SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378448590|ref|YP_005235949.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378448590|ref|YP_005235949.1|
Domain Number 1 Region: 4-158
Classification Level Classification E-value
Superfamily Hcp1-like 3.29e-73
Family SCOPe 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|378448590|ref|YP_005235949.1|
Sequence length 161
Comment putative cytoplasmic protein [Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S]
Sequence
MSYDIFLKIDGIDGESMDDKHKNEIEVLSWRWNIHQESTMHAGSGLGSGKVSVTNLSFEH
YIDRASPNLFKYCSSGKHIPQAILVMRKAGGNPLEYLKYTFTDLIIAMVSPSGSQGGEIA
SRESIELSFSTVKQEYVVQNQQGGSGGTITAGYDFKANKEI
Download sequence
Identical sequences A0A0F6AX81 A0A0F7DHU5 A0A0H3BNU5 A0A0H3N8E4 A0A0M0PMZ4 A0A0R9MBY7 A0A0U1FW47 A0A0V2F0H0 A0A1X2UIJ6 A0A221YUT2 A0A221Z3Q0 A0A265B9N7 A0A267S9D0 A0A2C6G9X6 A0A2D1XHB9 A0A2D3AL84 A0A2G1P1P1 A0A2H9YBY1 A0A2I6P7J4 A0A2K2ZQ02 E8XIU4 G4C4L2 H9L4J8 Q93IS3 S5HIB5 V1XBI9 V7UMR3
gi|378982815|ref|YP_005245970.1| ABAK02000001|CDS_4471148-4471633 ABAM02000001|CDS_819874-820359 ABAO01000023|CDS_6274-6759 ABEI01000010|CDS_23709-24194 ABEL01000001|CDS_24291-24776 ABEW01000005|CDS_24668-25153 ABFF01000003|CDS_376138-375653 ABFG01000003|CDS_419160-418675 AE006468|CDS_318679-319164 CP001113|CDS_320859-321344 CP001120|CDS_326646-327131 CP001363|CDS_319364-319849 FN424405|CDS_318650-319135 NZ_ACBF01000032|CDS_14591-14106 gi|550899693|ref|YP_008668785.1| gi|525827693|ref|YP_008250384.1| gi|525839274|ref|YP_008256548.1| gi|482905203|ref|YP_007903763.1| gi|194443822|ref|YP_002039513.1| gi|409248701|ref|YP_006884541.1| gi|383495095|ref|YP_005395784.1| gi|525856679|ref|YP_008259522.1| gi|549478373|ref|YP_008612121.1| gi|194450289|ref|YP_002044262.1| gi|549722997|ref|YP_008643187.1| gi|16763662|ref|NP_459277.1| gi|378448590|ref|YP_005235949.1| gi|528817983|ref|YP_008359186.1| gi|379699495|ref|YP_005241223.1| APC22929 gi|378443725|ref|YP_005231357.1| gi|386590164|ref|YP_006086564.1| 5xeu_A 5xeu_B 5xeu_C 5xeu_D 5xeu_E 5xeu_F gi|378698251|ref|YP_005180208.1| gi|526219213|ref|YP_008264531.1| NP_459277.1.58477 WP_000119443.1.100010 WP_000119443.1.100031 WP_000119443.1.100129 WP_000119443.1.100165 WP_000119443.1.1002 WP_000119443.1.100234 WP_000119443.1.100258 WP_000119443.1.100266 WP_000119443.1.100376 WP_000119443.1.100424 WP_000119443.1.100432 WP_000119443.1.100438 WP_000119443.1.100484 WP_000119443.1.100502 WP_000119443.1.100521 WP_000119443.1.100584 WP_000119443.1.100589 WP_000119443.1.100650 WP_000119443.1.100711 WP_000119443.1.100730 WP_000119443.1.10074 WP_000119443.1.10076 WP_000119443.1.100793 WP_000119443.1.100865 WP_000119443.1.100871 WP_000119443.1.100882 WP_000119443.1.100944 WP_000119443.1.100948 WP_000119443.1.101007 WP_000119443.1.101020 WP_000119443.1.101042 WP_000119443.1.101074 WP_000119443.1.101078 WP_000119443.1.101091 WP_000119443.1.101094 WP_000119443.1.101123 WP_000119443.1.101126 WP_000119443.1.101180 WP_000119443.1.101199 WP_000119443.1.101259 WP_000119443.1.101284 WP_000119443.1.101291 WP_000119443.1.1013 WP_000119443.1.101353 WP_000119443.1.101386 WP_000119443.1.101404 WP_000119443.1.101420 WP_000119443.1.101454 WP_000119443.1.101473 WP_000119443.1.101519 WP_000119443.1.101589 WP_000119443.1.101612 WP_000119443.1.101636 WP_000119443.1.101724 WP_000119443.1.101741 WP_000119443.1.101815 WP_000119443.1.101839 WP_000119443.1.101841 WP_000119443.1.101878 WP_000119443.1.101949 WP_000119443.1.101953 WP_000119443.1.101975 WP_000119443.1.102103 WP_000119443.1.10220 WP_000119443.1.10231 WP_000119443.1.10237 WP_000119443.1.10266 WP_000119443.1.10276 WP_000119443.1.10394 WP_000119443.1.10429 WP_000119443.1.10439 WP_000119443.1.10521 WP_000119443.1.10562 WP_000119443.1.10566 WP_000119443.1.10675 WP_000119443.1.10678 WP_000119443.1.10711 WP_000119443.1.10720 WP_000119443.1.10753 WP_000119443.1.10992 WP_000119443.1.11000 WP_000119443.1.11098 WP_000119443.1.1110 WP_000119443.1.11156 WP_000119443.1.11168 WP_000119443.1.11190 WP_000119443.1.11213 WP_000119443.1.11254 WP_000119443.1.11304 WP_000119443.1.1137 WP_000119443.1.11405 WP_000119443.1.11455 WP_000119443.1.11518 WP_000119443.1.11532 WP_000119443.1.11543 WP_000119443.1.11544 WP_000119443.1.11565 WP_000119443.1.11588 WP_000119443.1.11677 WP_000119443.1.11687 WP_000119443.1.11735 WP_000119443.1.11763 WP_000119443.1.11772 WP_000119443.1.11834 WP_000119443.1.11865 WP_000119443.1.11875 WP_000119443.1.11897 WP_000119443.1.11936 WP_000119443.1.11964 WP_000119443.1.12007 WP_000119443.1.12017 WP_000119443.1.12025 WP_000119443.1.12114 WP_000119443.1.12159 WP_000119443.1.12160 WP_000119443.1.12370 WP_000119443.1.12396 WP_000119443.1.12456 WP_000119443.1.12472 WP_000119443.1.12484 WP_000119443.1.12546 WP_000119443.1.12701 WP_000119443.1.12864 WP_000119443.1.12879 WP_000119443.1.12936 WP_000119443.1.12995 WP_000119443.1.13027 WP_000119443.1.13101 WP_000119443.1.13130 WP_000119443.1.13207 WP_000119443.1.13311 WP_000119443.1.13414 WP_000119443.1.13446 WP_000119443.1.13488 WP_000119443.1.13509 WP_000119443.1.13543 WP_000119443.1.13661 WP_000119443.1.13669 WP_000119443.1.13741 