WP_001670675.1.39497 WP_001670675.1.39502 WP_001670675.1.39503 WP_001670675.1.39512 WP_001670675.1.39530 WP_001670675.1.39553 WP_001670675.1.39556 WP_001670675.1.39576 WP_001670675.1.39584 WP_001670675.1.39609 WP_001670675.1.39614 WP_001670675.1.39619 WP_001670675.1.39620 WP_001670675.1.39624 WP_001670675.1.39629 WP_001670675.1.39632 WP_001670675.1.39659 WP_001670675.1.39667 WP_001670675.1.39722 WP_001670675.1.39723 WP_001670675.1.39724 WP_001670675.1.39763 WP_001670675.1.39775 WP_001670675.1.39808 WP_001670675.1.39862 WP_001670675.1.39879 WP_001670675.1.39890 WP_001670675.1.39921 WP_001670675.1.39923 WP_001670675.1.39941 WP_001670675.1.39945 WP_001670675.1.39947 WP_001670675.1.39953 WP_001670675.1.40017 WP_001670675.1.40025 WP_001670675.1.40031 WP_001670675.1.40072 WP_001670675.1.40073 WP_001670675.1.40081 WP_001670675.1.40095 WP_001670675.1.40097 WP_001670675.1.401 WP_001670675.1.4011 WP_001670675.1.40111 WP_001670675.1.40155 WP_001670675.1.40158 WP_001670675.1.40160 WP_001670675.1.40167 WP_001670675.1.40170 WP_001670675.1.40171 WP_001670675.1.40208 WP_001670675.1.40224 WP_001670675.1.40229 WP_001670675.1.40240 WP_001670675.1.40254 WP_001670675.1.40257 WP_001670675.1.40258 WP_001670675.1.40279 WP_001670675.1.40284 WP_001670675.1.40292 WP_001670675.1.40305 WP_001670675.1.40307 WP_001670675.1.40311 WP_001670675.1.40341 WP_001670675.1.40361 WP_001670675.1.40374 WP_001670675.1.40380 WP_001670675.1.40395 WP_001670675.1.4042 WP_001670675.1.40465 WP_001670675.1.40467 WP_001670675.1.40493 WP_001670675.1.40496 WP_001670675.1.40508 WP_001670675.1.40517 WP_001670675.1.40528 WP_001670675.1.40533 WP_001670675.1.40577 WP_001670675.1.40622 WP_001670675.1.40648 WP_001670675.1.40688 WP_001670675.1.40695 WP_001670675.1.40698 WP_001670675.1.40710 WP_001670675.1.40722 WP_001670675.1.40745 WP_001670675.1.4075 WP_001670675.1.40750 WP_001670675.1.40763 WP_001670675.1.40771 WP_001670675.1.40788 WP_001670675.1.40849 WP_001670675.1.40854 WP_001670675.1.4087 WP_001670675.1.40877 WP_001670675.1.4089 WP_001670675.1.40910 WP_001670675.1.40924 WP_001670675.1.40930 WP_001670675.1.40932 WP_001670675.1.40935 WP_001670675.1.40946 WP_001670675.1.40973 WP_001670675.1.40979 WP_001670675.1.40996 WP_001670675.1.41004 WP_001670675.1.41017 WP_001670675.1.41018 WP_001670675.1.4106 WP_001670675.1.41070 WP_001670675.1.41074 WP_001670675.1.41075 WP_001670675.1.41086 WP_001670675.1.4109 WP_001670675.1.41091 WP_001670675.1.41097 WP_001670675.1.41116 WP_001670675.1.41128 WP_001670675.1.41132 WP_001670675.1.41176 WP_001670675.1.41192 WP_001670675.1.41225 WP_001670675.1.41226 WP_001670675.1.41251 WP_001670675.1.41258 WP_001670675.1.41265 WP_001670675.1.41277 WP_001670675.1.41279 WP_001670675.1.41299 WP_001670675.1.41305 WP_001670675.1.41308 WP_001670675.1.41310 WP_001670675.1.41321 WP_001670675.1.41333 WP_001670675.1.41335 WP_001670675.1.41345 WP_001670675.1.4136 WP_001670675.1.41375 WP_001670675.1.4141 WP_001670675.1.41415 WP_001670675.1.41427 WP_001670675.1.41434 WP_001670675.1.41438 WP_001670675.1.41440 WP_001670675.1.41459 WP_001670675.1.41498 WP_001670675.1.41516 WP_001670675.1.41519 WP_001670675.1.41524 WP_001670675.1.41528 WP_001670675.1.41554 WP_001670675.1.41572 WP_001670675.1.41591 WP_001670675.1.41593 WP_001670675.1.41610 WP_001670675.1.41628 WP_001670675.1.41631 WP_001670675.1.41658 WP_001670675.1.41659 WP_001670675.1.41662 WP_001670675.1.41688 WP_001670675.1.41690 WP_001670675.1.41708 WP_001670675.1.41716 WP_001670675.1.41746 WP_001670675.1.41761 WP_001670675.1.4178 WP_001670675.1.41789 WP_001670675.1.41799 WP_001670675.1.41802 WP_001670675.1.41824 WP_001670675.1.41825 WP_001670675.1.41836 WP_001670675.1.4184 WP_001670675.1.41859 WP_001670675.1.41862 WP_001670675.1.41877 WP_001670675.1.41882 WP_001670675.1.41894 WP_001670675.1.41904 WP_001670675.1.41911 WP_001670675.1.41919 WP_001670675.1.41929 WP_001670675.1.41931 WP_001670675.1.41938 WP_001670675.1.4194 WP_001670675.1.41949 WP_001670675.1.41978 WP_001670675.1.41979 WP_001670675.1.41985 WP_001670675.1.41998 WP_001670675.1.42009 WP_001670675.1.42069 WP_001670675.1.42081 WP_001670675.1.42090 WP_001670675.1.42098 WP_001670675.1.42104 WP_001670675.1.42109 WP_001670675.1.42111 WP_001670675.1.42136 WP_001670675.1.42156 WP_001670675.1.42187 WP_001670675.1.422 WP_001670675.1.42200 WP_001670675.1.42219 WP_001670675.1.4222 WP_001670675.1.42238 WP_001670675.1.42243 WP_001670675.1.42244 WP_001670675.1.42248 WP_001670675.1.42257 WP_001670675.1.42261 WP_001670675.1.42262 WP_001670675.1.42263 WP_001670675.1.4229 WP_001670675.1.42320 WP_001670675.1.42322 WP_001670675.1.42342 WP_001670675.1.42349 WP_001670675.1.42364 WP_001670675.1.42371 WP_001670675.1.42372 WP_001670675.1.42379 WP_001670675.1.42391 WP_001670675.1.42392 WP_001670675.1.42399 WP_001670675.1.42404 WP_001670675.1.42422 WP_001670675.1.42433 WP_001670675.1.42444 WP_001670675.1.42453 WP_001670675.1.42489 WP_001670675.1.42539 WP_001670675.1.4257 WP_001670675.1.42595 WP_001670675.1.42603 WP_001670675.1.42605 WP_001670675.1.42650 WP_001670675.1.42655 WP_001670675.1.42666 WP_001670675.1.4267 WP_001670675.1.42675 WP_001670675.1.42676 WP_001670675.1.42683 WP_001670675.1.42685 WP_001670675.1.42701 WP_001670675.1.42707 WP_001670675.1.42734 WP_001670675.1.4276 WP_001670675.1.42767 WP_001670675.1.42794 WP_001670675.1.42797 WP_001670675.1.42805 WP_001670675.1.42815 WP_001670675.1.42829 WP_001670675.1.42859 WP_001670675.1.42861 WP_001670675.1.42864 WP_001670675.1.4288 WP_001670675.1.42887 WP_001670675.1.4289 WP_001670675.1.42892 WP_001670675.1.42923 WP_001670675.1.42932 WP_001670675.1.42957 WP_001670675.1.4298 WP_001670675.1.42981 WP_001670675.1.43008 WP_001670675.1.43016 WP_001670675.1.43018 WP_001670675.1.43019 WP_001670675.1.43041 WP_001670675.1.43065 WP_001670675.1.43068 WP_001670675.1.43069 WP_001670675.1.43070 WP_001670675.1.43077 WP_001670675.1.43086 WP_001670675.1.43126 WP_001670675.1.43128 WP_001670675.1.43141 WP_001670675.1.43157 WP_001670675.1.43160 WP_001670675.1.43161 WP_001670675.1.43190 WP_001670675.1.43198 WP_001670675.1.43201 WP_001670675.1.43244 WP_001670675.1.4326 WP_001670675.1.43272 WP_001670675.1.43276 WP_001670675.1.43290 WP_001670675.1.43292 WP_001670675.1.43307 WP_001670675.1.43312 WP_001670675.1.43334 WP_001670675.1.43339 WP_001670675.1.43351 WP_001670675.1.43371 WP_001670675.1.43437 WP_001670675.1.43438 WP_001670675.1.4344 WP_001670675.1.43441 WP_001670675.1.43476 WP_001670675.1.43508 WP_001670675.1.43513 WP_001670675.1.43520 WP_001670675.1.43522 WP_001670675.1.43528 WP_001670675.1.43535 WP_001670675.1.43606 WP_001670675.1.43613 WP_001670675.1.43633 WP_001670675.1.43637 WP_001670675.1.43651 WP_001670675.1.43668 WP_001670675.1.43676 WP_001670675.1.43685 WP_001670675.1.43710 WP_001670675.1.43711 WP_001670675.1.43722 WP_001670675.1.4373 WP_001670675.1.43778 WP_001670675.1.43782 WP_001670675.1.43785 WP_001670675.1.43801 WP_001670675.1.43812 WP_001670675.1.43828 WP_001670675.1.43839 WP_001670675.1.43864 WP_001670675.1.43875 WP_001670675.1.43878 WP_001670675.1.43886 WP_001670675.1.43888 WP_001670675.1.43919 WP_001670675.1.43951 WP_001670675.1.43974 WP_001670675.1.44005 WP_001670675.1.44010 WP_001670675.1.4404 WP_001670675.1.44043 WP_001670675.1.44049 WP_001670675.1.4405 WP_001670675.1.44099 WP_001670675.1.44101 WP_001670675.1.44113 WP_001670675.1.44121 WP_001670675.1.44132 WP_001670675.1.44144 WP_001670675.1.44160 WP_001670675.1.44180 WP_001670675.1.44187 WP_001670675.1.44191 WP_001670675.1.44196 WP_001670675.1.44248 WP_001670675.1.44250 WP_001670675.1.44262 WP_001670675.1.44268 WP_001670675.1.4427 WP_001670675.1.44291 WP_001670675.1.44296 WP_001670675.1.44300 WP_001670675.1.44310 WP_001670675.1.44337 WP_001670675.1.44343 WP_001670675.1.44351 WP_001670675.1.44359 WP_001670675.1.44360 WP_001670675.1.44397 WP_001670675.1.4440 WP_001670675.1.44416 WP_001670675.1.44431 WP_001670675.1.44433 WP_001670675.1.44437 WP_001670675.1.44438 WP_001670675.1.44440 WP_001670675.1.44443 WP_001670675.1.44453 WP_001670675.1.44474 WP_001670675.1.44479 WP_001670675.1.44546 WP_001670675.1.44578 WP_001670675.1.44593 WP_001670675.1.44606 WP_001670675.1.44607 WP_001670675.1.44633 WP_001670675.1.44636 WP_001670675.1.44640 WP_001670675.1.4467 WP_001670675.1.44678 WP_001670675.1.4468 WP_001670675.1.44702 WP_001670675.1.44705 WP_001670675.1.44747 WP_001670675.1.44762 WP_001670675.1.44781 WP_001670675.1.44791 WP_001670675.1.44815 WP_001670675.1.44828 WP_001670675.1.44831 WP_001670675.1.44833 WP_001670675.1.4485 WP_001670675.1.44877 WP_001670675.1.44879 WP_001670675.1.44887 WP_001670675.1.449 WP_001670675.1.44917 WP_001670675.1.44927 WP_001670675.1.44933 WP_001670675.1.44950 WP_001670675.1.44966 WP_001670675.1.44971 WP_001670675.1.44978 WP_001670675.1.44997 WP_001670675.1.44998 WP_001670675.1.4500 WP_001670675.1.4501 WP_001670675.1.45027 WP_001670675.1.45038 WP_001670675.1.45045 WP_001670675.1.4505 WP_001670675.1.45067 WP_001670675.1.45072 WP_001670675.1.45074 WP_001670675.1.45079 WP_001670675.1.45093 WP_001670675.1.45098 WP_001670675.1.45123 WP_001670675.1.45134 WP_001670675.1.45136 WP_001670675.1.45138 WP_001670675.1.45145 WP_001670675.1.45173 WP_001670675.1.45177 WP_001670675.1.45184 WP_001670675.1.45229 WP_001670675.1.45241 WP_001670675.1.45259 WP_001670675.1.45302 WP_001670675.1.4531 WP_001670675.1.45322 WP_001670675.1.45344 WP_001670675.1.45349 WP_001670675.1.45351 WP_001670675.1.45365 WP_001670675.1.4540 WP_001670675.1.45432 WP_001670675.1.45434 WP_001670675.1.45435 WP_001670675.1.45462 WP_001670675.1.45468 WP_001670675.1.45522 WP_001670675.1.45523 WP_001670675.1.45544 WP_001670675.1.45549 WP_001670675.1.45550 WP_001670675.1.45569 WP_001670675.1.45571 WP_001670675.1.45582 WP_001670675.1.45583 WP_001670675.1.45585 WP_001670675.1.45596 WP_001670675.1.45622 WP_001670675.1.45648 WP_001670675.1.45660 WP_001670675.1.45690 WP_001670675.1.45706 WP_001670675.1.45781 WP_001670675.1.45797 WP_001670675.1.458 WP_001670675.1.45829 WP_001670675.1.45844 WP_001670675.1.45848 WP_001670675.1.45871 WP_001670675.1.45906 WP_001670675.1.45918 WP_001670675.1.4592 WP_001670675.1.46011 WP_001670675.1.46030 WP_001670675.1.46069 WP_001670675.1.46077 WP_001670675.1.46091 WP_001670675.1.46112 WP_001670675.1.46124 WP_001670675.1.46169 WP_001670675.1.46173 WP_001670675.1.46174 WP_001670675.1.46187 WP_001670675.1.46203 WP_001670675.1.46205 WP_001670675.1.46215 WP_001670675.1.46225 WP_001670675.1.46232 WP_001670675.1.46241 WP_001670675.1.46250 WP_001670675.1.46278 WP_001670675.1.46286 WP_001670675.1.46299 WP_001670675.1.46303 WP_001670675.1.46307 WP_001670675.1.46322 WP_001670675.1.46323 WP_001670675.1.46345 WP_001670675.1.46355 WP_001670675.1.46358 WP_001670675.1.464 WP_001670675.1.46406 WP_001670675.1.46434 WP_001670675.1.46444 WP_001670675.1.46454 WP_001670675.1.46461 WP_001670675.1.46504 WP_001670675.1.46505 WP_001670675.1.46551 WP_001670675.1.46559 WP_001670675.1.46572 WP_001670675.1.46574 WP_001670675.1.46578 WP_001670675.1.46595 WP_001670675.1.46620 WP_001670675.1.46637 WP_001670675.1.46666 WP_001670675.1.46675 WP_001670675.1.46689 WP_001670675.1.46693 WP_001670675.1.46701 WP_001670675.1.4671 WP_001670675.1.46726 WP_001670675.1.46730 WP_001670675.1.46732 WP_001670675.1.4674 WP_001670675.1.46749 WP_001670675.1.46781 WP_001670675.1.46803 WP_001670675.1.46804 WP_001670675.1.46816 WP_001670675.1.46842 WP_001670675.1.4686 WP_001670675.1.4690 WP_001670675.1.46920 WP_001670675.1.46930 WP_001670675.1.46945 WP_001670675.1.46961 WP_001670675.1.46967 WP_001670675.1.46976 WP_001670675.1.47008 WP_001670675.1.47023 WP_001670675.1.47036 WP_001670675.1.47037 WP_001670675.1.47042 WP_001670675.1.47057 WP_001670675.1.47059 WP_001670675.1.47061 WP_001670675.1.47067 WP_001670675.1.47085 WP_001670675.1.47110 WP_001670675.1.47123 WP_001670675.1.47214 WP_001670675.1.47215 WP_001670675.1.47243 WP_001670675.1.47245 WP_001670675.1.47257 WP_001670675.1.47389 WP_001670675.1.47429 WP_001670675.1.47448 WP_001670675.1.47460 WP_001670675.1.4747 WP_001670675.1.47472 WP_001670675.1.47478 WP_001670675.1.47492 WP_001670675.1.47506 WP_001670675.1.47507 WP_001670675.1.47523 WP_001670675.1.47531 WP_001670675.1.47532 WP_001670675.1.47542 WP_001670675.1.47567 WP_001670675.1.47576 WP_001670675.1.47579 WP_001670675.1.4758 WP_001670675.1.47587 WP_001670675.1.47605 WP_001670675.1.47614 WP_001670675.1.47621 WP_001670675.1.47630 WP_001670675.1.47649 WP_001670675.1.47660 WP_001670675.1.4769 WP_001670675.1.4770 WP_001670675.1.47714 WP_001670675.1.4774 WP_001670675.1.4775 WP_001670675.1.47756 WP_001670675.1.47767 WP_001670675.1.47799 WP_001670675.1.4781 WP_001670675.1.47814 WP_001670675.1.47817 WP_001670675.1.47829 WP_001670675.1.47849 WP_001670675.1.47850 WP_001670675.1.47875 WP_001670675.1.47886 WP_001670675.1.47898 WP_001670675.1.47902 WP_001670675.1.47911 WP_001670675.1.47928 WP_001670675.1.4795 WP_001670675.1.47988 WP_001670675.1.47992 WP_001670675.1.48019 WP_001670675.1.48100 WP_001670675.1.48114 WP_001670675.1.48124 WP_001670675.1.48132 WP_001670675.1.48134 WP_001670675.1.48139 WP_001670675.1.48190 WP_001670675.1.48209 WP_001670675.1.48215 WP_001670675.1.48218 WP_001670675.1.48242 WP_001670675.1.48244 WP_001670675.1.48247 WP_001670675.1.48253 WP_001670675.1.48268 WP_001670675.1.48292 WP_001670675.1.483 WP_001670675.1.48324 WP_001670675.1.48367 WP_001670675.1.48377 WP_001670675.1.4839 WP_001670675.1.48399 WP_001670675.1.48426 WP_001670675.1.48430 WP_001670675.1.48436 WP_001670675.1.48455 WP_001670675.1.48493 WP_001670675.1.48510 WP_001670675.1.48524 WP_001670675.1.4853 WP_001670675.1.48570 WP_001670675.1.48586 WP_001670675.1.4859 WP_001670675.1.48591 WP_001670675.1.48610 WP_001670675.1.48631 WP_001670675.1.48651 WP_001670675.1.48663 WP_001670675.1.48690 WP_001670675.1.48734 WP_001670675.1.48751 WP_001670675.1.48755 WP_001670675.1.48756 WP_001670675.1.48768 WP_001670675.1.48778 WP_001670675.1.48788 WP_001670675.1.48797 WP_001670675.1.48841 WP_001670675.1.48849 WP_001670675.1.4885 WP_001670675.1.48855 WP_001670675.1.48876 WP_001670675.1.48894 WP_001670675.1.48896 WP_001670675.1.48918 WP_001670675.1.48919 WP_001670675.1.48931 WP_001670675.1.48955 WP_001670675.1.48963 WP_001670675.1.48973 WP_001670675.1.48985 WP_001670675.1.49004 WP_001670675.1.49005 WP_001670675.1.49012 WP_001670675.1.49084 WP_001670675.1.49102 WP_001670675.1.49106 WP_001670675.1.49113 WP_001670675.1.49117 WP_001670675.1.49121 WP_001670675.1.4914 WP_001670675.1.49140 WP_001670675.1.49153 WP_001670675.1.49155 WP_001670675.1.49166 WP_001670675.1.49175 WP_001670675.1.49204 WP_001670675.1.49214 WP_001670675.1.49226 WP_001670675.1.49233 WP_001670675.1.49239 WP_001670675.1.49256 WP_001670675.1.49262 WP_001670675.1.49276 WP_001670675.1.49290 WP_001670675.1.49309 WP_001670675.1.49311 WP_001670675.1.49334 WP_001670675.1.49340 WP_001670675.1.49355 WP_001670675.1.49366 WP_001670675.1.49375 WP_001670675.1.49429 WP_001670675.1.49430 WP_001670675.1.49434 WP_001670675.1.49450 WP_001670675.1.49472 WP_001670675.1.49490 WP_001670675.1.49494 WP_001670675.1.495 WP_001670675.1.49515 WP_001670675.1.49545 WP_001670675.1.49550 WP_001670675.1.49572 WP_001670675.1.49590 WP_001670675.1.49595 WP_001670675.1.49602 WP_001670675.1.49626 WP_001670675.1.49630 WP_001670675.1.49647 WP_001670675.1.49686 WP_001670675.1.49703 WP_001670675.1.49769 WP_001670675.1.49770 WP_001670675.1.49780 WP_001670675.1.4979 WP_001670675.1.49790 WP_001670675.1.49803 WP_001670675.1.49805 WP_001670675.1.49827 WP_001670675.1.49846 WP_001670675.1.49848 WP_001670675.1.4991 WP_001670675.1.49929 WP_001670675.1.49931 WP_001670675.1.49947 WP_001670675.1.49959 WP_001670675.1.49997 WP_001670675.1.50 WP_001670675.1.50003 WP_001670675.1.50007 WP_001670675.1.50014 WP_001670675.1.50030 WP_001670675.1.50043 WP_001670675.1.50080 WP_001670675.1.5009 WP_001670675.1.50103 WP_001670675.1.50128 WP_001670675.1.50153 WP_001670675.1.50158 WP_001670675.1.50161 WP_001670675.1.50198 WP_001670675.1.50211 WP_001670675.1.50239 WP_001670675.1.50247 WP_001670675.1.50251 WP_001670675.1.50285 WP_001670675.1.50308 WP_001670675.1.50309 WP_001670675.1.50332 WP_001670675.1.50374 WP_001670675.1.50376 WP_001670675.1.50386 WP_001670675.1.50387 WP_001670675.1.50389 WP_001670675.1.50404 WP_001670675.1.50406 WP_001670675.1.50413 WP_001670675.1.50449 WP_001670675.1.50468 WP_001670675.1.50478 WP_001670675.1.5051 WP_001670675.1.50517 WP_001670675.1.50529 WP_001670675.1.50565 WP_001670675.1.50566 WP_001670675.1.50570 WP_001670675.1.50576 WP_001670675.1.5058 WP_001670675.1.50626 WP_001670675.1.50652 WP_001670675.1.50676 WP_001670675.1.50684 WP_001670675.1.50726 WP_001670675.1.50750 WP_001670675.1.50769 WP_001670675.1.50771 WP_001670675.1.50774 WP_001670675.1.50782 WP_001670675.1.50800 WP_001670675.1.50804 WP_001670675.1.50808 WP_001670675.1.50875 WP_001670675.1.5088 WP_001670675.1.50882 WP_001670675.1.50885 WP_001670675.1.509 WP_001670675.1.50905 WP_001670675.1.50908 WP_001670675.1.50918 WP_001670675.1.50929 WP_001670675.1.50941 WP_001670675.1.50954 WP_001670675.1.50960 WP_001670675.1.50970 WP_001670675.1.50999 WP_001670675.1.51014 WP_001670675.1.51022 WP_001670675.1.51025 WP_001670675.1.51036 WP_001670675.1.51040 WP_001670675.1.51048 WP_001670675.1.51066 WP_001670675.1.51100 WP_001670675.1.51117 WP_001670675.1.51131 WP_001670675.1.51134 WP_001670675.1.51139 WP_001670675.1.5114 WP_001670675.1.51162 WP_001670675.1.51179 WP_001670675.1.51182 WP_001670675.1.51186 WP_001670675.1.51224 WP_001670675.1.51227 WP_001670675.1.5125 WP_001670675.1.5127 WP_001670675.1.51285 WP_001670675.1.51305 WP_001670675.1.51308 WP_001670675.1.51315 WP_001670675.1.51338 WP_001670675.1.51356 WP_001670675.1.5136 WP_001670675.1.5138 WP_001670675.1.51394 WP_001670675.1.51412 WP_001670675.1.51414 WP_001670675.1.51419 WP_001670675.1.51451 WP_001670675.1.51464 WP_001670675.1.51474 WP_001670675.1.51487 WP_001670675.1.51488 WP_001670675.1.51502 WP_001670675.1.51506 WP_001670675.1.51514 WP_001670675.1.51518 WP_001670675.1.51519 WP_001670675.1.51555 WP_001670675.1.51594 WP_001670675.1.51598 WP_001670675.1.51611 WP_001670675.1.51613 WP_001670675.1.51634 WP_001670675.1.51642 WP_001670675.1.51644 WP_001670675.1.51649 WP_001670675.1.51686 WP_001670675.1.51700 WP_001670675.1.51704 WP_001670675.1.51724 WP_001670675.1.51734 WP_001670675.1.51756 WP_001670675.1.51764 WP_001670675.1.51810 WP_001670675.1.51831 WP_001670675.1.51838 WP_001670675.1.51841 WP_001670675.1.5185 WP_001670675.1.51863 WP_001670675.1.51868 WP_001670675.1.51888 WP_001670675.1.51910 WP_001670675.1.51911 WP_001670675.1.51914 WP_001670675.1.51930 WP_001670675.1.51932 WP_001670675.1.51935 WP_001670675.1.51989 WP_001670675.1.51994 WP_001670675.1.520 WP_001670675.1.52047 WP_001670675.1.52057 WP_001670675.1.5211 WP_001670675.1.52114 WP_001670675.1.52121 WP_001670675.1.52123 WP_001670675.1.52129 WP_001670675.1.52148 WP_001670675.1.52156 WP_001670675.1.5216 WP_001670675.1.52161 WP_001670675.1.52170 WP_001670675.1.52191 WP_001670675.1.52202 WP_001670675.1.52209 WP_001670675.1.52255 WP_001670675.1.52301 WP_001670675.1.52321 WP_001670675.1.52336 WP_001670675.1.52339 WP_001670675.1.52346 WP_001670675.1.52353 WP_001670675.1.52356 WP_001670675.1.52361 WP_001670675.1.52438 WP_001670675.1.52446 WP_001670675.1.52469 WP_001670675.1.52527 WP_001670675.1.52528 WP_001670675.1.52571 WP_001670675.1.52582 WP_001670675.1.52586 WP_001670675.1.526 WP_001670675.1.52637 WP_001670675.1.52647 WP_001670675.1.52653 WP_001670675.1.52656 WP_001670675.1.52692 WP_001670675.1.52738 WP_001670675.1.52742 WP_001670675.1.52743 WP_001670675.1.52744 WP_001670675.1.52748 WP_001670675.1.52773 WP_001670675.1.52795 WP_001670675.1.52807 WP_001670675.1.52833 WP_001670675.1.52851 WP_001670675.1.52857 WP_001670675.1.52866 WP_001670675.1.52887 WP_001670675.1.52898 WP_001670675.1.52915 WP_001670675.1.52924 WP_001670675.1.52949 WP_001670675.1.52985 WP_001670675.1.53016 WP_001670675.1.53092 WP_001670675.1.53107 WP_001670675.1.53119 WP_001670675.1.5313 WP_001670675.1.53141 WP_001670675.1.53151 WP_001670675.1.53154 WP_001670675.1.53158 WP_001670675.1.53159 WP_001670675.1.5316 WP_001670675.1.53190 WP_001670675.1.53198 WP_001670675.1.53203 WP_001670675.1.53206 WP_001670675.1.53210 WP_001670675.1.53233 WP_001670675.1.53234 WP_001670675.1.53272 WP_001670675.1.53286 WP_001670675.1.53307 WP_001670675.1.53315 WP_001670675.1.53316 WP_001670675.1.53321 WP_001670675.1.5333 WP_001670675.1.53362 WP_001670675.1.53368 WP_001670675.1.53375 WP_001670675.1.53385 WP_001670675.1.53406 WP_001670675.1.53436 WP_001670675.1.53450 WP_001670675.1.53454 WP_001670675.1.53466 WP_001670675.1.5349 WP_001670675.1.53529 WP_001670675.1.53534 WP_001670675.1.53540 WP_001670675.1.53543 WP_001670675.1.53555 WP_001670675.1.53559 WP_001670675.1.5356 WP_001670675.1.53567 WP_001670675.1.53571 WP_001670675.1.5358 WP_001670675.1.53664 WP_001670675.1.53675 WP_001670675.1.53688 WP_001670675.1.53692 WP_001670675.1.53694 WP_001670675.1.53696 WP_001670675.1.53723 WP_001670675.1.5374 WP_001670675.1.53750 WP_001670675.1.53757 WP_001670675.1.53772 WP_001670675.1.53781 WP_001670675.1.53790 WP_001670675.1.53800 WP_001670675.1.53812 WP_001670675.1.53814 WP_001670675.1.53815 WP_001670675.1.53839 WP_001670675.1.53892 WP_001670675.1.53896 WP_001670675.1.53898 WP_001670675.1.53902 WP_001670675.1.53905 WP_001670675.1.5392 WP_001670675.1.53935 WP_001670675.1.53958 WP_001670675.1.53961 WP_001670675.1.53981 WP_001670675.1.53984 WP_001670675.1.54033 WP_001670675.1.54061 WP_001670675.1.54068 WP_001670675.1.54075 WP_001670675.1.54082 WP_001670675.1.54085 WP_001670675.1.54132 WP_001670675.1.54136 WP_001670675.1.5415 WP_001670675.1.54170 WP_001670675.1.54175 WP_001670675.1.54196 WP_001670675.1.542 WP_001670675.1.54203 WP_001670675.1.54209 WP_001670675.1.54259 WP_001670675.1.54271 WP_001670675.1.54273 WP_001670675.1.54274 WP_001670675.1.54283 WP_001670675.1.5430 WP_001670675.1.54319 WP_001670675.1.54324 WP_001670675.1.54333 WP_001670675.1.54364 WP_001670675.1.54366 WP_001670675.1.54371 WP_001670675.1.54400 WP_001670675.1.54431 WP_001670675.1.54442 WP_001670675.1.54469 WP_001670675.1.54482 WP_001670675.1.54522 WP_001670675.1.54526 WP_001670675.1.54558 WP_001670675.1.5456 WP_001670675.1.54569 WP_001670675.1.54589 WP_001670675.1.54615 WP_001670675.1.5462 WP_001670675.1.54644 WP_001670675.1.54662 WP_001670675.1.54667 WP_001670675.1.54678 WP_001670675.1.54681 WP_001670675.1.54694 WP_001670675.1.54722 WP_001670675.1.54748 WP_001670675.1.54749 WP_001670675.1.54764 WP_001670675.1.54774 WP_001670675.1.5481 WP_001670675.1.54814 WP_001670675.1.54822 WP_001670675.1.54827 