WP_000119443.1.13764 WP_000119443.1.13819 WP_000119443.1.13848 WP_000119443.1.13857 WP_000119443.1.1387 WP_000119443.1.13908 WP_000119443.1.13968 WP_000119443.1.14001 WP_000119443.1.14041 WP_000119443.1.14050 WP_000119443.1.14056 WP_000119443.1.14111 WP_000119443.1.14151 WP_000119443.1.14239 WP_000119443.1.14320 WP_000119443.1.14369 WP_000119443.1.14379 WP_000119443.1.14406 WP_000119443.1.14410 WP_000119443.1.14436 WP_000119443.1.14458 WP_000119443.1.14495 WP_000119443.1.14519 WP_000119443.1.14524 WP_000119443.1.14618 WP_000119443.1.14706 WP_000119443.1.14725 WP_000119443.1.14737 WP_000119443.1.14789 WP_000119443.1.14852 WP_000119443.1.14884 WP_000119443.1.1489 WP_000119443.1.14932 WP_000119443.1.15046 WP_000119443.1.15055 WP_000119443.1.15079 WP_000119443.1.15100 WP_000119443.1.15102 WP_000119443.1.15124 WP_000119443.1.15223 WP_000119443.1.15316 WP_000119443.1.15353 WP_000119443.1.1540 WP_000119443.1.15483 WP_000119443.1.15508 WP_000119443.1.1551 WP_000119443.1.15586 WP_000119443.1.15612 WP_000119443.1.15625 WP_000119443.1.15627 WP_000119443.1.15644 WP_000119443.1.15708 WP_000119443.1.15784 WP_000119443.1.158 WP_000119443.1.15830 WP_000119443.1.15835 WP_000119443.1.15862 WP_000119443.1.15881 WP_000119443.1.15909 WP_000119443.1.15910 WP_000119443.1.1592 WP_000119443.1.15986 WP_000119443.1.15995 WP_000119443.1.16004 WP_000119443.1.1601 WP_000119443.1.16028 WP_000119443.1.16047 WP_000119443.1.16062 WP_000119443.1.16063 WP_000119443.1.16103 WP_000119443.1.1611 WP_000119443.1.16125 WP_000119443.1.16166 WP_000119443.1.16172 WP_000119443.1.16226 WP_000119443.1.16233 WP_000119443.1.16331 WP_000119443.1.1635 WP_000119443.1.16361 WP_000119443.1.16468 WP_000119443.1.16525 WP_000119443.1.16551 WP_000119443.1.16565 WP_000119443.1.16581 WP_000119443.1.16614 WP_000119443.1.16650 WP_000119443.1.1668 WP_000119443.1.16686 WP_000119443.1.167 WP_000119443.1.16732 WP_000119443.1.16735 WP_000119443.1.16736 WP_000119443.1.16846 WP_000119443.1.16855 WP_000119443.1.16858 WP_000119443.1.16873 WP_000119443.1.1689 WP_000119443.1.16896 WP_000119443.1.16903 WP_000119443.1.16916 WP_000119443.1.16941 WP_000119443.1.16965 WP_000119443.1.16998 WP_000119443.1.1700 WP_000119443.1.17031 WP_000119443.1.17093 WP_000119443.1.17098 WP_000119443.1.17188 WP_000119443.1.17285 WP_000119443.1.17307 WP_000119443.1.1737 WP_000119443.1.174 WP_000119443.1.17447 WP_000119443.1.1749 WP_000119443.1.17693 WP_000119443.1.17702 WP_000119443.1.17703 WP_000119443.1.17705 WP_000119443.1.17743 WP_000119443.1.17755 WP_000119443.1.17891 WP_000119443.1.1798 WP_000119443.1.17991 WP_000119443.1.18019 WP_000119443.1.18022 WP_000119443.1.1807 WP_000119443.1.18089 WP_000119443.1.18111 WP_000119443.1.18122 WP_000119443.1.1814 WP_000119443.1.18163 WP_000119443.1.18177 WP_000119443.1.18178 WP_000119443.1.1818 WP_000119443.1.18192 WP_000119443.1.1825 WP_000119443.1.18254 WP_000119443.1.18265 WP_000119443.1.18281 WP_000119443.1.18282 WP_000119443.1.18468 WP_000119443.1.18485 WP_000119443.1.18607 WP_000119443.1.18692 WP_000119443.1.18715 WP_000119443.1.18776 WP_000119443.1.18822 WP_000119443.1.18940 WP_000119443.1.18949 WP_000119443.1.1897 WP_000119443.1.18972 WP_000119443.1.19030 WP_000119443.1.19038 WP_000119443.1.19053 WP_000119443.1.19055 WP_000119443.1.19273 WP_000119443.1.19291 WP_000119443.1.19320 WP_000119443.1.19357 WP_000119443.1.19458 WP_000119443.1.19461 WP_000119443.1.19588 WP_000119443.1.19614 WP_000119443.1.19616 WP_000119443.1.19642 WP_000119443.1.19683 WP_000119443.1.19706 WP_000119443.1.19724 WP_000119443.1.19749 WP_000119443.1.19784 WP_000119443.1.19809 WP_000119443.1.19851 WP_000119443.1.1990 WP_000119443.1.19975 WP_000119443.1.1998 WP_000119443.1.20 WP_000119443.1.20089 WP_000119443.1.20212 WP_000119443.1.20218 WP_000119443.1.20266 WP_000119443.1.20271 WP_000119443.1.20330 WP_000119443.1.2036 WP_000119443.1.20391 WP_000119443.1.20443 WP_000119443.1.20446 WP_000119443.1.20488 WP_000119443.1.20503 WP_000119443.1.20525 WP_000119443.1.2054 WP_000119443.1.20553 WP_000119443.1.20614 WP_000119443.1.20626 WP_000119443.1.20646 WP_000119443.1.20695 WP_000119443.1.20789 WP_000119443.1.20862 WP_000119443.1.20886 WP_000119443.1.20900 WP_000119443.1.20908 WP_000119443.1.2101 WP_000119443.1.21049 WP_000119443.1.21075 WP_000119443.1.21086 WP_000119443.1.21089 WP_000119443.1.21136 WP_000119443.1.21165 WP_000119443.1.21245 WP_000119443.1.21246 WP_000119443.1.21286 WP_000119443.1.21351 WP_000119443.1.21399 WP_000119443.1.21400 WP_000119443.1.21404 WP_000119443.1.21443 WP_000119443.1.21453 WP_000119443.1.21497 WP_000119443.1.21499 WP_000119443.1.21548 WP_000119443.1.21603 WP_000119443.1.21692 WP_000119443.1.21750 WP_000119443.1.21751 WP_000119443.1.21825 WP_000119443.1.21845 WP_000119443.1.21940 WP_000119443.1.21981 WP_000119443.1.21991 WP_000119443.1.22019 WP_000119443.1.22024 WP_000119443.1.2205 WP_000119443.1.22062 WP_000119443.1.22117 WP_000119443.1.22205 WP_000119443.1.2221 WP_000119443.1.22235 WP_000119443.1.22240 WP_000119443.1.22315 WP_000119443.1.22323 WP_000119443.1.22337 WP_000119443.1.2235 WP_000119443.1.22427 WP_000119443.1.22453 WP_000119443.1.22485 WP_000119443.1.22514 WP_000119443.1.22537 WP_000119443.1.22565 WP_000119443.1.22575 WP_000119443.1.22582 WP_000119443.1.22604 WP_000119443.1.22620 WP_000119443.1.22676 WP_000119443.1.22692 WP_000119443.1.22758 WP_000119443.1.22845 WP_000119443.1.22864 WP_000119443.1.22979 WP_000119443.1.23010 WP_000119443.1.23114 WP_000119443.1.2314 WP_000119443.1.23148 WP_000119443.1.23155 WP_000119443.1.23172 WP_000119443.1.23175 WP_000119443.1.23192 WP_000119443.1.23259 WP_000119443.1.23279 WP_000119443.1.23309 WP_000119443.1.23311 WP_000119443.1.23343 WP_000119443.1.23379 WP_000119443.1.23460 WP_000119443.1.23472 WP_000119443.1.23482 WP_000119443.1.23500 WP_000119443.1.23503 WP_000119443.1.23509 WP_000119443.1.23513 WP_000119443.1.23529 WP_000119443.1.23587 WP_000119443.1.23634 WP_000119443.1.23639 WP_000119443.1.2364 WP_000119443.1.23646 WP_000119443.1.237 WP_000119443.1.23707 WP_000119443.1.23720 WP_000119443.1.23736 WP_000119443.1.23755 WP_000119443.1.2376 WP_000119443.1.2380 WP_000119443.1.23959 WP_000119443.1.24082 WP_000119443.1.24158 WP_000119443.1.24163 WP_000119443.1.24206 WP_000119443.1.24308 WP_000119443.1.24376 WP_000119443.1.24392 WP_000119443.1.24433 WP_000119443.1.24444 WP_000119443.1.24555 WP_000119443.1.24578 WP_000119443.1.24686 WP_000119443.1.24737 WP_000119443.1.24779 WP_000119443.1.24839 WP_000119443.1.24873 WP_000119443.1.25008 WP_000119443.1.25015 WP_000119443.1.25072 WP_000119443.1.25119 WP_000119443.1.25206 WP_000119443.1.2525 WP_000119443.1.25405 WP_000119443.1.25454 WP_000119443.1.25493 WP_000119443.1.25546 WP_000119443.1.25690 WP_000119443.1.2570 WP_000119443.1.25703 WP_000119443.1.25722 WP_000119443.1.25740 WP_000119443.1.25809 WP_000119443.1.25814 WP_000119443.1.25825 WP_000119443.1.25928 WP_000119443.1.25988 WP_000119443.1.26034 WP_000119443.1.26123 WP_000119443.1.26269 WP_000119443.1.26282 WP_000119443.1.26311 WP_000119443.1.26319 WP_000119443.1.26384 WP_000119443.1.26426 WP_000119443.1.26429 WP_000119443.1.26493 WP_000119443.1.26512 WP_000119443.1.26551 WP_000119443.1.26567 WP_000119443.1.26576 WP_000119443.1.26582 WP_000119443.1.26646 WP_000119443.1.26709 WP_000119443.1.26741 WP_000119443.1.26787 WP_000119443.1.26892 WP_000119443.1.26919 WP_000119443.1.27010 WP_000119443.1.27051 WP_000119443.1.27072 WP_000119443.1.27084 WP_000119443.1.27173 WP_000119443.1.27206 WP_000119443.1.27223 WP_000119443.1.27255 WP_000119443.1.27342 WP_000119443.1.27513 WP_000119443.1.27522 WP_000119443.1.27523 WP_000119443.1.27535 WP_000119443.1.27544 WP_000119443.1.27616 WP_000119443.1.2763 WP_000119443.1.27665 WP_000119443.1.27707 WP_000119443.1.27713 WP_000119443.1.2777 WP_000119443.1.27776 WP_000119443.1.27815 WP_000119443.1.27857 WP_000119443.1.27969 WP_000119443.1.28032 WP_000119443.1.28073 WP_000119443.1.28094 WP_000119443.1.28126 WP_000119443.1.28225 WP_000119443.1.28235 WP_000119443.1.2825 WP_000119443.1.28267 WP_000119443.1.2829 WP_000119443.1.28301 WP_000119443.1.28302 WP_000119443.1.2835 WP_000119443.1.28370 WP_000119443.1.28393 WP_000119443.1.28538 WP_000119443.1.28575 WP_000119443.1.28612 WP_000119443.1.28625 WP_000119443.1.28655 WP_000119443.1.28673 WP_000119443.1.28775 WP_000119443.1.28776 WP_000119443.1.2879 WP_000119443.1.28830 WP_000119443.1.2890 WP_000119443.1.28946 WP_000119443.1.29006 WP_000119443.1.29010 WP_000119443.1.29099 WP_000119443.1.2910 WP_000119443.1.29113 WP_000119443.1.29255 WP_000119443.1.29349 WP_000119443.1.29509 WP_000119443.1.29588 WP_000119443.1.29601 WP_000119443.1.29606 WP_000119443.1.29615 WP_000119443.1.29619 WP_000119443.1.29774 WP_000119443.1.29827 WP_000119443.1.29898 WP_000119443.1.29923 WP_000119443.1.29990 WP_000119443.1.30006 WP_000119443.1.30022 WP_000119443.1.30027 WP_000119443.1.30086 WP_000119443.1.30093 WP_000119443.1.30179 WP_000119443.1.30180 WP_000119443.1.30202 WP_000119443.1.30356 WP_000119443.1.30425 WP_000119443.1.30437 WP_000119443.1.30507 WP_000119443.1.30547 WP_000119443.1.30619 WP_000119443.1.3068 WP_000119443.1.30794 WP_000119443.1.3080 WP_000119443.1.30819 WP_000119443.1.30823 WP_000119443.1.30833 WP_000119443.1.30835 WP_000119443.1.30909 WP_000119443.1.30972 WP_000119443.1.31 WP_000119443.1.31001 WP_000119443.1.31011 WP_000119443.1.31092 WP_000119443.1.31122 WP_000119443.1.3114 WP_000119443.1.31171 WP_000119443.1.3119 WP_000119443.1.31195 WP_000119443.1.31198 WP_000119443.1.31210 WP_000119443.1.31214 WP_000119443.1.31281 WP_000119443.1.31362 WP_000119443.1.31451 WP_000119443.1.31476 WP_000119443.1.31504 WP_000119443.1.31515 WP_000119443.1.31578 WP_000119443.1.31658 WP_000119443.1.31665 WP_000119443.1.3170 WP_000119443.1.31725 WP_000119443.1.31782 WP_000119443.1.31845 WP_000119443.1.31927 WP_000119443.1.31940 WP_000119443.1.31952 WP_000119443.1.31967 WP_000119443.1.31972 WP_000119443.1.32006 WP_000119443.1.32056 WP_000119443.1.32192 WP_000119443.1.32206 WP_000119443.1.32260 WP_000119443.1.32368 WP_000119443.1.32408 WP_000119443.1.32423 WP_000119443.1.32424 WP_000119443.1.32438 WP_000119443.1.32527 WP_000119443.1.32545 WP_000119443.1.32624 WP_000119443.1.32660 WP_000119443.1.32702 