WP_001670675.1.54833 WP_001670675.1.54845 WP_001670675.1.5485 WP_001670675.1.54865 WP_001670675.1.54877 WP_001670675.1.5493 WP_001670675.1.54935 WP_001670675.1.54936 WP_001670675.1.54979 WP_001670675.1.54984 WP_001670675.1.54992 WP_001670675.1.55008 WP_001670675.1.55010 WP_001670675.1.55034 WP_001670675.1.55073 WP_001670675.1.55152 WP_001670675.1.55156 WP_001670675.1.55163 WP_001670675.1.55165 WP_001670675.1.55166 WP_001670675.1.5517 WP_001670675.1.55178 WP_001670675.1.55200 WP_001670675.1.55215 WP_001670675.1.55223 WP_001670675.1.55224 WP_001670675.1.5523 WP_001670675.1.55285 WP_001670675.1.55290 WP_001670675.1.55294 WP_001670675.1.55310 WP_001670675.1.55317 WP_001670675.1.55325 WP_001670675.1.55379 WP_001670675.1.5539 WP_001670675.1.55418 WP_001670675.1.55430 WP_001670675.1.55461 WP_001670675.1.55468 WP_001670675.1.55475 WP_001670675.1.55477 WP_001670675.1.55496 WP_001670675.1.55506 WP_001670675.1.5552 WP_001670675.1.55528 WP_001670675.1.55545 WP_001670675.1.5555 WP_001670675.1.55557 WP_001670675.1.55559 WP_001670675.1.5560 WP_001670675.1.55604 WP_001670675.1.55623 WP_001670675.1.55639 WP_001670675.1.55640 WP_001670675.1.55647 WP_001670675.1.55672 WP_001670675.1.55699 WP_001670675.1.55706 WP_001670675.1.55718 WP_001670675.1.5572 WP_001670675.1.55725 WP_001670675.1.55743 WP_001670675.1.55768 WP_001670675.1.5577 WP_001670675.1.55780 WP_001670675.1.55782 WP_001670675.1.55796 WP_001670675.1.55803 WP_001670675.1.55853 WP_001670675.1.55923 WP_001670675.1.55948 WP_001670675.1.55967 WP_001670675.1.55973 WP_001670675.1.55993 WP_001670675.1.55995 WP_001670675.1.56002 WP_001670675.1.56004 WP_001670675.1.56012 WP_001670675.1.56026 WP_001670675.1.56059 WP_001670675.1.56070 WP_001670675.1.56082 WP_001670675.1.56097 WP_001670675.1.56100 WP_001670675.1.56105 WP_001670675.1.56144 WP_001670675.1.56172 WP_001670675.1.5621 WP_001670675.1.56222 WP_001670675.1.56226 WP_001670675.1.56235 WP_001670675.1.56238 WP_001670675.1.56244 WP_001670675.1.56247 WP_001670675.1.56261 WP_001670675.1.56263 WP_001670675.1.56286 WP_001670675.1.56303 WP_001670675.1.56304 WP_001670675.1.56305 WP_001670675.1.56311 WP_001670675.1.5633 WP_001670675.1.56354 WP_001670675.1.56368 WP_001670675.1.56370 WP_001670675.1.56385 WP_001670675.1.56389 WP_001670675.1.56393 WP_001670675.1.56396 WP_001670675.1.56414 WP_001670675.1.56419 WP_001670675.1.56423 WP_001670675.1.56438 WP_001670675.1.56468 WP_001670675.1.56512 WP_001670675.1.56514 WP_001670675.1.56535 WP_001670675.1.56559 WP_001670675.1.56560 WP_001670675.1.56585 WP_001670675.1.56597 WP_001670675.1.56601 WP_001670675.1.56614 WP_001670675.1.56615 WP_001670675.1.56640 WP_001670675.1.56647 WP_001670675.1.56651 WP_001670675.1.56660 WP_001670675.1.56671 WP_001670675.1.5668 WP_001670675.1.56682 WP_001670675.1.56724 WP_001670675.1.56791 WP_001670675.1.56824 WP_001670675.1.56825 WP_001670675.1.56851 WP_001670675.1.56853 WP_001670675.1.56861 WP_001670675.1.56875 WP_001670675.1.56877 WP_001670675.1.56887 WP_001670675.1.56889 WP_001670675.1.56893 WP_001670675.1.56898 WP_001670675.1.56905 WP_001670675.1.56942 WP_001670675.1.56950 WP_001670675.1.56981 WP_001670675.1.57000 WP_001670675.1.57026 WP_001670675.1.57039 WP_001670675.1.57056 WP_001670675.1.57076 WP_001670675.1.57084 WP_001670675.1.57101 WP_001670675.1.5711 WP_001670675.1.57125 WP_001670675.1.57137 WP_001670675.1.57143 WP_001670675.1.57147 WP_001670675.1.57149 WP_001670675.1.57168 WP_001670675.1.57179 WP_001670675.1.57186 WP_001670675.1.57187 WP_001670675.1.57232 WP_001670675.1.57233 WP_001670675.1.57244 WP_001670675.1.57246 WP_001670675.1.57296 WP_001670675.1.57307 WP_001670675.1.57342 WP_001670675.1.57344 WP_001670675.1.57356 WP_001670675.1.57357 WP_001670675.1.57362 WP_001670675.1.57377 WP_001670675.1.57399 WP_001670675.1.57418 WP_001670675.1.57433 WP_001670675.1.57494 WP_001670675.1.57510 WP_001670675.1.57515 WP_001670675.1.57521 WP_001670675.1.57529 WP_001670675.1.5753 WP_001670675.1.57534 WP_001670675.1.57555 WP_001670675.1.57559 WP_001670675.1.57576 WP_001670675.1.57601 WP_001670675.1.57607 WP_001670675.1.5761 WP_001670675.1.57631 WP_001670675.1.57641 WP_001670675.1.57684 WP_001670675.1.57699 WP_001670675.1.57709 WP_001670675.1.57735 WP_001670675.1.5774 WP_001670675.1.57763 WP_001670675.1.57781 WP_001670675.1.57785 WP_001670675.1.57797 WP_001670675.1.57800 WP_001670675.1.5781 WP_001670675.1.57835 WP_001670675.1.57862 WP_001670675.1.57873 WP_001670675.1.57890 WP_001670675.1.57891 WP_001670675.1.57893 WP_001670675.1.57965 WP_001670675.1.57972 WP_001670675.1.57978 WP_001670675.1.58008 WP_001670675.1.5801 WP_001670675.1.58040 WP_001670675.1.58041 WP_001670675.1.58044 WP_001670675.1.58081 WP_001670675.1.5809 WP_001670675.1.58090 WP_001670675.1.58131 WP_001670675.1.58132 WP_001670675.1.58144 WP_001670675.1.58153 WP_001670675.1.58157 WP_001670675.1.58173 WP_001670675.1.58191 WP_001670675.1.58194 WP_001670675.1.58239 WP_001670675.1.58249 WP_001670675.1.58252 WP_001670675.1.58261 WP_001670675.1.58274 WP_001670675.1.5828 WP_001670675.1.58282 WP_001670675.1.58290 WP_001670675.1.58301 WP_001670675.1.58324 WP_001670675.1.58326 WP_001670675.1.58357 WP_001670675.1.58358 WP_001670675.1.5836 WP_001670675.1.58407 WP_001670675.1.58416 WP_001670675.1.58418 WP_001670675.1.58442 WP_001670675.1.58443 WP_001670675.1.5846 WP_001670675.1.58485 WP_001670675.1.58486 WP_001670675.1.58489 WP_001670675.1.58537 WP_001670675.1.5854 WP_001670675.1.58548 WP_001670675.1.58564 WP_001670675.1.58568 WP_001670675.1.5858 WP_001670675.1.58583 WP_001670675.1.58604 WP_001670675.1.58652 WP_001670675.1.58662 WP_001670675.1.58663 WP_001670675.1.58669 WP_001670675.1.58675 WP_001670675.1.58698 WP_001670675.1.587 WP_001670675.1.58724 WP_001670675.1.58729 WP_001670675.1.58744 WP_001670675.1.58745 WP_001670675.1.58749 WP_001670675.1.5875 WP_001670675.1.5878 WP_001670675.1.58796 WP_001670675.1.58803 WP_001670675.1.58807 WP_001670675.1.58831 WP_001670675.1.58836 WP_001670675.1.58847 WP_001670675.1.5886 WP_001670675.1.58861 WP_001670675.1.58883 WP_001670675.1.58884 WP_001670675.1.58898 WP_001670675.1.58926 WP_001670675.1.58932 WP_001670675.1.58949 WP_001670675.1.58963 WP_001670675.1.58970 WP_001670675.1.58974 WP_001670675.1.59006 WP_001670675.1.59020 WP_001670675.1.59043 WP_001670675.1.59056 WP_001670675.1.59061 WP_001670675.1.59064 WP_001670675.1.59068 WP_001670675.1.59084 WP_001670675.1.59094 WP_001670675.1.59097 WP_001670675.1.59125 WP_001670675.1.59136 WP_001670675.1.59142 WP_001670675.1.59163 WP_001670675.1.59224 WP_001670675.1.59236 WP_001670675.1.59276 WP_001670675.1.59282 WP_001670675.1.5929 WP_001670675.1.59294 WP_001670675.1.59299 WP_001670675.1.59313 WP_001670675.1.59321 WP_001670675.1.59335 WP_001670675.1.59336 WP_001670675.1.59375 WP_001670675.1.59381 WP_001670675.1.59412 WP_001670675.1.59420 WP_001670675.1.59427 WP_001670675.1.59439 WP_001670675.1.59458 WP_001670675.1.5949 WP_001670675.1.59490 WP_001670675.1.59501 WP_001670675.1.59508 WP_001670675.1.59510 WP_001670675.1.59512 WP_001670675.1.59521 WP_001670675.1.5953 WP_001670675.1.59538 WP_001670675.1.59548 WP_001670675.1.59636 WP_001670675.1.59641 WP_001670675.1.59646 WP_001670675.1.59648 WP_001670675.1.59684 WP_001670675.1.5969 WP_001670675.1.59694 WP_001670675.1.59710 WP_001670675.1.59751 WP_001670675.1.59771 WP_001670675.1.5979 WP_001670675.1.59827 WP_001670675.1.59829 WP_001670675.1.59830 WP_001670675.1.59847 WP_001670675.1.59848 WP_001670675.1.59863 WP_001670675.1.59928 WP_001670675.1.59933 WP_001670675.1.59953 WP_001670675.1.59969 WP_001670675.1.59979 WP_001670675.1.59994 WP_001670675.1.60004 WP_001670675.1.60008 WP_001670675.1.60015 WP_001670675.1.60021 WP_001670675.1.60045 WP_001670675.1.60052 WP_001670675.1.60069 WP_001670675.1.60076 WP_001670675.1.60106 WP_001670675.1.60114 WP_001670675.1.60126 WP_001670675.1.60137 WP_001670675.1.60140 WP_001670675.1.60154 WP_001670675.1.60155 WP_001670675.1.60168 WP_001670675.1.60192 WP_001670675.1.60199 WP_001670675.1.60209 WP_001670675.1.60212 WP_001670675.1.60226 WP_001670675.1.60231 WP_001670675.1.60253 WP_001670675.1.60285 WP_001670675.1.60320 WP_001670675.1.60322 WP_001670675.1.60324 WP_001670675.1.6033 WP_001670675.1.60330 WP_001670675.1.60356 WP_001670675.1.60370 WP_001670675.1.60379 WP_001670675.1.6038 WP_001670675.1.60380 WP_001670675.1.6041 WP_001670675.1.60424 WP_001670675.1.60425 WP_001670675.1.60464 WP_001670675.1.60469 WP_001670675.1.60481 WP_001670675.1.605 WP_001670675.1.60503 WP_001670675.1.6052 WP_001670675.1.60545 WP_001670675.1.60560 WP_001670675.1.60561 WP_001670675.1.6058 WP_001670675.1.60584 WP_001670675.1.60597 WP_001670675.1.6060 WP_001670675.1.60608 WP_001670675.1.60622 WP_001670675.1.60643 WP_001670675.1.60661 WP_001670675.1.60676 WP_001670675.1.60708 WP_001670675.1.60713 WP_001670675.1.60725 WP_001670675.1.60746 WP_001670675.1.60760 WP_001670675.1.60772 WP_001670675.1.60783 WP_001670675.1.60792 WP_001670675.1.60794 WP_001670675.1.608 WP_001670675.1.60807 WP_001670675.1.60809 WP_001670675.1.60838 WP_001670675.1.60855 WP_001670675.1.6086 WP_001670675.1.60863 WP_001670675.1.60866 WP_001670675.1.60874 WP_001670675.1.60882 WP_001670675.1.60889 WP_001670675.1.60897 WP_001670675.1.60919 WP_001670675.1.60926 WP_001670675.1.60941 WP_001670675.1.60950 WP_001670675.1.60976 WP_001670675.1.60990 WP_001670675.1.6104 WP_001670675.1.61044 WP_001670675.1.61045 WP_001670675.1.61076 WP_001670675.1.61078 WP_001670675.1.6108 WP_001670675.1.61114 WP_001670675.1.61123 WP_001670675.1.6114 WP_001670675.1.61146 WP_001670675.1.61147 WP_001670675.1.61168 WP_001670675.1.61184 WP_001670675.1.61201 WP_001670675.1.61210 WP_001670675.1.61218 WP_001670675.1.61232 WP_001670675.1.61233 WP_001670675.1.6129 WP_001670675.1.61296 WP_001670675.1.61309 WP_001670675.1.61345 WP_001670675.1.61356 WP_001670675.1.61357 WP_001670675.1.61381 WP_001670675.1.61417 WP_001670675.1.6143 WP_001670675.1.61497 WP_001670675.1.61501 WP_001670675.1.61509 WP_001670675.1.61511 WP_001670675.1.61519 WP_001670675.1.61539 WP_001670675.1.61542 WP_001670675.1.61553 WP_001670675.1.61574 WP_001670675.1.61582 WP_001670675.1.61594 WP_001670675.1.61595 WP_001670675.1.61609 WP_001670675.1.6164 WP_001670675.1.61649 WP_001670675.1.61652 WP_001670675.1.61662 WP_001670675.1.61667 WP_001670675.1.61671 WP_001670675.1.61694 WP_001670675.1.61697 WP_001670675.1.61712 WP_001670675.1.61714 WP_001670675.1.61730 WP_001670675.1.61732 WP_001670675.1.61743 WP_001670675.1.61783 WP_001670675.1.61809 WP_001670675.1.61857 WP_001670675.1.61877 WP_001670675.1.61908 WP_001670675.1.61918 WP_001670675.1.61920 WP_001670675.1.61922 WP_001670675.1.61924 WP_001670675.1.61952 WP_001670675.1.61968 WP_001670675.1.62007 WP_001670675.1.62020 WP_001670675.1.62025 WP_001670675.1.62076 WP_001670675.1.6209 WP_001670675.1.6210 WP_001670675.1.62120 WP_001670675.1.62122 WP_001670675.1.62124 WP_001670675.1.62144 WP_001670675.1.62158 WP_001670675.1.62195 WP_001670675.1.62199 WP_001670675.1.62201 WP_001670675.1.62204 WP_001670675.1.62210 WP_001670675.1.62222 WP_001670675.1.62223 WP_001670675.1.62241 WP_001670675.1.62245 WP_001670675.1.62257 WP_001670675.1.62271 WP_001670675.1.62302 WP_001670675.1.62304 WP_001670675.1.62314 WP_001670675.1.62323 WP_001670675.1.62333 WP_001670675.1.62338 WP_001670675.1.62339 WP_001670675.1.62344 WP_001670675.1.62364 