WP_000119443.1.32714 WP_000119443.1.32750 WP_000119443.1.32786 WP_000119443.1.32804 WP_000119443.1.32860 WP_000119443.1.32900 WP_000119443.1.32907 WP_000119443.1.32930 WP_000119443.1.32961 WP_000119443.1.33030 WP_000119443.1.33106 WP_000119443.1.33160 WP_000119443.1.33248 WP_000119443.1.333 WP_000119443.1.33392 WP_000119443.1.33486 WP_000119443.1.33492 WP_000119443.1.33499 WP_000119443.1.33580 WP_000119443.1.33592 WP_000119443.1.33629 WP_000119443.1.33659 WP_000119443.1.33693 WP_000119443.1.33817 WP_000119443.1.33870 WP_000119443.1.3394 WP_000119443.1.3395 WP_000119443.1.34075 WP_000119443.1.34081 WP_000119443.1.34126 WP_000119443.1.34257 WP_000119443.1.34259 WP_000119443.1.34279 WP_000119443.1.34304 WP_000119443.1.34319 WP_000119443.1.34417 WP_000119443.1.34453 WP_000119443.1.34610 WP_000119443.1.34659 WP_000119443.1.34703 WP_000119443.1.34704 WP_000119443.1.34707 WP_000119443.1.34854 WP_000119443.1.34972 WP_000119443.1.34975 WP_000119443.1.34977 WP_000119443.1.35045 WP_000119443.1.35129 WP_000119443.1.35193 WP_000119443.1.35404 WP_000119443.1.35408 WP_000119443.1.3541 WP_000119443.1.35425 WP_000119443.1.35429 WP_000119443.1.35460 WP_000119443.1.35463 WP_000119443.1.35494 WP_000119443.1.35503 WP_000119443.1.35509 WP_000119443.1.35590 WP_000119443.1.35648 WP_000119443.1.35777 WP_000119443.1.35868 WP_000119443.1.35892 WP_000119443.1.35940 WP_000119443.1.36003 WP_000119443.1.3601 WP_000119443.1.36011 WP_000119443.1.36017 WP_000119443.1.36157 WP_000119443.1.36286 WP_000119443.1.36542 WP_000119443.1.36547 WP_000119443.1.36609 WP_000119443.1.36705 WP_000119443.1.36751 WP_000119443.1.36839 WP_000119443.1.36918 WP_000119443.1.36949 WP_000119443.1.37013 WP_000119443.1.37073 WP_000119443.1.37111 WP_000119443.1.37112 WP_000119443.1.37256 WP_000119443.1.37293 WP_000119443.1.37320 WP_000119443.1.3734 WP_000119443.1.37370 WP_000119443.1.37376 WP_000119443.1.3744 WP_000119443.1.37478 WP_000119443.1.37498 WP_000119443.1.37504 WP_000119443.1.3751 WP_000119443.1.3756 WP_000119443.1.37618 WP_000119443.1.37687 WP_000119443.1.37848 WP_000119443.1.37965 WP_000119443.1.38026 WP_000119443.1.38125 WP_000119443.1.38322 WP_000119443.1.38341 WP_000119443.1.38393 WP_000119443.1.38569 WP_000119443.1.38609 WP_000119443.1.38613 WP_000119443.1.38622 WP_000119443.1.38673 WP_000119443.1.3869 WP_000119443.1.38693 WP_000119443.1.38740 WP_000119443.1.38781 WP_000119443.1.38830 WP_000119443.1.38881 WP_000119443.1.38882 WP_000119443.1.3891 WP_000119443.1.38913 WP_000119443.1.39003 WP_000119443.1.39136 WP_000119443.1.39197 WP_000119443.1.39229 WP_000119443.1.39265 WP_000119443.1.39275 WP_000119443.1.39405 WP_000119443.1.39420 WP_000119443.1.39449 WP_000119443.1.39466 WP_000119443.1.39471 WP_000119443.1.39497 WP_000119443.1.39503 WP_000119443.1.39512 WP_000119443.1.39556 WP_000119443.1.39576 WP_000119443.1.39584 WP_000119443.1.39609 WP_000119443.1.39629 WP_000119443.1.39724 WP_000119443.1.39808 WP_000119443.1.39862 WP_000119443.1.40017 WP_000119443.1.40025 WP_000119443.1.40072 WP_000119443.1.4011 WP_000119443.1.40155 WP_000119443.1.40171 WP_000119443.1.40224 WP_000119443.1.40240 WP_000119443.1.40257 WP_000119443.1.40258 WP_000119443.1.40292 WP_000119443.1.40305 WP_000119443.1.40311 WP_000119443.1.40341 WP_000119443.1.40380 WP_000119443.1.40395 WP_000119443.1.40465 WP_000119443.1.40492 WP_000119443.1.40648 WP_000119443.1.40722 WP_000119443.1.4075 WP_000119443.1.40771 WP_000119443.1.40979 WP_000119443.1.40996 WP_000119443.1.41018 WP_000119443.1.41048 WP_000119443.1.41050 WP_000119443.1.41086 WP_000119443.1.41091 WP_000119443.1.41225 WP_000119443.1.41226 WP_000119443.1.41279 WP_000119443.1.41299 WP_000119443.1.41438 WP_000119443.1.41554 WP_000119443.1.41572 WP_000119443.1.41591 WP_000119443.1.41662 WP_000119443.1.41708 WP_000119443.1.41761 WP_000119443.1.41859 WP_000119443.1.41877 WP_000119443.1.41882 WP_000119443.1.41904 WP_000119443.1.41931 WP_000119443.1.41938 WP_000119443.1.41979 WP_000119443.1.41985 WP_000119443.1.41998 WP_000119443.1.42009 WP_000119443.1.42104 WP_000119443.1.42156 WP_000119443.1.4222 WP_000119443.1.42238 WP_000119443.1.42243 WP_000119443.1.42244 WP_000119443.1.42248 WP_000119443.1.42276 WP_000119443.1.42320 WP_000119443.1.42328 WP_000119443.1.42342 WP_000119443.1.42422 WP_000119443.1.42433 WP_000119443.1.42444 WP_000119443.1.42489 WP_000119443.1.42491 WP_000119443.1.4257 WP_000119443.1.42605 WP_000119443.1.42655 WP_000119443.1.42676 WP_000119443.1.42707 WP_000119443.1.4276 WP_000119443.1.42794 WP_000119443.1.42797 WP_000119443.1.42864 WP_000119443.1.4288 WP_000119443.1.42887 WP_000119443.1.4289 WP_000119443.1.42923 WP_000119443.1.42981 WP_000119443.1.43018 WP_000119443.1.43041 WP_000119443.1.43077 WP_000119443.1.43086 WP_000119443.1.43160 WP_000119443.1.43244 WP_000119443.1.43272 WP_000119443.1.43299 WP_000119443.1.43312 WP_000119443.1.43339 WP_000119443.1.43351 WP_000119443.1.43371 WP_000119443.1.43437 WP_000119443.1.43438 WP_000119443.1.43476 WP_000119443.1.43508 WP_000119443.1.43520 WP_000119443.1.43522 WP_000119443.1.43528 WP_000119443.1.43606 WP_000119443.1.43613 WP_000119443.1.43710 WP_000119443.1.4373 WP_000119443.1.43778 WP_000119443.1.43839 WP_000119443.1.43864 WP_000119443.1.43873 WP_000119443.1.43886 WP_000119443.1.43951 WP_000119443.1.4404 WP_000119443.1.44043 WP_000119443.1.4405 WP_000119443.1.44099 WP_000119443.1.44113 WP_000119443.1.44121 WP_000119443.1.44291 WP_000119443.1.44300 WP_000119443.1.44310 WP_000119443.1.44433 WP_000119443.1.44443 WP_000119443.1.44578 WP_000119443.1.44593 WP_000119443.1.44640 WP_000119443.1.4467 WP_000119443.1.44678 WP_000119443.1.44702 WP_000119443.1.44781 WP_000119443.1.44791 WP_000119443.1.44833 WP_000119443.1.4485 WP_000119443.1.44887 WP_000119443.1.449 WP_000119443.1.44927 WP_000119443.1.44933 WP_000119443.1.44950 WP_000119443.1.44971 WP_000119443.1.44998 WP_000119443.1.45027 WP_000119443.1.45038 WP_000119443.1.45045 WP_000119443.1.45067 WP_000119443.1.45079 WP_000119443.1.45098 WP_000119443.1.45123 WP_000119443.1.45145 WP_000119443.1.45177 WP_000119443.1.45229 WP_000119443.1.45259 WP_000119443.1.45322 WP_000119443.1.45344 WP_000119443.1.45349 WP_000119443.1.45365 WP_000119443.1.4540 WP_000119443.1.45434 WP_000119443.1.45462 WP_000119443.1.45468 WP_000119443.1.45535 WP_000119443.1.45550 WP_000119443.1.45582 WP_000119443.1.45585 WP_000119443.1.45622 WP_000119443.1.45690 WP_000119443.1.45781 WP_000119443.1.45797 WP_000119443.1.458 WP_000119443.1.45848 WP_000119443.1.46069 WP_000119443.1.46091 WP_000119443.1.46112 WP_000119443.1.46173 WP_000119443.1.46174 WP_000119443.1.46187 WP_000119443.1.46205 WP_000119443.1.46243 WP_000119443.1.46250 WP_000119443.1.46278 WP_000119443.1.46299 WP_000119443.1.46303 WP_000119443.1.46323 WP_000119443.1.46434 WP_000119443.1.46444 WP_000119443.1.46572 WP_000119443.1.46595 WP_000119443.1.46693 WP_000119443.1.46730 WP_000119443.1.46732 WP_000119443.1.46930 WP_000119443.1.47008 WP_000119443.1.47214 WP_000119443.1.47389 WP_000119443.1.47429 WP_000119443.1.47442 WP_000119443.1.47448 WP_000119443.1.4747 WP_000119443.1.47472 WP_000119443.1.47478 WP_000119443.1.47492 WP_000119443.1.47579 WP_000119443.1.4769 WP_000119443.1.47714 WP_000119443.1.47799 WP_000119443.1.47817 WP_000119443.1.47849 WP_000119443.1.47902 WP_000119443.1.47928 WP_000119443.1.48124 WP_000119443.1.48218 WP_000119443.1.48242 WP_000119443.1.48244 WP_000119443.1.48247 WP_000119443.1.48253 WP_000119443.1.48367 WP_000119443.1.48377 WP_000119443.1.48399 WP_000119443.1.48755 WP_000119443.1.4885 WP_000119443.1.48855 WP_000119443.1.48876 WP_000119443.1.48894 WP_000119443.1.48896 WP_000119443.1.48918 WP_000119443.1.48919 WP_000119443.1.48931 WP_000119443.1.49012 WP_000119443.1.49084 WP_000119443.1.49102 WP_000119443.1.49113 WP_000119443.1.49155 WP_000119443.1.49175 WP_000119443.1.49226 WP_000119443.1.49239 WP_000119443.1.49256 WP_000119443.1.49290 WP_000119443.1.49309 WP_000119443.1.49340 WP_000119443.1.49366 WP_000119443.1.49375 WP_000119443.1.49490 WP_000119443.1.49515 WP_000119443.1.49572 WP_000119443.1.49595 WP_000119443.1.49602 WP_000119443.1.49626 WP_000119443.1.49630 WP_000119443.1.49647 WP_000119443.1.49686 WP_000119443.1.49780 WP_000119443.1.4979 WP_000119443.1.49803 WP_000119443.1.49805 WP_000119443.1.49848 WP_000119443.1.49929 WP_000119443.1.49931 WP_000119443.1.50 WP_000119443.1.50003 WP_000119443.1.50007 WP_000119443.1.50161 WP_000119443.1.50198 WP_000119443.1.50211 WP_000119443.1.50251 WP_000119443.1.50285 WP_000119443.1.50376 WP_000119443.1.50386 WP_000119443.1.50404 WP_000119443.1.50478 WP_000119443.1.5058 WP_000119443.1.50593 WP_000119443.1.50676 WP_000119443.1.50769 WP_000119443.1.50774 WP_000119443.1.50782 WP_000119443.1.50800 WP_000119443.1.50804 WP_000119443.1.50808 WP_000119443.1.5088 WP_000119443.1.50918 WP_000119443.1.50999 WP_000119443.1.51014 WP_000119443.1.51022 WP_000119443.1.51066 WP_000119443.1.51131 WP_000119443.1.51162 WP_000119443.1.51179 WP_000119443.1.51182 WP_000119443.1.51186 WP_000119443.1.51224 WP_000119443.1.51285 WP_000119443.1.51308 WP_000119443.1.51331 WP_000119443.1.5138 WP_000119443.1.51419 WP_000119443.1.51487 WP_000119443.1.51488 WP_000119443.1.51506 WP_000119443.1.51514 WP_000119443.1.51594 WP_000119443.1.51611 WP_000119443.1.51634 WP_000119443.1.51649 WP_000119443.1.51686 WP_000119443.1.51756 WP_000119443.1.51831 WP_000119443.1.51841 WP_000119443.1.51888 WP_000119443.1.51911 WP_000119443.1.51914 WP_000119443.1.51932 WP_000119443.1.51989 WP_000119443.1.52121 WP_000119443.1.52148 WP_000119443.1.52170 WP_000119443.1.52255 WP_000119443.1.52336 WP_000119443.1.52353 WP_000119443.1.52527 WP_000119443.1.52528 WP_000119443.1.52637 WP_000119443.1.52653 WP_000119443.1.52692 WP_000119443.1.52743 WP_000119443.1.52744 WP_000119443.1.52857 WP_000119443.1.52866 WP_000119443.1.52898 WP_000119443.1.52915 WP_000119443.1.52924 WP_000119443.1.52949 WP_000119443.1.52985 WP_000119443.1.53100 WP_000119443.1.5316 WP_000119443.1.53203 WP_000119443.1.53272 WP_000119443.1.53286 WP_000119443.1.53406 WP_000119443.1.53436 WP_000119443.1.53466 WP_000119443.1.53529 WP_000119443.1.53534 WP_000119443.1.53543 WP_000119443.1.53675 WP_000119443.1.53688 WP_000119443.1.53694 WP_000119443.1.53696 WP_000119443.1.53757 WP_000119443.1.53772 