WP_001670675.1.62374 WP_001670675.1.62380 WP_001670675.1.62403 WP_001670675.1.62404 WP_001670675.1.62411 WP_001670675.1.62412 WP_001670675.1.62436 WP_001670675.1.62475 WP_001670675.1.62486 WP_001670675.1.62504 WP_001670675.1.62522 WP_001670675.1.6253 WP_001670675.1.62536 WP_001670675.1.62564 WP_001670675.1.62570 WP_001670675.1.62640 WP_001670675.1.62648 WP_001670675.1.62686 WP_001670675.1.62693 WP_001670675.1.627 WP_001670675.1.62725 WP_001670675.1.62745 WP_001670675.1.62751 WP_001670675.1.62757 WP_001670675.1.62798 WP_001670675.1.62825 WP_001670675.1.62853 WP_001670675.1.62903 WP_001670675.1.62910 WP_001670675.1.62913 WP_001670675.1.6292 WP_001670675.1.62932 WP_001670675.1.62955 WP_001670675.1.62960 WP_001670675.1.62976 WP_001670675.1.62983 WP_001670675.1.62988 WP_001670675.1.63016 WP_001670675.1.63025 WP_001670675.1.63043 WP_001670675.1.63045 WP_001670675.1.63063 WP_001670675.1.63069 WP_001670675.1.63087 WP_001670675.1.63102 WP_001670675.1.63118 WP_001670675.1.63129 WP_001670675.1.63135 WP_001670675.1.63155 WP_001670675.1.63169 WP_001670675.1.63181 WP_001670675.1.63186 WP_001670675.1.63203 WP_001670675.1.63229 WP_001670675.1.63234 WP_001670675.1.63243 WP_001670675.1.63250 WP_001670675.1.63256 WP_001670675.1.63290 WP_001670675.1.63297 WP_001670675.1.63358 WP_001670675.1.63382 WP_001670675.1.63422 WP_001670675.1.63432 WP_001670675.1.63448 WP_001670675.1.63455 WP_001670675.1.63461 WP_001670675.1.63479 WP_001670675.1.63497 WP_001670675.1.63499 WP_001670675.1.63509 WP_001670675.1.63514 WP_001670675.1.63525 WP_001670675.1.63529 WP_001670675.1.63532 WP_001670675.1.6357 WP_001670675.1.63577 WP_001670675.1.63583 WP_001670675.1.63585 WP_001670675.1.63592 WP_001670675.1.63603 WP_001670675.1.63663 WP_001670675.1.63664 WP_001670675.1.6367 WP_001670675.1.63677 WP_001670675.1.63690 WP_001670675.1.6370 WP_001670675.1.63718 WP_001670675.1.63731 WP_001670675.1.63736 WP_001670675.1.63748 WP_001670675.1.6375 WP_001670675.1.63757 WP_001670675.1.63766 WP_001670675.1.63781 WP_001670675.1.63797 WP_001670675.1.63816 WP_001670675.1.63824 WP_001670675.1.63831 WP_001670675.1.63834 WP_001670675.1.63851 WP_001670675.1.63860 WP_001670675.1.63863 WP_001670675.1.63864 WP_001670675.1.63866 WP_001670675.1.63876 WP_001670675.1.6389 WP_001670675.1.63901 WP_001670675.1.63903 WP_001670675.1.63912 WP_001670675.1.63934 WP_001670675.1.63955 WP_001670675.1.63958 WP_001670675.1.63963 WP_001670675.1.63977 WP_001670675.1.6399 WP_001670675.1.63992 WP_001670675.1.64007 WP_001670675.1.64010 WP_001670675.1.64018 WP_001670675.1.64032 WP_001670675.1.64034 WP_001670675.1.64046 WP_001670675.1.64072 WP_001670675.1.64085 WP_001670675.1.64087 WP_001670675.1.64109 WP_001670675.1.64121 WP_001670675.1.6415 WP_001670675.1.64157 WP_001670675.1.64208 WP_001670675.1.64229 WP_001670675.1.6423 WP_001670675.1.64242 WP_001670675.1.64244 WP_001670675.1.64266 WP_001670675.1.64293 WP_001670675.1.64332 WP_001670675.1.64350 WP_001670675.1.6437 WP_001670675.1.64374 WP_001670675.1.64376 WP_001670675.1.64385 WP_001670675.1.64387 WP_001670675.1.644 WP_001670675.1.64403 WP_001670675.1.64412 WP_001670675.1.64462 WP_001670675.1.64471 WP_001670675.1.64500 WP_001670675.1.64501 WP_001670675.1.6451 WP_001670675.1.64538 WP_001670675.1.64569 WP_001670675.1.64597 WP_001670675.1.64632 WP_001670675.1.64645 WP_001670675.1.64648 WP_001670675.1.64649 WP_001670675.1.64654 WP_001670675.1.64662 WP_001670675.1.64663 WP_001670675.1.64667 WP_001670675.1.64674 WP_001670675.1.64690 WP_001670675.1.64702 WP_001670675.1.64709 WP_001670675.1.64710 WP_001670675.1.64711 WP_001670675.1.64744 WP_001670675.1.64757 WP_001670675.1.64758 WP_001670675.1.64763 WP_001670675.1.64781 WP_001670675.1.64798 WP_001670675.1.64817 WP_001670675.1.64831 WP_001670675.1.64847 WP_001670675.1.6487 WP_001670675.1.6489 WP_001670675.1.64891 WP_001670675.1.64894 WP_001670675.1.64919 WP_001670675.1.64920 WP_001670675.1.64974 WP_001670675.1.64977 WP_001670675.1.65011 WP_001670675.1.65018 WP_001670675.1.65022 WP_001670675.1.65027 WP_001670675.1.65028 WP_001670675.1.65052 WP_001670675.1.65054 WP_001670675.1.65075 WP_001670675.1.6514 WP_001670675.1.65163 WP_001670675.1.65168 WP_001670675.1.65171 WP_001670675.1.65172 WP_001670675.1.65185 WP_001670675.1.65191 WP_001670675.1.65200 WP_001670675.1.65211 WP_001670675.1.65218 WP_001670675.1.65226 WP_001670675.1.65238 WP_001670675.1.65248 WP_001670675.1.65249 WP_001670675.1.65266 WP_001670675.1.65269 WP_001670675.1.65348 WP_001670675.1.6535 WP_001670675.1.65357 WP_001670675.1.65394 WP_001670675.1.65395 WP_001670675.1.65437 WP_001670675.1.65459 WP_001670675.1.65463 WP_001670675.1.65474 WP_001670675.1.65475 WP_001670675.1.65487 WP_001670675.1.6549 WP_001670675.1.65499 WP_001670675.1.65508 WP_001670675.1.6554 WP_001670675.1.65558 WP_001670675.1.65572 WP_001670675.1.6560 WP_001670675.1.65601 WP_001670675.1.6561 WP_001670675.1.65633 WP_001670675.1.6565 WP_001670675.1.65650 WP_001670675.1.65696 WP_001670675.1.65697 WP_001670675.1.65698 WP_001670675.1.65699 WP_001670675.1.6572 WP_001670675.1.65737 WP_001670675.1.6575 WP_001670675.1.65755 WP_001670675.1.65771 WP_001670675.1.65782 WP_001670675.1.65790 WP_001670675.1.65795 WP_001670675.1.65812 WP_001670675.1.65818 WP_001670675.1.65838 WP_001670675.1.65846 WP_001670675.1.65849 WP_001670675.1.65863 WP_001670675.1.65876 WP_001670675.1.65881 WP_001670675.1.65883 WP_001670675.1.65901 WP_001670675.1.6594 WP_001670675.1.65940 WP_001670675.1.65945 WP_001670675.1.6595 WP_001670675.1.65956 WP_001670675.1.65968 WP_001670675.1.65985 WP_001670675.1.66021 WP_001670675.1.66031 WP_001670675.1.66049 WP_001670675.1.66052 WP_001670675.1.66064 WP_001670675.1.66074 WP_001670675.1.66082 WP_001670675.1.66109 WP_001670675.1.66122 WP_001670675.1.66129 WP_001670675.1.66145 WP_001670675.1.66167 WP_001670675.1.66171 WP_001670675.1.66183 WP_001670675.1.6620 WP_001670675.1.66216 WP_001670675.1.66234 WP_001670675.1.66235 WP_001670675.1.66270 WP_001670675.1.66272 WP_001670675.1.66273 WP_001670675.1.66289 WP_001670675.1.6630 WP_001670675.1.66314 WP_001670675.1.66315 WP_001670675.1.66324 WP_001670675.1.66330 WP_001670675.1.6634 WP_001670675.1.66358 WP_001670675.1.66361 WP_001670675.1.66362 WP_001670675.1.66365 WP_001670675.1.66368 WP_001670675.1.6638 WP_001670675.1.66385 WP_001670675.1.6640 WP_001670675.1.66400 WP_001670675.1.66428 WP_001670675.1.66446 WP_001670675.1.66462 WP_001670675.1.6647 WP_001670675.1.66480 WP_001670675.1.66492 WP_001670675.1.66506 WP_001670675.1.66534 WP_001670675.1.66539 WP_001670675.1.66600 WP_001670675.1.66630 WP_001670675.1.66665 WP_001670675.1.66678 WP_001670675.1.66681 WP_001670675.1.66684 WP_001670675.1.66698 WP_001670675.1.66733 WP_001670675.1.66755 WP_001670675.1.66759 WP_001670675.1.66779 WP_001670675.1.6680 WP_001670675.1.66801 WP_001670675.1.66820 WP_001670675.1.66824 WP_001670675.1.66825 WP_001670675.1.66834 WP_001670675.1.66860 WP_001670675.1.66876 WP_001670675.1.66901 WP_001670675.1.6692 WP_001670675.1.66937 WP_001670675.1.66953 WP_001670675.1.66955 WP_001670675.1.66959 WP_001670675.1.66962 WP_001670675.1.66981 WP_001670675.1.67 WP_001670675.1.67024 WP_001670675.1.67037 WP_001670675.1.67042 WP_001670675.1.67045 WP_001670675.1.67075 WP_001670675.1.6710 WP_001670675.1.67100 WP_001670675.1.67101 WP_001670675.1.67143 WP_001670675.1.67173 WP_001670675.1.67181 WP_001670675.1.67184 WP_001670675.1.67201 WP_001670675.1.67211 WP_001670675.1.67228 WP_001670675.1.67235 WP_001670675.1.67237 WP_001670675.1.67268 WP_001670675.1.67279 WP_001670675.1.67288 WP_001670675.1.67336 WP_001670675.1.67339 WP_001670675.1.67347 WP_001670675.1.67374 WP_001670675.1.67387 WP_001670675.1.6739 WP_001670675.1.67394 WP_001670675.1.67397 WP_001670675.1.67403 WP_001670675.1.67424 WP_001670675.1.67430 WP_001670675.1.67442 WP_001670675.1.67465 WP_001670675.1.67539 WP_001670675.1.67552 WP_001670675.1.67556 WP_001670675.1.67576 WP_001670675.1.6760 WP_001670675.1.67604 WP_001670675.1.67617 WP_001670675.1.67619 WP_001670675.1.67625 WP_001670675.1.67627 WP_001670675.1.67633 WP_001670675.1.67637 WP_001670675.1.67641 WP_001670675.1.67657 WP_001670675.1.67673 WP_001670675.1.67682 WP_001670675.1.67700 WP_001670675.1.67707 WP_001670675.1.67718 WP_001670675.1.67729 WP_001670675.1.67772 WP_001670675.1.67774 WP_001670675.1.67803 WP_001670675.1.67814 WP_001670675.1.6782 WP_001670675.1.67820 WP_001670675.1.67825 WP_001670675.1.67827 WP_001670675.1.67829 WP_001670675.1.6785 WP_001670675.1.67887 WP_001670675.1.67905 WP_001670675.1.67910 WP_001670675.1.67924 WP_001670675.1.67932 WP_001670675.1.67942 WP_001670675.1.67954 WP_001670675.1.67969 WP_001670675.1.67977 WP_001670675.1.67988 WP_001670675.1.68 WP_001670675.1.68036 WP_001670675.1.68043 WP_001670675.1.68073 WP_001670675.1.6809 WP_001670675.1.68105 WP_001670675.1.68113 WP_001670675.1.68115 WP_001670675.1.68131 WP_001670675.1.68140 WP_001670675.1.68147 WP_001670675.1.68159 WP_001670675.1.68182 WP_001670675.1.6819 WP_001670675.1.68201 WP_001670675.1.68206 WP_001670675.1.68210 WP_001670675.1.6827 WP_001670675.1.68275 WP_001670675.1.68285 WP_001670675.1.6833 WP_001670675.1.68359 WP_001670675.1.68401 WP_001670675.1.68420 WP_001670675.1.68477 WP_001670675.1.68478 WP_001670675.1.6849 WP_001670675.1.685 WP_001670675.1.68514 WP_001670675.1.68532 WP_001670675.1.68547 WP_001670675.1.68564 WP_001670675.1.6857 WP_001670675.1.68589 WP_001670675.1.68591 WP_001670675.1.68652 WP_001670675.1.68655 WP_001670675.1.68656 WP_001670675.1.68658 WP_001670675.1.68677 WP_001670675.1.68688 WP_001670675.1.6869 WP_001670675.1.68690 WP_001670675.1.68742 WP_001670675.1.6875 WP_001670675.1.68770 WP_001670675.1.68778 WP_001670675.1.68787 WP_001670675.1.68809 WP_001670675.1.68816 WP_001670675.1.68818 WP_001670675.1.6882 WP_001670675.1.68893 WP_001670675.1.68894 WP_001670675.1.68895 WP_001670675.1.68914 WP_001670675.1.68928 WP_001670675.1.68958 WP_001670675.1.68966 WP_001670675.1.68975 WP_001670675.1.68999 WP_001670675.1.69001 WP_001670675.1.69006 WP_001670675.1.69011 WP_001670675.1.69029 WP_001670675.1.6904 WP_001670675.1.69053 WP_001670675.1.6907 WP_001670675.1.69080 WP_001670675.1.69086 WP_001670675.1.6913 WP_001670675.1.69131 WP_001670675.1.69146 WP_001670675.1.69151 WP_001670675.1.69170 WP_001670675.1.69210 WP_001670675.1.69236 WP_001670675.1.69255 WP_001670675.1.69270 WP_001670675.1.69273 WP_001670675.1.69282 WP_001670675.1.69288 WP_001670675.1.69296 WP_001670675.1.69320 WP_001670675.1.69346 WP_001670675.1.69357 WP_001670675.1.69359 WP_001670675.1.69371 WP_001670675.1.69376 WP_001670675.1.69396 WP_001670675.1.69397 WP_001670675.1.69433 WP_001670675.1.69465 WP_001670675.1.69466 WP_001670675.1.69485 WP_001670675.1.69515 WP_001670675.1.6954 WP_001670675.1.69554 WP_001670675.1.69564 WP_001670675.1.69575 WP_001670675.1.69592 WP_001670675.1.69597 WP_001670675.1.69611 WP_001670675.1.69616 WP_001670675.1.69636 WP_001670675.1.69642 WP_001670675.1.69644 WP_001670675.1.69656 WP_001670675.1.69657 WP_001670675.1.69690 WP_001670675.1.69696 WP_001670675.1.69704 WP_001670675.1.69710 WP_001670675.1.69754 WP_001670675.1.69758 WP_001670675.1.69760 WP_001670675.1.69767 WP_001670675.1.69785 WP_001670675.1.69787 WP_001670675.1.69790 WP_001670675.1.69807 WP_001670675.1.69808 WP_001670675.1.69839 WP_001670675.1.69848 WP_001670675.1.69890 WP_001670675.1.69923 WP_001670675.1.69948 WP_001670675.1.69953 WP_001670675.1.69965 WP_001670675.1.69975 WP_001670675.1.69977 WP_001670675.1.69982 WP_001670675.1.70003 WP_001670675.1.70010 WP_001670675.1.70028 WP_001670675.1.70047 WP_001670675.1.70049 WP_001670675.1.70058 WP_001670675.1.70061 WP_001670675.1.70088 WP_001670675.1.7010 WP_001670675.1.7014 WP_001670675.1.7016 WP_001670675.1.70169 WP_001670675.1.70205 WP_001670675.1.7021 WP_001670675.1.70240 WP_001670675.1.70241 WP_001670675.1.70249 WP_001670675.1.70261 WP_001670675.1.70269 WP_001670675.1.70272 WP_001670675.1.70289 WP_001670675.1.70303 WP_001670675.1.70314 WP_001670675.1.70321 WP_001670675.1.70326 WP_001670675.1.70327 WP_001670675.1.7033 WP_001670675.1.70427 WP_001670675.1.70433 WP_001670675.1.70440 WP_001670675.1.70447 WP_001670675.1.70485 WP_001670675.1.70488 WP_001670675.1.70491 WP_001670675.1.70523 WP_001670675.1.70531 WP_001670675.1.70545 WP_001670675.1.70547 WP_001670675.1.70580 WP_001670675.1.70596 WP_001670675.1.7060 WP_001670675.1.70623 WP_001670675.1.70643 WP_001670675.1.70644 WP_001670675.1.70662 WP_001670675.1.70671 WP_001670675.1.70678 WP_001670675.1.70679 WP_001670675.1.70683 WP_001670675.1.70708 WP_001670675.1.70717 WP_001670675.1.70731 WP_001670675.1.70732 WP_001670675.1.70733 WP_001670675.1.70761 WP_001670675.1.70772 WP_001670675.1.70785 WP_001670675.1.70792 WP_001670675.1.70797 WP_001670675.1.70837 WP_001670675.1.70845 WP_001670675.1.70846 WP_001670675.1.70883 WP_001670675.1.70899 WP_001670675.1.70922 WP_001670675.1.70929 WP_001670675.1.70948 WP_001670675.1.70959 WP_001670675.1.70969 WP_001670675.1.70971 WP_001670675.1.70977 WP_001670675.1.70981 WP_001670675.1.70985 WP_001670675.1.70995 WP_001670675.1.71010 WP_001670675.1.71023 WP_001670675.1.71039 WP_001670675.1.71057 WP_001670675.1.71081 WP_001670675.1.71116 WP_001670675.1.71117 WP_001670675.1.71146 WP_001670675.1.71165 WP_001670675.1.71171 WP_001670675.1.71172 WP_001670675.1.71184 WP_001670675.1.71186 WP_001670675.1.71188 WP_001670675.1.71201 WP_001670675.1.71202 WP_001670675.1.71243 WP_001670675.1.71268 WP_001670675.1.71299 WP_001670675.1.71305 WP_001670675.1.71306 WP_001670675.1.71337 WP_001670675.1.7134 WP_001670675.1.71363 WP_001670675.1.71368 WP_001670675.1.71378 WP_001670675.1.714 WP_001670675.1.71401 WP_001670675.1.71407 WP_001670675.1.7142 WP_001670675.1.71446 WP_001670675.1.71452 WP_001670675.1.71455 WP_001670675.1.71456 WP_001670675.1.71481 WP_001670675.1.71487 WP_001670675.1.71500 WP_001670675.1.71523 WP_001670675.1.71542 WP_001670675.1.71566 WP_001670675.1.71600 WP_001670675.1.71626 WP_001670675.1.71636 WP_001670675.1.71640 WP_001670675.1.71649 WP_001670675.1.71651 WP_001670675.1.71653 WP_001670675.1.71656 WP_001670675.1.71691 WP_001670675.1.71702 WP_001670675.1.71716 WP_001670675.1.7174 WP_001670675.1.71746 WP_001670675.1.71750 WP_001670675.1.71756 WP_001670675.1.71798 WP_001670675.1.71845 WP_001670675.1.71848 WP_001670675.1.71872 WP_001670675.1.71881 WP_001670675.1.71908 WP_001670675.1.71923 WP_001670675.1.71929 WP_001670675.1.71941 WP_001670675.1.71950 WP_001670675.1.71952 WP_001670675.1.71954 WP_001670675.1.71973 WP_001670675.1.71979 WP_001670675.1.71984 WP_001670675.1.71985 WP_001670675.1.720 WP_001670675.1.72003 WP_001670675.1.72065 WP_001670675.1.72068 WP_001670675.1.72073 WP_001670675.1.72100 WP_001670675.1.72105 WP_001670675.1.72107 WP_001670675.1.72119 WP_001670675.1.72121 WP_001670675.1.72182 WP_001670675.1.72190 WP_001670675.1.72203 WP_001670675.1.72220 WP_001670675.1.72221 WP_001670675.1.72226 WP_001670675.1.72234 WP_001670675.1.72243 WP_001670675.1.72254 WP_001670675.1.72269 WP_001670675.1.72281 WP_001670675.1.72283 WP_001670675.1.72300 WP_001670675.1.72307 WP_001670675.1.72325 WP_001670675.1.72339 WP_001670675.1.72350 WP_001670675.1.72351 WP_001670675.1.72372 WP_001670675.1.72376 WP_001670675.1.72382 WP_001670675.1.72383 WP_001670675.1.72403 WP_001670675.1.72412 WP_001670675.1.7243 WP_001670675.1.72461 WP_001670675.1.72470 WP_001670675.1.72527 WP_001670675.1.72532 WP_001670675.1.7255 WP_001670675.1.72594 WP_001670675.1.72602 WP_001670675.1.72625 WP_001670675.1.72629 WP_001670675.1.72631 WP_001670675.1.72638 WP_001670675.1.72642 WP_001670675.1.72667 WP_001670675.1.72674 WP_001670675.1.72716 WP_001670675.1.72718 WP_001670675.1.72724 WP_001670675.1.72728 WP_001670675.1.72789 WP_001670675.1.72793 WP_001670675.1.72797 WP_001670675.1.72827 WP_001670675.1.72828 WP_001670675.1.72843 WP_001670675.1.72850 WP_001670675.1.72865 WP_001670675.1.72871 WP_001670675.1.72872 WP_001670675.1.72887 WP_001670675.1.72892 WP_001670675.1.72896 WP_001670675.1.72897 WP_001670675.1.72944 WP_001670675.1.7295 WP_001670675.1.72968 WP_001670675.1.72969 WP_001670675.1.72975 WP_001670675.1.72987 WP_001670675.1.7304 WP_001670675.1.73052 WP_001670675.1.73062 WP_001670675.1.73068 WP_001670675.1.73102 WP_001670675.1.7311 WP_001670675.1.73114 WP_001670675.1.73125 WP_001670675.1.73144 WP_001670675.1.7315 WP_001670675.1.73177 WP_001670675.1.73180 WP_001670675.1.73200 WP_001670675.1.73258 WP_001670675.1.73270 WP_001670675.1.73285 WP_001670675.1.7332 WP_001670675.1.73328 WP_001670675.1.7333 WP_001670675.1.7334 WP_001670675.1.73352 WP_001670675.1.73362 WP_001670675.1.73377 WP_001670675.1.73379 WP_001670675.1.73389 WP_001670675.1.7341 WP_001670675.1.73425 WP_001670675.1.73461 WP_001670675.1.73481 WP_001670675.1.73488 WP_001670675.1.73504 WP_001670675.1.73512 WP_001670675.1.7353 WP_001670675.1.73535 WP_001670675.1.73544 WP_001670675.1.7356 WP_001670675.1.73561 WP_001670675.1.73581 WP_001670675.1.73596 WP_001670675.1.73598 WP_001670675.1.7361 WP_001670675.1.73617 WP_001670675.1.73648 WP_001670675.1.73667 WP_001670675.1.73669 WP_001670675.1.73708 WP_001670675.1.7374 WP_001670675.1.73753 WP_001670675.1.73758 WP_001670675.1.73764 WP_001670675.1.73768 WP_001670675.1.73794 WP_001670675.1.73804 WP_001670675.1.73831 WP_001670675.1.73847 WP_001670675.1.73849 WP_001670675.1.7386 WP_001670675.1.7387 WP_001670675.1.73924 WP_001670675.1.73926 WP_001670675.1.7394 WP_001670675.1.73945 WP_001670675.1.73948 WP_001670675.1.73956 WP_001670675.1.73958 WP_001670675.1.73999 WP_001670675.1.74024 WP_001670675.1.74028 WP_001670675.1.74029 WP_001670675.1.74030 WP_001670675.1.74038 WP_001670675.1.74040 WP_001670675.1.74043 WP_001670675.1.74049 WP_001670675.1.74058 WP_001670675.1.74070 WP_001670675.1.74077 WP_001670675.1.74089 WP_001670675.1.74117 WP_001670675.1.74135 WP_001670675.1.74174 WP_001670675.1.74181 WP_001670675.1.74191 WP_001670675.1.74207 WP_001670675.1.74214 WP_001670675.1.74241 WP_001670675.1.74248 WP_001670675.1.74285 WP_001670675.1.743 WP_001670675.1.7430 WP_001670675.1.74300 WP_001670675.1.74317 WP_001670675.1.7433 WP_001670675.1.74379 WP_001670675.1.74402 WP_001670675.1.74410 WP_001670675.1.74414 WP_001670675.1.74415 WP_001670675.1.74418 WP_001670675.1.74422 WP_001670675.1.7444 WP_001670675.1.74454 WP_001670675.1.74466 WP_001670675.1.74481 WP_001670675.1.745 WP_001670675.1.74500 WP_001670675.1.74529 WP_001670675.1.74545 WP_001670675.1.74570 WP_001670675.1.74578 WP_001670675.1.74616 WP_001670675.1.74620 WP_001670675.1.74621 WP_001670675.1.74639 WP_001670675.1.74644 WP_001670675.1.74647 WP_001670675.1.74661 WP_001670675.1.74677 WP_001670675.1.74699 WP_001670675.1.74702 WP_001670675.1.74741 WP_001670675.1.74745 WP_001670675.1.74806 WP_001670675.1.74807 WP_001670675.1.74826 WP_001670675.1.74831 WP_001670675.1.74884 WP_001670675.1.74894 WP_001670675.1.7491 WP_001670675.1.74929 WP_001670675.1.74939 WP_001670675.1.74946 WP_001670675.1.74972 WP_001670675.1.74973 WP_001670675.1.74992 WP_001670675.1.74996 WP_001670675.1.75009 WP_001670675.1.75051 WP_001670675.1.75056 WP_001670675.1.75058 WP_001670675.1.7507 WP_001670675.1.75089 WP_001670675.1.75114 WP_001670675.1.75116 WP_001670675.1.75129 WP_001670675.1.75148 WP_001670675.1.75159 WP_001670675.1.75177 WP_001670675.1.75180 WP_001670675.1.75187 WP_001670675.1.75237 WP_001670675.1.75273 WP_001670675.1.75288 WP_001670675.1.75296 WP_001670675.1.75301 WP_001670675.1.75334 WP_001670675.1.75362 WP_001670675.1.75371 WP_001670675.1.75385 WP_001670675.1.75392 WP_001670675.1.75400 WP_001670675.1.75402 WP_001670675.1.75413 WP_001670675.1.7543 WP_001670675.1.75433 WP_001670675.1.75450 WP_001670675.1.75494 WP_001670675.1.75532 WP_001670675.1.75565 WP_001670675.1.7558 WP_001670675.1.75585 WP_001670675.1.75593 WP_001670675.1.75607 WP_001670675.1.75609 WP_001670675.1.75610 WP_001670675.1.75626 WP_001670675.1.75633 WP_001670675.1.75664 WP_001670675.1.75703 WP_001670675.1.75716 WP_001670675.1.75718 WP_001670675.1.75740 WP_001670675.1.75745 WP_001670675.1.75751 WP_001670675.1.75760 WP_001670675.1.75764 WP_001670675.1.75793 WP_001670675.1.75794 WP_001670675.1.75810 WP_001670675.1.75828 WP_001670675.1.75837 WP_001670675.1.75844 WP_001670675.1.75863 WP_001670675.1.75873 WP_001670675.1.75874 WP_001670675.1.75884 WP_001670675.1.75886 WP_001670675.1.75898 WP_001670675.1.75902 WP_001670675.1.75932 WP_001670675.1.75945 WP_001670675.1.75957 WP_001670675.1.76 WP_001670675.1.76020 WP_001670675.1.76024 WP_001670675.1.76055 WP_001670675.1.76081 WP_001670675.1.76097 WP_001670675.1.76102 WP_001670675.1.76108 WP_001670675.1.76115 WP_001670675.1.76116 WP_001670675.1.76122 WP_001670675.1.76137 WP_001670675.1.76156 WP_001670675.1.76164 WP_001670675.1.76170 WP_001670675.1.76186 WP_001670675.1.76208 WP_001670675.1.76252 WP_001670675.1.76256 WP_001670675.1.7629 WP_001670675.1.76301 WP_001670675.1.76327 WP_001670675.1.7633 WP_001670675.1.76339 WP_001670675.1.7634 WP_001670675.1.76345 WP_001670675.1.76346 WP_001670675.1.76364 WP_001670675.1.76366 WP_001670675.1.76417 WP_001670675.1.76434 WP_001670675.1.76445 WP_001670675.1.76451 WP_001670675.1.7646 WP_001670675.1.76471 WP_001670675.1.76495 WP_001670675.1.76510 WP_001670675.1.76548 WP_001670675.1.76558 WP_001670675.1.76572 WP_001670675.1.76576 WP_001670675.1.7660 WP_001670675.1.76641 WP_001670675.1.76651 WP_001670675.1.76653 WP_001670675.1.76673 WP_001670675.1.76706 WP_001670675.1.7672 WP_001670675.1.76721 WP_001670675.1.76724 WP_001670675.1.76738 WP_001670675.1.76756 WP_001670675.1.76760 WP_001670675.1.76776 WP_001670675.1.76788 WP_001670675.1.76799 WP_001670675.1.76806 WP_001670675.1.7684 WP_001670675.1.76854 WP_001670675.1.76866 WP_001670675.1.76875 WP_001670675.1.76880 WP_001670675.1.76899 WP_001670675.1.76913 WP_001670675.1.76916 WP_001670675.1.76932 WP_001670675.1.76968 WP_001670675.1.76973 WP_001670675.1.76988 WP_001670675.1.77016 WP_001670675.1.77017 WP_001670675.1.77038 WP_001670675.1.77047 WP_001670675.1.77067 WP_001670675.1.77080 WP_001670675.1.77087 WP_001670675.1.77090 WP_001670675.1.77111 WP_001670675.1.7712 WP_001670675.1.77177 WP_001670675.1.77180 WP_001670675.1.77184 WP_001670675.1.77193 WP_001670675.1.77241 WP_001670675.1.77244 WP_001670675.1.77267 WP_001670675.1.77271 WP_001670675.1.77292 WP_001670675.1.77299 WP_001670675.1.77306 WP_001670675.1.77313 WP_001670675.1.77356 WP_001670675.1.77384 WP_001670675.1.77390 WP_001670675.1.77414 WP_001670675.1.77431 WP_001670675.1.77436 WP_001670675.1.77440 WP_001670675.1.77475 WP_001670675.1.77496 WP_001670675.1.77501 WP_001670675.1.77512 WP_001670675.1.77513 WP_001670675.1.77514 WP_001670675.1.77529 WP_001670675.1.77543 WP_001670675.1.77549 WP_001670675.1.77555 