WP_000119443.1.53790 WP_000119443.1.53812 WP_000119443.1.53905 WP_000119443.1.54033 WP_000119443.1.54061 WP_000119443.1.54075 WP_000119443.1.54082 WP_000119443.1.54085 WP_000119443.1.54136 WP_000119443.1.54196 WP_000119443.1.542 WP_000119443.1.54209 WP_000119443.1.54273 WP_000119443.1.54274 WP_000119443.1.54324 WP_000119443.1.54333 WP_000119443.1.54364 WP_000119443.1.54400 WP_000119443.1.54522 WP_000119443.1.54526 WP_000119443.1.5456 WP_000119443.1.54607 WP_000119443.1.54644 WP_000119443.1.54662 WP_000119443.1.54694 WP_000119443.1.54722 WP_000119443.1.54764 WP_000119443.1.54774 WP_000119443.1.54814 WP_000119443.1.54822 WP_000119443.1.54845 WP_000119443.1.5485 WP_000119443.1.54992 WP_000119443.1.55008 WP_000119443.1.55073 WP_000119443.1.55152 WP_000119443.1.55156 WP_000119443.1.5517 WP_000119443.1.55224 WP_000119443.1.55285 WP_000119443.1.55294 WP_000119443.1.55325 WP_000119443.1.55430 WP_000119443.1.55461 WP_000119443.1.55475 WP_000119443.1.55477 WP_000119443.1.5552 WP_000119443.1.55528 WP_000119443.1.55545 WP_000119443.1.55554 WP_000119443.1.5560 WP_000119443.1.55614 WP_000119443.1.55647 WP_000119443.1.55672 WP_000119443.1.55706 WP_000119443.1.55718 WP_000119443.1.55743 WP_000119443.1.55768 WP_000119443.1.55782 WP_000119443.1.55973 WP_000119443.1.55993 WP_000119443.1.55995 WP_000119443.1.56002 WP_000119443.1.56012 WP_000119443.1.56026 WP_000119443.1.56059 WP_000119443.1.56100 WP_000119443.1.56105 WP_000119443.1.56244 WP_000119443.1.56247 WP_000119443.1.56304 WP_000119443.1.5633 WP_000119443.1.56354 WP_000119443.1.56385 WP_000119443.1.56389 WP_000119443.1.56393 WP_000119443.1.56438 WP_000119443.1.56468 WP_000119443.1.56512 WP_000119443.1.56559 WP_000119443.1.56560 WP_000119443.1.56597 WP_000119443.1.56601 WP_000119443.1.56614 WP_000119443.1.56647 WP_000119443.1.56651 WP_000119443.1.56660 WP_000119443.1.56671 WP_000119443.1.56682 WP_000119443.1.56824 WP_000119443.1.56877 WP_000119443.1.56905 WP_000119443.1.57000 WP_000119443.1.57149 WP_000119443.1.57168 WP_000119443.1.57187 WP_000119443.1.57232 WP_000119443.1.57356 WP_000119443.1.57357 WP_000119443.1.57377 WP_000119443.1.57433 WP_000119443.1.57494 WP_000119443.1.57515 WP_000119443.1.57529 WP_000119443.1.5753 WP_000119443.1.57576 WP_000119443.1.57607 WP_000119443.1.57735 WP_000119443.1.57763 WP_000119443.1.57797 WP_000119443.1.5781 WP_000119443.1.57857 WP_000119443.1.57862 WP_000119443.1.57890 WP_000119443.1.57891 WP_000119443.1.57978 WP_000119443.1.5801 WP_000119443.1.58041 WP_000119443.1.58153 WP_000119443.1.58157 WP_000119443.1.58249 WP_000119443.1.58301 WP_000119443.1.58358 WP_000119443.1.58372 WP_000119443.1.58407 WP_000119443.1.58418 WP_000119443.1.5846 WP_000119443.1.5854 WP_000119443.1.58548 WP_000119443.1.58564 WP_000119443.1.58604 WP_000119443.1.58662 WP_000119443.1.58669 WP_000119443.1.58729 WP_000119443.1.58744 WP_000119443.1.58745 WP_000119443.1.5878 WP_000119443.1.58803 WP_000119443.1.58831 WP_000119443.1.58834 WP_000119443.1.5886 WP_000119443.1.58932 WP_000119443.1.59084 WP_000119443.1.59094 WP_000119443.1.59136 WP_000119443.1.59148 WP_000119443.1.59224 WP_000119443.1.59294 WP_000119443.1.59412 WP_000119443.1.59420 WP_000119443.1.59458 WP_000119443.1.59490 WP_000119443.1.59508 WP_000119443.1.59512 WP_000119443.1.5953 WP_000119443.1.59684 WP_000119443.1.59694 WP_000119443.1.59710 WP_000119443.1.59755 WP_000119443.1.59771 WP_000119443.1.59928 WP_000119443.1.59953 WP_000119443.1.60004 WP_000119443.1.60008 WP_000119443.1.60015 WP_000119443.1.60021 WP_000119443.1.60069 WP_000119443.1.60140 WP_000119443.1.60209 WP_000119443.1.60213 WP_000119443.1.60231 WP_000119443.1.60285 WP_000119443.1.60370 WP_000119443.1.60379 WP_000119443.1.60464 WP_000119443.1.60507 WP_000119443.1.60545 WP_000119443.1.60561 WP_000119443.1.60597 WP_000119443.1.60608 WP_000119443.1.60772 WP_000119443.1.60855 WP_000119443.1.6086 WP_000119443.1.60874 WP_000119443.1.60976 WP_000119443.1.60990 WP_000119443.1.61078 WP_000119443.1.6108 WP_000119443.1.61087 WP_000119443.1.61114 WP_000119443.1.61184 WP_000119443.1.61218 WP_000119443.1.61232 WP_000119443.1.61233 WP_000119443.1.6129 WP_000119443.1.61296 WP_000119443.1.61345 WP_000119443.1.61417 WP_000119443.1.61509 WP_000119443.1.61519 WP_000119443.1.61582 WP_000119443.1.61609 WP_000119443.1.61662 WP_000119443.1.61712 WP_000119443.1.61714 WP_000119443.1.61730 WP_000119443.1.61743 WP_000119443.1.61857 WP_000119443.1.61918 WP_000119443.1.61924 WP_000119443.1.61952 WP_000119443.1.61968 WP_000119443.1.62007 WP_000119443.1.62020 WP_000119443.1.6209 WP_000119443.1.6210 WP_000119443.1.62120 WP_000119443.1.62122 WP_000119443.1.62204 WP_000119443.1.62257 WP_000119443.1.62271 WP_000119443.1.62304 WP_000119443.1.62339 WP_000119443.1.62344 WP_000119443.1.62364 WP_000119443.1.62374 WP_000119443.1.62403 WP_000119443.1.62504 WP_000119443.1.62522 WP_000119443.1.62564 WP_000119443.1.62570 WP_000119443.1.62648 WP_000119443.1.62677 WP_000119443.1.62725 WP_000119443.1.62853 WP_000119443.1.62903 WP_000119443.1.62910 WP_000119443.1.62955 WP_000119443.1.62976 WP_000119443.1.63043 WP_000119443.1.63063 WP_000119443.1.63129 