WP_001670675.1.77563 WP_001670675.1.77565 WP_001670675.1.77575 WP_001670675.1.77596 WP_001670675.1.77629 WP_001670675.1.77646 WP_001670675.1.77653 WP_001670675.1.77692 WP_001670675.1.77702 WP_001670675.1.77710 WP_001670675.1.77713 WP_001670675.1.7772 WP_001670675.1.77729 WP_001670675.1.77754 WP_001670675.1.7782 WP_001670675.1.77825 WP_001670675.1.77837 WP_001670675.1.7784 WP_001670675.1.77846 WP_001670675.1.77851 WP_001670675.1.77871 WP_001670675.1.77898 WP_001670675.1.77900 WP_001670675.1.77918 WP_001670675.1.7792 WP_001670675.1.77923 WP_001670675.1.7793 WP_001670675.1.77951 WP_001670675.1.77960 WP_001670675.1.77971 WP_001670675.1.77975 WP_001670675.1.77983 WP_001670675.1.77987 WP_001670675.1.77989 WP_001670675.1.78 WP_001670675.1.7802 WP_001670675.1.78026 WP_001670675.1.78033 WP_001670675.1.78035 WP_001670675.1.78048 WP_001670675.1.78051 WP_001670675.1.78053 WP_001670675.1.78076 WP_001670675.1.78096 WP_001670675.1.78100 WP_001670675.1.78107 WP_001670675.1.78110 WP_001670675.1.78120 WP_001670675.1.7814 WP_001670675.1.78166 WP_001670675.1.78168 WP_001670675.1.78170 WP_001670675.1.78192 WP_001670675.1.78195 WP_001670675.1.78201 WP_001670675.1.78245 WP_001670675.1.78259 WP_001670675.1.78291 WP_001670675.1.78301 WP_001670675.1.78309 WP_001670675.1.78320 WP_001670675.1.78352 WP_001670675.1.78372 WP_001670675.1.78382 WP_001670675.1.78383 WP_001670675.1.78388 WP_001670675.1.78407 WP_001670675.1.78410 WP_001670675.1.78443 WP_001670675.1.78495 WP_001670675.1.78496 WP_001670675.1.78501 WP_001670675.1.78602 WP_001670675.1.78603 WP_001670675.1.7861 WP_001670675.1.78618 WP_001670675.1.7862 WP_001670675.1.78626 WP_001670675.1.78632 WP_001670675.1.78658 WP_001670675.1.78661 WP_001670675.1.78673 WP_001670675.1.78674 WP_001670675.1.78676 WP_001670675.1.78697 WP_001670675.1.78715 WP_001670675.1.78734 WP_001670675.1.78735 WP_001670675.1.78738 WP_001670675.1.78761 WP_001670675.1.7877 WP_001670675.1.78771 WP_001670675.1.78802 WP_001670675.1.78815 WP_001670675.1.78830 WP_001670675.1.78835 WP_001670675.1.78838 WP_001670675.1.78862 WP_001670675.1.78871 WP_001670675.1.78874 WP_001670675.1.78877 WP_001670675.1.78881 WP_001670675.1.78896 WP_001670675.1.789 WP_001670675.1.7891 WP_001670675.1.78918 WP_001670675.1.78928 WP_001670675.1.7893 WP_001670675.1.78930 WP_001670675.1.78959 WP_001670675.1.78993 WP_001670675.1.79011 WP_001670675.1.79012 WP_001670675.1.79032 WP_001670675.1.79069 WP_001670675.1.79074 WP_001670675.1.79081 WP_001670675.1.79098 WP_001670675.1.79099 WP_001670675.1.79140 WP_001670675.1.79151 WP_001670675.1.79155 WP_001670675.1.79164 WP_001670675.1.79167 WP_001670675.1.79204 WP_001670675.1.79235 WP_001670675.1.79280 WP_001670675.1.79289 WP_001670675.1.79297 WP_001670675.1.79302 WP_001670675.1.79335 WP_001670675.1.79370 WP_001670675.1.79397 WP_001670675.1.794 WP_001670675.1.79456 WP_001670675.1.79462 WP_001670675.1.79466 WP_001670675.1.79468 WP_001670675.1.79472 WP_001670675.1.79490 WP_001670675.1.79495 WP_001670675.1.79529 WP_001670675.1.79531 WP_001670675.1.79532 WP_001670675.1.79547 WP_001670675.1.79570 WP_001670675.1.79580 WP_001670675.1.79586 WP_001670675.1.7964 WP_001670675.1.79642 WP_001670675.1.79645 WP_001670675.1.79654 WP_001670675.1.79659 WP_001670675.1.79668 WP_001670675.1.7970 WP_001670675.1.79708 WP_001670675.1.7972 WP_001670675.1.79722 WP_001670675.1.79734 WP_001670675.1.79738 WP_001670675.1.79757 WP_001670675.1.79772 WP_001670675.1.7979 WP_001670675.1.7982 WP_001670675.1.79832 WP_001670675.1.79845 WP_001670675.1.79880 WP_001670675.1.79892 WP_001670675.1.7991 WP_001670675.1.79910 WP_001670675.1.79914 WP_001670675.1.79916 WP_001670675.1.79929 WP_001670675.1.79934 WP_001670675.1.7994 WP_001670675.1.79942 WP_001670675.1.79945 WP_001670675.1.79951 WP_001670675.1.79966 WP_001670675.1.79974 WP_001670675.1.79977 WP_001670675.1.79996 WP_001670675.1.80065 WP_001670675.1.80077 WP_001670675.1.80103 WP_001670675.1.80137 WP_001670675.1.80182 WP_001670675.1.80236 WP_001670675.1.80249 WP_001670675.1.80250 WP_001670675.1.80254 WP_001670675.1.80273 WP_001670675.1.80282 WP_001670675.1.80293 WP_001670675.1.80296 WP_001670675.1.80307 WP_001670675.1.80354 WP_001670675.1.80366 WP_001670675.1.80368 WP_001670675.1.80380 WP_001670675.1.80386 WP_001670675.1.80400 WP_001670675.1.80441 WP_001670675.1.80443 WP_001670675.1.80448 WP_001670675.1.80462 WP_001670675.1.80473 WP_001670675.1.80479 WP_001670675.1.80480 WP_001670675.1.8049 WP_001670675.1.80492 WP_001670675.1.80529 WP_001670675.1.80542 WP_001670675.1.80569 WP_001670675.1.80609 WP_001670675.1.80629 WP_001670675.1.80638 WP_001670675.1.80651 WP_001670675.1.80664 WP_001670675.1.80667 WP_001670675.1.80674 WP_001670675.1.80696 WP_001670675.1.80725 WP_001670675.1.80741 WP_001670675.1.80750 WP_001670675.1.80757 WP_001670675.1.80760 WP_001670675.1.80780 WP_001670675.1.80819 WP_001670675.1.80827 WP_001670675.1.80831 WP_001670675.1.80850 WP_001670675.1.80857 WP_001670675.1.80874 WP_001670675.1.80876 WP_001670675.1.80881 WP_001670675.1.80913 WP_001670675.1.80927 WP_001670675.1.80939 WP_001670675.1.8096 WP_001670675.1.80973 WP_001670675.1.80984 WP_001670675.1.81037 WP_001670675.1.81041 WP_001670675.1.8106 WP_001670675.1.81067 WP_001670675.1.81069 WP_001670675.1.81084 WP_001670675.1.81109 WP_001670675.1.81110 WP_001670675.1.81131 WP_001670675.1.81149 WP_001670675.1.81175 WP_001670675.1.81187 WP_001670675.1.8119 WP_001670675.1.81193 WP_001670675.1.81197 WP_001670675.1.81225 WP_001670675.1.81231 WP_001670675.1.81262 WP_001670675.1.81268 WP_001670675.1.81269 WP_001670675.1.8127 WP_001670675.1.81271 WP_001670675.1.81275 WP_001670675.1.8130 WP_001670675.1.81302 WP_001670675.1.81305 WP_001670675.1.8131 WP_001670675.1.81320 WP_001670675.1.81321 WP_001670675.1.81328 WP_001670675.1.81333 WP_001670675.1.8134 WP_001670675.1.81342 WP_001670675.1.81354 WP_001670675.1.81364 WP_001670675.1.81388 WP_001670675.1.81404 WP_001670675.1.81409 WP_001670675.1.81410 WP_001670675.1.81425 WP_001670675.1.81455 WP_001670675.1.81472 WP_001670675.1.81494 WP_001670675.1.81504 WP_001670675.1.81528 WP_001670675.1.81548 WP_001670675.1.81557 WP_001670675.1.81568 WP_001670675.1.81667 WP_001670675.1.81668 WP_001670675.1.81676 WP_001670675.1.8168 WP_001670675.1.81681 WP_001670675.1.8170 WP_001670675.1.81727 WP_001670675.1.81735 WP_001670675.1.81736 WP_001670675.1.81743 WP_001670675.1.81746 WP_001670675.1.81750 WP_001670675.1.81760 WP_001670675.1.81763 WP_001670675.1.81768 WP_001670675.1.81785 WP_001670675.1.81795 WP_001670675.1.81798 WP_001670675.1.81855 WP_001670675.1.81902 WP_001670675.1.81921 WP_001670675.1.81931 WP_001670675.1.81936 WP_001670675.1.81941 WP_001670675.1.81949 WP_001670675.1.8196 WP_001670675.1.81965 WP_001670675.1.81974 WP_001670675.1.81977 WP_001670675.1.81995 WP_001670675.1.82070 WP_001670675.1.82076 WP_001670675.1.82099 WP_001670675.1.82131 WP_001670675.1.82141 WP_001670675.1.82149 WP_001670675.1.82156 WP_001670675.1.8218 WP_001670675.1.82180 WP_001670675.1.82192 WP_001670675.1.82201 WP_001670675.1.82214 WP_001670675.1.82225 WP_001670675.1.82232 WP_001670675.1.82258 WP_001670675.1.82269 WP_001670675.1.82337 WP_001670675.1.82347 WP_001670675.1.8236 WP_001670675.1.82369 WP_001670675.1.82395 WP_001670675.1.8240 WP_001670675.1.82401 WP_001670675.1.82408 WP_001670675.1.82416 WP_001670675.1.8242 WP_001670675.1.82420 WP_001670675.1.82434 WP_001670675.1.82456 WP_001670675.1.82464 WP_001670675.1.82465 WP_001670675.1.8247 WP_001670675.1.82473 WP_001670675.1.82474 WP_001670675.1.82479 WP_001670675.1.82503 WP_001670675.1.82515 WP_001670675.1.82529 WP_001670675.1.82530 WP_001670675.1.82553 WP_001670675.1.82569 WP_001670675.1.82570 WP_001670675.1.82584 WP_001670675.1.82636 WP_001670675.1.82646 WP_001670675.1.82648 WP_001670675.1.82670 WP_001670675.1.82676 WP_001670675.1.82692 WP_001670675.1.82731 WP_001670675.1.82761 WP_001670675.1.82763 WP_001670675.1.82812 WP_001670675.1.8282 WP_001670675.1.82841 WP_001670675.1.82843 WP_001670675.1.82850 WP_001670675.1.82867 WP_001670675.1.82872 WP_001670675.1.82886 WP_001670675.1.82895 WP_001670675.1.82908 WP_001670675.1.82937 WP_001670675.1.8294 WP_001670675.1.82944 WP_001670675.1.82946 WP_001670675.1.82956 WP_001670675.1.82959 WP_001670675.1.82964 WP_001670675.1.82992 WP_001670675.1.83005 WP_001670675.1.83006 WP_001670675.1.83007 WP_001670675.1.8304 WP_001670675.1.83061 WP_001670675.1.83092 WP_001670675.1.83119 WP_001670675.1.83128 WP_001670675.1.83139 WP_001670675.1.83163 WP_001670675.1.83180 WP_001670675.1.83204 WP_001670675.1.8322 WP_001670675.1.83221 WP_001670675.1.83229 WP_001670675.1.83235 WP_001670675.1.83252 WP_001670675.1.83258 WP_001670675.1.83280 WP_001670675.1.83290 WP_001670675.1.83301 WP_001670675.1.83305 WP_001670675.1.83331 WP_001670675.1.83333 WP_001670675.1.83354 WP_001670675.1.83356 WP_001670675.1.83360 WP_001670675.1.83365 WP_001670675.1.83378 WP_001670675.1.83382 WP_001670675.1.83407 WP_001670675.1.83413 WP_001670675.1.83491 WP_001670675.1.83510 WP_001670675.1.83516 WP_001670675.1.83523 WP_001670675.1.8354 WP_001670675.1.83558 WP_001670675.1.83572 WP_001670675.1.83598 WP_001670675.1.83650 WP_001670675.1.83651 WP_001670675.1.83657 WP_001670675.1.83677 WP_001670675.1.83721 WP_001670675.1.83739 WP_001670675.1.8375 WP_001670675.1.83759 WP_001670675.1.83760 WP_001670675.1.83806 WP_001670675.1.83854 WP_001670675.1.83897 WP_001670675.1.83923 WP_001670675.1.83960 WP_001670675.1.8399 WP_001670675.1.83994 WP_001670675.1.83995 WP_001670675.1.84 WP_001670675.1.84000 WP_001670675.1.84001 WP_001670675.1.84011 WP_001670675.1.84031 WP_001670675.1.8406 WP_001670675.1.84075 WP_001670675.1.84076 WP_001670675.1.84077 WP_001670675.1.84083 WP_001670675.1.84086 WP_001670675.1.84100 WP_001670675.1.84103 WP_001670675.1.84106 WP_001670675.1.84110 WP_001670675.1.84127 WP_001670675.1.84150 WP_001670675.1.84154 WP_001670675.1.84168 WP_001670675.1.84179 WP_001670675.1.84209 WP_001670675.1.84230 WP_001670675.1.8425 WP_001670675.1.84252 WP_001670675.1.84283 WP_001670675.1.84291 WP_001670675.1.84300 WP_001670675.1.8431 WP_001670675.1.84345 WP_001670675.1.84355 WP_001670675.1.84359 WP_001670675.1.84369 WP_001670675.1.84373 WP_001670675.1.84392 WP_001670675.1.84397 WP_001670675.1.84401 WP_001670675.1.8441 WP_001670675.1.84435 WP_001670675.1.84459 WP_001670675.1.84461 WP_001670675.1.84475 WP_001670675.1.84497 WP_001670675.1.84515 WP_001670675.1.84532 WP_001670675.1.84551 WP_001670675.1.84554 WP_001670675.1.84567 WP_001670675.1.84572 WP_001670675.1.84598 WP_001670675.1.84631 WP_001670675.1.84644 WP_001670675.1.84659 WP_001670675.1.84683 WP_001670675.1.84693 WP_001670675.1.84727 WP_001670675.1.84744 WP_001670675.1.84745 WP_001670675.1.84773 WP_001670675.1.84814 WP_001670675.1.84872 WP_001670675.1.84876 WP_001670675.1.84879 WP_001670675.1.84899 WP_001670675.1.849 WP_001670675.1.84945 WP_001670675.1.84967 WP_001670675.1.8497 WP_001670675.1.84983 WP_001670675.1.85004 WP_001670675.1.85014 WP_001670675.1.8502 WP_001670675.1.85039 WP_001670675.1.85040 WP_001670675.1.85079 WP_001670675.1.85094 WP_001670675.1.85120 WP_001670675.1.85126 WP_001670675.1.85134 WP_001670675.1.85147 WP_001670675.1.85153 WP_001670675.1.85178 WP_001670675.1.85180 WP_001670675.1.85190 WP_001670675.1.85192 WP_001670675.1.85217 WP_001670675.1.8526 WP_001670675.1.85271 WP_001670675.1.85273 WP_001670675.1.85301 WP_001670675.1.8533 WP_001670675.1.85338 WP_001670675.1.85339 WP_001670675.1.8537 WP_001670675.1.85408 WP_001670675.1.85433 WP_001670675.1.8545 WP_001670675.1.85456 WP_001670675.1.85469 WP_001670675.1.85481 WP_001670675.1.85483 WP_001670675.1.85511 WP_001670675.1.85512 WP_001670675.1.8552 WP_001670675.1.85541 WP_001670675.1.8556 WP_001670675.1.85568 WP_001670675.1.8557 WP_001670675.1.85606 WP_001670675.1.85615 WP_001670675.1.85617 WP_001670675.1.85635 WP_001670675.1.85646 WP_001670675.1.85663 WP_001670675.1.85665 WP_001670675.1.85669 WP_001670675.1.85671 WP_001670675.1.85672 WP_001670675.1.85675 WP_001670675.1.85688 WP_001670675.1.85703 WP_001670675.1.85723 WP_001670675.1.85728 WP_001670675.1.85742 WP_001670675.1.85746 WP_001670675.1.85759 WP_001670675.1.85777 WP_001670675.1.85780 WP_001670675.1.85811 WP_001670675.1.85854 WP_001670675.1.85855 WP_001670675.1.85864 WP_001670675.1.85886 WP_001670675.1.859 WP_001670675.1.85900 WP_001670675.1.85904 WP_001670675.1.8591 WP_001670675.1.85917 WP_001670675.1.8594 WP_001670675.1.85943 WP_001670675.1.85976 WP_001670675.1.85977 WP_001670675.1.85982 WP_001670675.1.860 WP_001670675.1.86007 WP_001670675.1.86010 WP_001670675.1.86017 WP_001670675.1.86043 WP_001670675.1.8605 WP_001670675.1.86084 WP_001670675.1.8610 WP_001670675.1.86120 WP_001670675.1.86138 WP_001670675.1.8614 WP_001670675.1.86156 WP_001670675.1.86157 WP_001670675.1.86159 WP_001670675.1.8616 WP_001670675.1.86173 WP_001670675.1.86224 WP_001670675.1.86240 WP_001670675.1.86259 WP_001670675.1.86285 WP_001670675.1.86306 WP_001670675.1.86310 WP_001670675.1.86316 WP_001670675.1.86323 WP_001670675.1.86335 WP_001670675.1.86342 WP_001670675.1.86347 WP_001670675.1.86356 WP_001670675.1.86380 WP_001670675.1.86389 WP_001670675.1.8640 WP_001670675.1.8642 WP_001670675.1.86426 WP_001670675.1.86450 WP_001670675.1.86453 WP_001670675.1.86466 WP_001670675.1.86469 WP_001670675.1.8647 WP_001670675.1.86489 WP_001670675.1.86514 WP_001670675.1.86530 WP_001670675.1.86580 WP_001670675.1.86588 WP_001670675.1.86593 WP_001670675.1.86601 WP_001670675.1.86610 WP_001670675.1.86634 WP_001670675.1.86656 WP_001670675.1.86661 WP_001670675.1.86663 WP_001670675.1.86699 WP_001670675.1.8672 WP_001670675.1.86735 WP_001670675.1.86744 WP_001670675.1.86770 WP_001670675.1.8678 WP_001670675.1.86794 WP_001670675.1.86800 WP_001670675.1.86807 WP_001670675.1.86810 WP_001670675.1.86811 WP_001670675.1.86815 WP_001670675.1.8684 WP_001670675.1.86859 WP_001670675.1.86860 WP_001670675.1.86895 WP_001670675.1.86902 WP_001670675.1.86906 WP_001670675.1.8691 WP_001670675.1.86915 WP_001670675.1.86945 WP_001670675.1.86982 WP_001670675.1.86989 WP_001670675.1.87023 WP_001670675.1.87034 WP_001670675.1.87038 WP_001670675.1.87041 WP_001670675.1.87051 WP_001670675.1.87095 WP_001670675.1.87136 WP_001670675.1.87143 WP_001670675.1.87148 WP_001670675.1.87155 WP_001670675.1.87187 WP_001670675.1.87219 WP_001670675.1.87220 WP_001670675.1.87258 WP_001670675.1.87265 WP_001670675.1.87276 WP_001670675.1.87282 WP_001670675.1.87283 WP_001670675.1.87293 WP_001670675.1.87323 WP_001670675.1.87346 WP_001670675.1.8736 WP_001670675.1.87365 WP_001670675.1.87370 WP_001670675.1.87376 WP_001670675.1.87420 WP_001670675.1.87460 WP_001670675.1.87484 WP_001670675.1.87493 WP_001670675.1.87500 WP_001670675.1.87528 WP_001670675.1.87552 WP_001670675.1.87560 WP_001670675.1.87583 WP_001670675.1.87584 WP_001670675.1.8760 WP_001670675.1.87600 WP_001670675.1.87609 WP_001670675.1.87612 WP_001670675.1.87615 WP_001670675.1.87618 WP_001670675.1.87626 WP_001670675.1.87651 WP_001670675.1.87653 WP_001670675.1.87659 WP_001670675.1.8767 WP_001670675.1.87687 WP_001670675.1.87695 WP_001670675.1.87698 WP_001670675.1.87706 WP_001670675.1.87712 WP_001670675.1.87739 WP_001670675.1.87741 WP_001670675.1.87742 WP_001670675.1.87760 WP_001670675.1.87779 WP_001670675.1.87852 WP_001670675.1.87875 WP_001670675.1.87899 WP_001670675.1.87905 WP_001670675.1.8792 WP_001670675.1.87933 WP_001670675.1.87936 WP_001670675.1.87945 WP_001670675.1.87949 WP_001670675.1.87999 WP_001670675.1.88014 WP_001670675.1.88019 WP_001670675.1.88025 WP_001670675.1.88026 WP_001670675.1.8805 WP_001670675.1.88052 WP_001670675.1.8806 WP_001670675.1.88073 WP_001670675.1.8809 WP_001670675.1.88092 WP_001670675.1.881 WP_001670675.1.88145 WP_001670675.1.88165 WP_001670675.1.88174 WP_001670675.1.88185 WP_001670675.1.88199 WP_001670675.1.88214 WP_001670675.1.88222 WP_001670675.1.88244 WP_001670675.1.88264 WP_001670675.1.88275 WP_001670675.1.88291 WP_001670675.1.88293 WP_001670675.1.88299 WP_001670675.1.88313 WP_001670675.1.88356 WP_001670675.1.88359 WP_001670675.1.8837 WP_001670675.1.88393 WP_001670675.1.88407 WP_001670675.1.88414 WP_001670675.1.88423 WP_001670675.1.88444 WP_001670675.1.88446 WP_001670675.1.88458 WP_001670675.1.88474 WP_001670675.1.8849 WP_001670675.1.88501 WP_001670675.1.88508 WP_001670675.1.88538 WP_001670675.1.88547 WP_001670675.1.886 WP_001670675.1.88609 WP_001670675.1.88620 WP_001670675.1.88624 WP_001670675.1.88647 WP_001670675.1.88648 WP_001670675.1.88651 WP_001670675.1.88683 WP_001670675.1.88692 WP_001670675.1.88698 WP_001670675.1.88703 WP_001670675.1.88707 WP_001670675.1.88727 WP_001670675.1.88731 WP_001670675.1.88762 WP_001670675.1.88772 WP_001670675.1.88792 WP_001670675.1.88817 WP_001670675.1.88850 WP_001670675.1.88854 WP_001670675.1.8889 WP_001670675.1.88892 WP_001670675.1.88894 WP_001670675.1.88902 WP_001670675.1.8891 WP_001670675.1.88942 WP_001670675.1.88957 WP_001670675.1.88966 WP_001670675.1.88967 WP_001670675.1.88968 WP_001670675.1.88970 WP_001670675.1.88980 WP_001670675.1.88981 WP_001670675.1.88982 WP_001670675.1.88995 WP_001670675.1.88998 WP_001670675.1.89008 WP_001670675.1.89054 WP_001670675.1.89114 WP_001670675.1.89116 WP_001670675.1.89119 WP_001670675.1.89120 WP_001670675.1.89138 WP_001670675.1.89174 WP_001670675.1.89177 WP_001670675.1.89182 WP_001670675.1.89188 WP_001670675.1.89215 WP_001670675.1.89221 WP_001670675.1.89291 WP_001670675.1.89298 WP_001670675.1.89304 WP_001670675.1.89308 WP_001670675.1.89311 WP_001670675.1.89314 WP_001670675.1.89328 WP_001670675.1.89332 WP_001670675.1.89343 WP_001670675.1.89354 WP_001670675.1.89362 WP_001670675.1.89395 WP_001670675.1.8940 WP_001670675.1.89408 WP_001670675.1.89425 WP_001670675.1.89449 WP_001670675.1.89452 WP_001670675.1.89462 WP_001670675.1.8947 WP_001670675.1.89503 WP_001670675.1.89512 WP_001670675.1.89527 WP_001670675.1.89570 WP_001670675.1.8958 WP_001670675.1.89580 WP_001670675.1.89591 WP_001670675.1.89604 WP_001670675.1.89606 WP_001670675.1.8961 WP_001670675.1.89612 WP_001670675.1.89622 WP_001670675.1.89632 WP_001670675.1.89634 WP_001670675.1.89647 WP_001670675.1.89657 WP_001670675.1.89659 WP_001670675.1.89668 WP_001670675.1.89680 WP_001670675.1.89706 WP_001670675.1.89713 WP_001670675.1.89733 WP_001670675.1.89764 WP_001670675.1.89765 WP_001670675.1.89777 WP_001670675.1.89789 WP_001670675.1.89796 WP_001670675.1.89804 WP_001670675.1.89815 WP_001670675.1.89817 WP_001670675.1.89832 WP_001670675.1.89845 WP_001670675.1.89870 WP_001670675.1.89888 WP_001670675.1.89902 WP_001670675.1.89911 WP_001670675.1.89940 WP_001670675.1.8995 WP_001670675.1.89952 WP_001670675.1.8996 WP_001670675.1.89965 WP_001670675.1.89975 WP_001670675.1.90007 WP_001670675.1.9002 WP_001670675.1.9003 WP_001670675.1.90033 WP_001670675.1.90084 WP_001670675.1.90097 WP_001670675.1.90108 WP_001670675.1.9011 WP_001670675.1.90193 WP_001670675.1.90196 WP_001670675.1.90240 WP_001670675.1.90248 WP_001670675.1.90252 WP_001670675.1.90274 WP_001670675.1.90280 WP_001670675.1.90311 WP_001670675.1.90330 WP_001670675.1.90338 WP_001670675.1.90348 WP_001670675.1.90363 WP_001670675.1.90365 WP_001670675.1.90409 WP_001670675.1.90417 WP_001670675.1.90421 WP_001670675.1.90428 WP_001670675.1.90440 WP_001670675.1.90453 WP_001670675.1.90458 WP_001670675.1.90472 WP_001670675.1.90489 WP_001670675.1.90513 WP_001670675.1.90522 WP_001670675.1.90540 WP_001670675.1.90557 WP_001670675.1.90563 WP_001670675.1.90582 WP_001670675.1.90585 WP_001670675.1.90620 WP_001670675.1.90625 WP_001670675.1.9064 WP_001670675.1.90641 WP_001670675.1.90686 WP_001670675.1.90701 WP_001670675.1.90713 WP_001670675.1.90734 WP_001670675.1.90748 WP_001670675.1.90759 WP_001670675.1.90792 WP_001670675.1.90794 WP_001670675.1.90796 WP_001670675.1.90811 WP_001670675.1.90814 WP_001670675.1.90859 WP_001670675.1.90866 WP_001670675.1.90876 WP_001670675.1.9091 WP_001670675.1.9093 WP_001670675.1.90959 WP_001670675.1.90973 WP_001670675.1.90983 WP_001670675.1.90984 WP_001670675.1.91003 WP_001670675.1.91042 WP_001670675.1.91049 WP_001670675.1.91056 WP_001670675.1.91067 WP_001670675.1.91069 WP_001670675.1.91156 WP_001670675.1.91164 WP_001670675.1.91179 WP_001670675.1.91189 WP_001670675.1.91205 WP_001670675.1.91215 WP_001670675.1.91239 WP_001670675.1.91278 WP_001670675.1.91282 WP_001670675.1.91291 WP_001670675.1.9131 WP_001670675.1.91312 WP_001670675.1.91313 WP_001670675.1.91331 WP_001670675.1.91334 WP_001670675.1.9135 WP_001670675.1.9137 WP_001670675.1.91372 WP_001670675.1.91424 WP_001670675.1.91459 WP_001670675.1.91470 WP_001670675.1.91474 WP_001670675.1.91493 WP_001670675.1.91505 WP_001670675.1.91506 WP_001670675.1.91512 WP_001670675.1.91524 WP_001670675.1.91528 WP_001670675.1.91557 WP_001670675.1.91564 WP_001670675.1.91579 WP_001670675.1.91580 WP_001670675.1.91597 WP_001670675.1.91621 WP_001670675.1.91625 WP_001670675.1.91628 WP_001670675.1.91655 WP_001670675.1.9166 WP_001670675.1.91702 WP_001670675.1.91715 WP_001670675.1.91724 WP_001670675.1.91732 WP_001670675.1.91736 WP_001670675.1.91742 WP_001670675.1.91772 WP_001670675.1.91776 WP_001670675.1.91788 WP_001670675.1.91795 WP_001670675.1.91806 WP_001670675.1.91864 WP_001670675.1.9187 WP_001670675.1.91870 WP_001670675.1.91880 WP_001670675.1.91898 WP_001670675.1.91904 WP_001670675.1.91974 WP_001670675.1.92013 WP_001670675.1.92018 WP_001670675.1.92047 WP_001670675.1.92060 WP_001670675.1.92067 WP_001670675.1.92082 WP_001670675.1.92087 WP_001670675.1.92093 WP_001670675.1.92098 WP_001670675.1.92099 WP_001670675.1.92108 WP_001670675.1.92122 WP_001670675.1.92129 WP_001670675.1.92156 WP_001670675.1.92165 WP_001670675.1.92171 WP_001670675.1.92172 WP_001670675.1.92183 WP_001670675.1.92208 WP_001670675.1.92213 WP_001670675.1.9222 WP_001670675.1.92240 WP_001670675.1.92243 WP_001670675.1.92268 WP_001670675.1.92299 WP_001670675.1.92310 WP_001670675.1.92318 WP_001670675.1.92327 WP_001670675.1.92375 WP_001670675.1.92394 WP_001670675.1.92399 WP_001670675.1.92408 WP_001670675.1.92411 WP_001670675.1.92439 WP_001670675.1.92443 WP_001670675.1.92452 WP_001670675.1.92470 WP_001670675.1.92477 WP_001670675.1.92482 WP_001670675.1.92529 WP_001670675.1.92531 WP_001670675.1.92545 WP_001670675.1.92557 WP_001670675.1.92562 WP_001670675.1.92570 WP_001670675.1.92575 WP_001670675.1.92588 WP_001670675.1.926 WP_001670675.1.92628 WP_001670675.1.92633 WP_001670675.1.92646 WP_001670675.1.92649 WP_001670675.1.92659 WP_001670675.1.92669 WP_001670675.1.92671 WP_001670675.1.92676 WP_001670675.1.92705 WP_001670675.1.9271 WP_001670675.1.92729 WP_001670675.1.92734 WP_001670675.1.92738 WP_001670675.1.92754 WP_001670675.1.92786 WP_001670675.1.92806 WP_001670675.1.92810 WP_001670675.1.92823 WP_001670675.1.92827 