WP_000119443.1.63155 WP_000119443.1.63181 WP_000119443.1.63203 WP_000119443.1.63234 WP_000119443.1.63243 WP_000119443.1.63256 WP_000119443.1.63290 WP_000119443.1.63382 WP_000119443.1.63422 WP_000119443.1.63455 WP_000119443.1.63461 WP_000119443.1.63499 WP_000119443.1.6357 WP_000119443.1.63718 WP_000119443.1.63731 WP_000119443.1.6375 WP_000119443.1.63781 WP_000119443.1.63797 WP_000119443.1.63824 WP_000119443.1.63831 WP_000119443.1.63834 WP_000119443.1.63864 WP_000119443.1.6399 WP_000119443.1.63992 WP_000119443.1.64018 WP_000119443.1.64072 WP_000119443.1.64208 WP_000119443.1.6423 WP_000119443.1.64242 WP_000119443.1.64244 WP_000119443.1.64266 WP_000119443.1.6437 WP_000119443.1.64387 WP_000119443.1.64403 WP_000119443.1.64569 WP_000119443.1.64645 WP_000119443.1.64649 WP_000119443.1.64674 WP_000119443.1.64690 WP_000119443.1.64702 WP_000119443.1.64757 WP_000119443.1.64781 WP_000119443.1.64798 WP_000119443.1.64831 WP_000119443.1.6489 WP_000119443.1.64894 WP_000119443.1.64919 WP_000119443.1.65018 WP_000119443.1.65028 WP_000119443.1.65168 WP_000119443.1.65238 WP_000119443.1.65248 WP_000119443.1.65269 WP_000119443.1.65348 WP_000119443.1.6535 WP_000119443.1.65437 WP_000119443.1.65474 WP_000119443.1.6561 WP_000119443.1.65633 WP_000119443.1.65696 WP_000119443.1.6572 WP_000119443.1.6575 WP_000119443.1.65782 WP_000119443.1.65795 WP_000119443.1.65849 WP_000119443.1.6594 WP_000119443.1.65940 WP_000119443.1.65956 WP_000119443.1.65968 WP_000119443.1.66129 WP_000119443.1.66167 WP_000119443.1.66272 WP_000119443.1.66314 WP_000119443.1.66330 WP_000119443.1.66358 WP_000119443.1.66362 WP_000119443.1.66368 WP_000119443.1.6638 WP_000119443.1.66534 WP_000119443.1.66600 WP_000119443.1.66678 WP_000119443.1.66698 WP_000119443.1.66779 WP_000119443.1.6680 WP_000119443.1.66825 WP_000119443.1.66834 WP_000119443.1.66876 WP_000119443.1.66901 WP_000119443.1.67045 WP_000119443.1.67100 WP_000119443.1.67181 WP_000119443.1.67184 WP_000119443.1.67235 WP_000119443.1.67268 WP_000119443.1.67347 WP_000119443.1.67374 WP_000119443.1.6739 WP_000119443.1.67465 WP_000119443.1.67552 WP_000119443.1.67617 WP_000119443.1.67682 WP_000119443.1.67707 WP_000119443.1.67772 WP_000119443.1.67803 WP_000119443.1.67827 WP_000119443.1.67887 WP_000119443.1.67905 WP_000119443.1.67924 WP_000119443.1.67977 WP_000119443.1.68073 WP_000119443.1.6809 WP_000119443.1.68115 WP_000119443.1.68201 WP_000119443.1.68206 WP_000119443.1.68210 WP_000119443.1.6827 WP_000119443.1.68275 WP_000119443.1.6833 WP_000119443.1.68401 WP_000119443.1.68477 WP_000119443.1.6849 WP_000119443.1.68547 WP_000119443.1.68589 WP_000119443.1.68655 WP_000119443.1.68658 WP_000119443.1.68690 WP_000119443.1.68778 WP_000119443.1.68787 WP_000119443.1.68816 WP_000119443.1.68818 WP_000119443.1.68894 WP_000119443.1.68928 WP_000119443.1.68958 WP_000119443.1.68966 WP_000119443.1.69001 WP_000119443.1.69029 WP_000119443.1.6904 WP_000119443.1.6913 WP_000119443.1.69146 WP_000119443.1.69151 WP_000119443.1.69255 WP_000119443.1.69288 WP_000119443.1.69320 WP_000119443.1.69359 WP_000119443.1.69397 WP_000119443.1.69515 WP_000119443.1.6954 WP_000119443.1.69564 WP_000119443.1.69588 WP_000119443.1.69592 WP_000119443.1.69597 WP_000119443.1.69644 WP_000119443.1.69704 WP_000119443.1.69754 WP_000119443.1.69758 WP_000119443.1.69760 WP_000119443.1.69787 WP_000119443.1.69790 WP_000119443.1.69807 WP_000119443.1.69808 WP_000119443.1.69848 WP_000119443.1.69890 WP_000119443.1.69975 WP_000119443.1.69977 WP_000119443.1.70028 WP_000119443.1.70047 WP_000119443.1.7014 WP_000119443.1.7021 WP_000119443.1.70241 WP_000119443.1.70269 WP_000119443.1.70289 WP_000119443.1.70326 WP_000119443.1.70447 WP_000119443.1.70485 WP_000119443.1.70547 WP_000119443.1.70683 WP_000119443.1.70732 WP_000119443.1.70792 WP_000119443.1.70797 WP_000119443.1.70869 WP_000119443.1.70883 WP_000119443.1.70922 WP_000119443.1.70948 WP_000119443.1.70959 WP_000119443.1.71007 WP_000119443.1.71010 WP_000119443.1.71023 WP_000119443.1.71069 WP_000119443.1.71116 WP_000119443.1.71120 WP_000119443.1.71165 WP_000119443.1.71188 WP_000119443.1.71202 WP_000119443.1.71268 WP_000119443.1.71299 WP_000119443.1.71306 WP_000119443.1.71337 WP_000119443.1.71363 WP_000119443.1.71378 WP_000119443.1.7142 WP_000119443.1.71452 WP_000119443.1.71481 WP_000119443.1.71636 WP_000119443.1.71691 WP_000119443.1.71702 WP_000119443.1.71746 WP_000119443.1.71756 WP_000119443.1.71798 WP_000119443.1.71845 WP_000119443.1.71881 WP_000119443.1.71908 WP_000119443.1.71923 WP_000119443.1.71929 WP_000119443.1.71941 WP_000119443.1.71952 WP_000119443.1.72065 WP_000119443.1.72068 WP_000119443.1.72188 WP_000119443.1.72220 WP_000119443.1.72234 WP_000119443.1.72283 WP_000119443.1.72307 WP_000119443.1.72351 WP_000119443.1.72372 WP_000119443.1.72382 WP_000119443.1.72403 WP_000119443.1.7243 WP_000119443.1.72594 WP_000119443.1.72629 WP_000119443.1.72642 WP_000119443.1.72728 WP_000119443.1.72827 WP_000119443.1.72850 WP_000119443.1.72871 WP_000119443.1.72872 WP_000119443.1.72892 WP_000119443.1.72897 WP_000119443.1.72944 WP_000119443.1.72968 WP_000119443.1.72975 WP_000119443.1.7304 WP_000119443.1.73062 