WP_001670675.1.92832 WP_001670675.1.92842 WP_001670675.1.92875 WP_001670675.1.92879 WP_001670675.1.92890 WP_001670675.1.92893 WP_001670675.1.92895 WP_001670675.1.92926 WP_001670675.1.92929 WP_001670675.1.92936 WP_001670675.1.92939 WP_001670675.1.92975 WP_001670675.1.92987 WP_001670675.1.92988 WP_001670675.1.93007 WP_001670675.1.93022 WP_001670675.1.93059 WP_001670675.1.93061 WP_001670675.1.93076 WP_001670675.1.93086 WP_001670675.1.93101 WP_001670675.1.93103 WP_001670675.1.93105 WP_001670675.1.93111 WP_001670675.1.93118 WP_001670675.1.93121 WP_001670675.1.93136 WP_001670675.1.93155 WP_001670675.1.93168 WP_001670675.1.93184 WP_001670675.1.93213 WP_001670675.1.93215 WP_001670675.1.93221 WP_001670675.1.93223 WP_001670675.1.93239 WP_001670675.1.93275 WP_001670675.1.93302 WP_001670675.1.93322 WP_001670675.1.93339 WP_001670675.1.93350 WP_001670675.1.9336 WP_001670675.1.93365 WP_001670675.1.93376 WP_001670675.1.93387 WP_001670675.1.93410 WP_001670675.1.93469 WP_001670675.1.93511 WP_001670675.1.93512 WP_001670675.1.93524 WP_001670675.1.93543 WP_001670675.1.93577 WP_001670675.1.93596 WP_001670675.1.93604 WP_001670675.1.93635 WP_001670675.1.93650 WP_001670675.1.93656 WP_001670675.1.93657 WP_001670675.1.93662 WP_001670675.1.93691 WP_001670675.1.937 WP_001670675.1.93705 WP_001670675.1.9374 WP_001670675.1.93741 WP_001670675.1.9375 WP_001670675.1.93754 WP_001670675.1.93761 WP_001670675.1.93780 WP_001670675.1.9380 WP_001670675.1.93803 WP_001670675.1.93804 WP_001670675.1.93809 WP_001670675.1.93828 WP_001670675.1.93837 WP_001670675.1.93842 WP_001670675.1.93843 WP_001670675.1.93875 WP_001670675.1.9389 WP_001670675.1.93909 WP_001670675.1.93919 WP_001670675.1.93937 WP_001670675.1.93938 WP_001670675.1.93956 WP_001670675.1.93984 WP_001670675.1.93986 WP_001670675.1.9399 WP_001670675.1.93994 WP_001670675.1.94017 WP_001670675.1.94039 WP_001670675.1.94064 WP_001670675.1.94070 WP_001670675.1.94071 WP_001670675.1.94072 WP_001670675.1.94079 WP_001670675.1.94097 WP_001670675.1.94107 WP_001670675.1.94132 WP_001670675.1.94142 WP_001670675.1.94162 WP_001670675.1.94168 WP_001670675.1.94181 WP_001670675.1.94198 WP_001670675.1.94215 WP_001670675.1.94303 WP_001670675.1.9432 WP_001670675.1.94352 WP_001670675.1.94354 WP_001670675.1.94365 WP_001670675.1.94380 WP_001670675.1.94383 WP_001670675.1.94390 WP_001670675.1.9440 WP_001670675.1.94412 WP_001670675.1.94415 WP_001670675.1.94458 WP_001670675.1.94473 WP_001670675.1.94492 WP_001670675.1.94510 WP_001670675.1.94527 WP_001670675.1.94565 WP_001670675.1.94573 WP_001670675.1.94579 WP_001670675.1.94584 WP_001670675.1.94586 WP_001670675.1.94593 WP_001670675.1.94598 WP_001670675.1.94622 WP_001670675.1.9463 WP_001670675.1.94649 WP_001670675.1.94650 WP_001670675.1.94655 WP_001670675.1.94659 WP_001670675.1.94662 WP_001670675.1.94669 WP_001670675.1.94670 WP_001670675.1.94674 WP_001670675.1.94700 WP_001670675.1.94717 WP_001670675.1.94745 WP_001670675.1.94782 WP_001670675.1.94785 WP_001670675.1.94796 WP_001670675.1.94798 WP_001670675.1.9481 WP_001670675.1.94815 WP_001670675.1.94817 WP_001670675.1.94820 WP_001670675.1.94835 WP_001670675.1.94849 WP_001670675.1.94850 WP_001670675.1.94851 WP_001670675.1.94864 WP_001670675.1.94947 WP_001670675.1.94952 WP_001670675.1.94959 WP_001670675.1.94967 WP_001670675.1.94982 WP_001670675.1.94983 WP_001670675.1.94987 WP_001670675.1.95006 WP_001670675.1.9503 WP_001670675.1.95051 WP_001670675.1.95055 WP_001670675.1.95076 WP_001670675.1.95085 WP_001670675.1.95094 WP_001670675.1.95099 WP_001670675.1.95121 WP_001670675.1.95133 WP_001670675.1.95136 WP_001670675.1.95152 WP_001670675.1.9516 WP_001670675.1.95165 WP_001670675.1.95171 WP_001670675.1.95235 WP_001670675.1.95239 WP_001670675.1.95246 WP_001670675.1.95248 WP_001670675.1.95249 WP_001670675.1.9525 WP_001670675.1.95255 WP_001670675.1.95265 WP_001670675.1.9527 WP_001670675.1.95277 WP_001670675.1.95282 WP_001670675.1.95289 WP_001670675.1.95298 WP_001670675.1.9530 WP_001670675.1.95320 WP_001670675.1.95338 WP_001670675.1.95388 WP_001670675.1.95404 WP_001670675.1.95412 WP_001670675.1.95434 WP_001670675.1.95447 WP_001670675.1.95456 WP_001670675.1.95530 WP_001670675.1.95546 WP_001670675.1.95547 WP_001670675.1.95558 WP_001670675.1.95579 WP_001670675.1.95590 WP_001670675.1.95607 WP_001670675.1.95623 WP_001670675.1.95625 WP_001670675.1.95630 WP_001670675.1.95641 WP_001670675.1.95656 WP_001670675.1.95670 WP_001670675.1.95675 WP_001670675.1.95691 WP_001670675.1.95701 WP_001670675.1.95703 WP_001670675.1.95716 WP_001670675.1.95729 WP_001670675.1.9574 WP_001670675.1.95744 WP_001670675.1.95757 WP_001670675.1.95776 WP_001670675.1.95805 WP_001670675.1.95826 WP_001670675.1.95840 WP_001670675.1.9586 WP_001670675.1.95866 WP_001670675.1.95884 WP_001670675.1.95890 WP_001670675.1.95906 WP_001670675.1.95911 WP_001670675.1.95939 WP_001670675.1.95940 WP_001670675.1.95963 WP_001670675.1.96004 WP_001670675.1.96025 WP_001670675.1.96042 WP_001670675.1.96044 WP_001670675.1.96045 WP_001670675.1.96054 WP_001670675.1.9609 WP_001670675.1.96094 WP_001670675.1.96107 WP_001670675.1.96127 WP_001670675.1.96139 WP_001670675.1.96144 WP_001670675.1.96162 WP_001670675.1.96172 WP_001670675.1.96188 WP_001670675.1.96190 WP_001670675.1.96203 WP_001670675.1.96206 WP_001670675.1.96211 WP_001670675.1.96212 WP_001670675.1.9624 WP_001670675.1.96260 WP_001670675.1.9628 WP_001670675.1.96317 WP_001670675.1.96319 WP_001670675.1.9633 WP_001670675.1.96335 WP_001670675.1.96340 WP_001670675.1.96343 WP_001670675.1.96348 WP_001670675.1.96349 WP_001670675.1.96359 WP_001670675.1.96380 WP_001670675.1.96429 WP_001670675.1.9644 WP_001670675.1.96469 WP_001670675.1.96490 WP_001670675.1.96497 WP_001670675.1.96500 WP_001670675.1.96521 WP_001670675.1.96533 WP_001670675.1.96537 WP_001670675.1.96539 WP_001670675.1.96552 WP_001670675.1.96555 WP_001670675.1.96563 WP_001670675.1.96584 WP_001670675.1.96588 WP_001670675.1.96590 WP_001670675.1.96600 WP_001670675.1.96610 WP_001670675.1.96625 WP_001670675.1.96635 WP_001670675.1.9664 WP_001670675.1.96640 WP_001670675.1.96642 WP_001670675.1.96662 WP_001670675.1.96675 WP_001670675.1.9670 WP_001670675.1.96731 WP_001670675.1.96732 WP_001670675.1.96735 WP_001670675.1.9674 WP_001670675.1.96750 WP_001670675.1.96761 WP_001670675.1.96771 WP_001670675.1.96792 WP_001670675.1.96798 WP_001670675.1.96801 WP_001670675.1.96803 WP_001670675.1.96810 WP_001670675.1.9686 WP_001670675.1.96876 WP_001670675.1.96890 WP_001670675.1.96902 WP_001670675.1.96917 WP_001670675.1.96925 WP_001670675.1.96938 WP_001670675.1.96946 WP_001670675.1.96957 WP_001670675.1.96978 WP_001670675.1.96993 WP_001670675.1.97015 WP_001670675.1.97026 WP_001670675.1.97028 WP_001670675.1.97043 WP_001670675.1.97047 WP_001670675.1.97079 WP_001670675.1.97089 WP_001670675.1.97103 WP_001670675.1.97109 WP_001670675.1.97143 WP_001670675.1.97145 WP_001670675.1.97154 WP_001670675.1.97184 WP_001670675.1.97185 WP_001670675.1.97190 WP_001670675.1.97224 WP_001670675.1.97260 WP_001670675.1.97287 WP_001670675.1.97291 WP_001670675.1.97297 WP_001670675.1.97318 WP_001670675.1.97322 WP_001670675.1.97328 WP_001670675.1.97337 WP_001670675.1.97368 WP_001670675.1.97369 WP_001670675.1.97386 WP_001670675.1.97413 WP_001670675.1.97422 WP_001670675.1.97441 WP_001670675.1.97477 WP_001670675.1.97480 WP_001670675.1.97487 WP_001670675.1.97497 WP_001670675.1.97505 WP_001670675.1.97534 WP_001670675.1.97547 WP_001670675.1.97594 WP_001670675.1.97597 WP_001670675.1.97599 WP_001670675.1.97606 WP_001670675.1.97613 WP_001670675.1.97615 WP_001670675.1.97620 WP_001670675.1.97626 WP_001670675.1.97628 WP_001670675.1.97631 WP_001670675.1.97640 WP_001670675.1.97646 WP_001670675.1.97648 WP_001670675.1.97656 WP_001670675.1.97690 WP_001670675.1.97691 WP_001670675.1.97693 WP_001670675.1.97704 WP_001670675.1.97725 WP_001670675.1.97726 WP_001670675.1.97727 WP_001670675.1.97732 WP_001670675.1.97736 WP_001670675.1.9774 WP_001670675.1.9775 WP_001670675.1.97768 WP_001670675.1.97772 WP_001670675.1.97800 WP_001670675.1.97819 WP_001670675.1.97840 WP_001670675.1.97846 WP_001670675.1.97873 WP_001670675.1.97907 WP_001670675.1.9793 WP_001670675.1.97938 WP_001670675.1.97981 WP_001670675.1.97986 WP_001670675.1.9799 WP_001670675.1.97991 WP_001670675.1.98006 WP_001670675.1.98019 WP_001670675.1.98022 WP_001670675.1.98036 WP_001670675.1.9805 WP_001670675.1.98080 WP_001670675.1.98086 WP_001670675.1.98107 WP_001670675.1.9811 WP_001670675.1.98110 WP_001670675.1.98119 WP_001670675.1.98124 WP_001670675.1.98146 WP_001670675.1.98158 WP_001670675.1.98170 WP_001670675.1.98201 WP_001670675.1.98219 WP_001670675.1.98236 WP_001670675.1.98250 WP_001670675.1.9826 WP_001670675.1.98263 WP_001670675.1.98314 WP_001670675.1.98338 WP_001670675.1.98392 WP_001670675.1.98402 WP_001670675.1.9841 WP_001670675.1.98418 WP_001670675.1.98438 WP_001670675.1.98440 WP_001670675.1.98446 WP_001670675.1.98448 WP_001670675.1.98457 WP_001670675.1.98472 WP_001670675.1.98483 WP_001670675.1.98495 WP_001670675.1.9850 WP_001670675.1.98502 WP_001670675.1.98513 WP_001670675.1.98531 WP_001670675.1.98551 WP_001670675.1.98570 WP_001670675.1.98577 WP_001670675.1.98607 WP_001670675.1.98608 WP_001670675.1.98627 WP_001670675.1.9863 WP_001670675.1.98634 WP_001670675.1.98676 WP_001670675.1.98677 WP_001670675.1.98726 WP_001670675.1.98731 WP_001670675.1.98760 WP_001670675.1.98762 WP_001670675.1.98763 WP_001670675.1.9877 WP_001670675.1.98779 WP_001670675.1.98801 WP_001670675.1.98818 WP_001670675.1.98843 WP_001670675.1.98899 WP_001670675.1.98947 WP_001670675.1.9898 WP_001670675.1.9899 WP_001670675.1.99040 WP_001670675.1.99057 WP_001670675.1.99071 WP_001670675.1.99072 WP_001670675.1.99073 WP_001670675.1.99097 WP_001670675.1.99098 WP_001670675.1.99107 WP_001670675.1.99163 WP_001670675.1.99164 WP_001670675.1.99184 WP_001670675.1.9919 WP_001670675.1.99197 WP_001670675.1.99215 WP_001670675.1.99219 WP_001670675.1.99255 WP_001670675.1.99267 WP_001670675.1.99276 WP_001670675.1.99278 WP_001670675.1.99327 WP_001670675.1.99335 WP_001670675.1.99339 WP_001670675.1.99350 WP_001670675.1.99360 WP_001670675.1.99363 WP_001670675.1.99369 WP_001670675.1.99388 WP_001670675.1.99397 WP_001670675.1.99456 WP_001670675.1.99463 WP_001670675.1.99483 WP_001670675.1.99490 WP_001670675.1.99493 WP_001670675.1.99531 WP_001670675.1.9954 WP_001670675.1.99546 WP_001670675.1.99561 WP_001670675.1.99577 WP_001670675.1.99579 WP_001670675.1.99595 WP_001670675.1.99613 WP_001670675.1.99626 WP_001670675.1.99630 WP_001670675.1.99646 WP_001670675.1.99657 WP_001670675.1.99660 WP_001670675.1.99671 WP_001670675.1.99676 WP_001670675.1.99712 WP_001670675.1.99725 WP_001670675.1.99747 WP_001670675.1.99764 WP_001670675.1.99783 WP_001670675.1.99813 WP_001670675.1.99824 WP_001670675.1.99829 WP_001670675.1.99837 WP_001670675.1.99841 WP_001670675.1.99858 WP_001670675.1.99889 WP_001670675.1.9992 WP_001670675.1.99924 WP_001670675.1.99958 WP_001670675.1.99961 WP_001670675.1.99996 gi|16763647|ref|NP_459262.1| gi|197363544|ref|YP_002143181.1| gi|16759250|ref|NP_454867.1| gi|482905218|ref|YP_007903778.1| 209261.t2601 220341.STY0285 295319.SPA2505 550537.SEN0266 550538.SG0262 554290.SSPA2336 99287.STM0264 gi|559997021|ref|YP_008250399.2| gi|207855776|ref|YP_002242427.1| gi|29142975|ref|NP_806317.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]