WP_000119443.1.73125 WP_000119443.1.7315 WP_000119443.1.73200 WP_000119443.1.73328 WP_000119443.1.7334 WP_000119443.1.73377 WP_000119443.1.73461 WP_000119443.1.73512 WP_000119443.1.7356 WP_000119443.1.73561 WP_000119443.1.73581 WP_000119443.1.73596 WP_000119443.1.73617 WP_000119443.1.73667 WP_000119443.1.7374 WP_000119443.1.73758 WP_000119443.1.73804 WP_000119443.1.73847 WP_000119443.1.7386 WP_000119443.1.7387 WP_000119443.1.73926 WP_000119443.1.73945 WP_000119443.1.74028 WP_000119443.1.74029 WP_000119443.1.74040 WP_000119443.1.74117 WP_000119443.1.74181 WP_000119443.1.74191 WP_000119443.1.7433 WP_000119443.1.74379 WP_000119443.1.74402 WP_000119443.1.74410 WP_000119443.1.74414 WP_000119443.1.74422 WP_000119443.1.74466 WP_000119443.1.74481 WP_000119443.1.745 WP_000119443.1.74500 WP_000119443.1.74529 WP_000119443.1.74620 WP_000119443.1.74639 WP_000119443.1.74661 WP_000119443.1.74745 WP_000119443.1.74806 WP_000119443.1.74807 WP_000119443.1.7491 WP_000119443.1.74946 WP_000119443.1.74992 WP_000119443.1.74996 WP_000119443.1.75009 WP_000119443.1.75058 WP_000119443.1.75129 WP_000119443.1.75180 WP_000119443.1.75187 WP_000119443.1.75288 WP_000119443.1.75362 WP_000119443.1.75385 WP_000119443.1.75392 WP_000119443.1.7543 WP_000119443.1.75494 WP_000119443.1.75585 WP_000119443.1.75626 WP_000119443.1.75664 WP_000119443.1.75703 WP_000119443.1.75760 WP_000119443.1.75793 WP_000119443.1.75837 WP_000119443.1.75873 WP_000119443.1.75874 WP_000119443.1.75945 WP_000119443.1.76 WP_000119443.1.76020 WP_000119443.1.76055 WP_000119443.1.76156 WP_000119443.1.76186 WP_000119443.1.76208 WP_000119443.1.76252 WP_000119443.1.76301 WP_000119443.1.76327 WP_000119443.1.7634 WP_000119443.1.76445 WP_000119443.1.76471 WP_000119443.1.76532 WP_000119443.1.76548 WP_000119443.1.76576 WP_000119443.1.7660 WP_000119443.1.76673 WP_000119443.1.76706 WP_000119443.1.7672 WP_000119443.1.76721 WP_000119443.1.76756 WP_000119443.1.76760 WP_000119443.1.76866 WP_000119443.1.76875 WP_000119443.1.76880 WP_000119443.1.77038 WP_000119443.1.77047 WP_000119443.1.77080 WP_000119443.1.77177 WP_000119443.1.77180 WP_000119443.1.77244 WP_000119443.1.77267 WP_000119443.1.77271 WP_000119443.1.77292 WP_000119443.1.77313 WP_000119443.1.77349 WP_000119443.1.77390 WP_000119443.1.77431 WP_000119443.1.77436 WP_000119443.1.77440 WP_000119443.1.77514 WP_000119443.1.77529 WP_000119443.1.77543 WP_000119443.1.77549 WP_000119443.1.77555 WP_000119443.1.77565 WP_000119443.1.77596 WP_000119443.1.77629 WP_000119443.1.77646 WP_000119443.1.77653 WP_000119443.1.77692 WP_000119443.1.77710 WP_000119443.1.77871 WP_000119443.1.77898 WP_000119443.1.77918 WP_000119443.1.77960 WP_000119443.1.78 WP_000119443.1.78053 WP_000119443.1.78076 WP_000119443.1.78096 WP_000119443.1.78100 WP_000119443.1.78245 WP_000119443.1.78259 WP_000119443.1.78301 WP_000119443.1.78372 WP_000119443.1.78383 WP_000119443.1.78407 WP_000119443.1.78495 WP_000119443.1.78602 WP_000119443.1.7861 WP_000119443.1.78618 WP_000119443.1.78735 WP_000119443.1.78738 WP_000119443.1.78771 WP_000119443.1.78802 WP_000119443.1.78830 WP_000119443.1.78835 WP_000119443.1.78838 WP_000119443.1.78862 WP_000119443.1.78871 WP_000119443.1.7891 WP_000119443.1.78918 WP_000119443.1.78930 WP_000119443.1.79011 WP_000119443.1.79032 WP_000119443.1.79081 WP_000119443.1.79151 WP_000119443.1.79167 WP_000119443.1.79203 WP_000119443.1.79302 WP_000119443.1.79335 WP_000119443.1.79370 WP_000119443.1.794 WP_000119443.1.79427 WP_000119443.1.79462 WP_000119443.1.79466 WP_000119443.1.79472 WP_000119443.1.79490 WP_000119443.1.79529 WP_000119443.1.7964 WP_000119443.1.79645 WP_000119443.1.79659 WP_000119443.1.79668 WP_000119443.1.7972 WP_000119443.1.79734 WP_000119443.1.79738 WP_000119443.1.7979 WP_000119443.1.79832 WP_000119443.1.79867 WP_000119443.1.79914 WP_000119443.1.79929 WP_000119443.1.79934 WP_000119443.1.7994 WP_000119443.1.79945 WP_000119443.1.79966 WP_000119443.1.79996 WP_000119443.1.80077 WP_000119443.1.80137 WP_000119443.1.80250 WP_000119443.1.80293 WP_000119443.1.80296 WP_000119443.1.80307 WP_000119443.1.80366 WP_000119443.1.80441 WP_000119443.1.80448 WP_000119443.1.80479 WP_000119443.1.80651 WP_000119443.1.80674 WP_000119443.1.80741 WP_000119443.1.80750 WP_000119443.1.80757 WP_000119443.1.80780 WP_000119443.1.80831 WP_000119443.1.80868 WP_000119443.1.80881 WP_000119443.1.80913 WP_000119443.1.80927 WP_000119443.1.80939 WP_000119443.1.8096 WP_000119443.1.80973 WP_000119443.1.81037 WP_000119443.1.81069 WP_000119443.1.81149 WP_000119443.1.81175 WP_000119443.1.8119 WP_000119443.1.81193 WP_000119443.1.81275 WP_000119443.1.81302 WP_000119443.1.81305 WP_000119443.1.81320 WP_000119443.1.81321 WP_000119443.1.81328 WP_000119443.1.81404 WP_000119443.1.81409 WP_000119443.1.81410 WP_000119443.1.81425 WP_000119443.1.81504 WP_000119443.1.81528 WP_000119443.1.81548 WP_000119443.1.81667 WP_000119443.1.8168 WP_000119443.1.81735 WP_000119443.1.81746 WP_000119443.1.81750 WP_000119443.1.81760 WP_000119443.1.81902 WP_000119443.1.81941 WP_000119443.1.8196 WP_000119443.1.81974 WP_000119443.1.81977 WP_000119443.1.82037 WP_000119443.1.82099 WP_000119443.1.82192 WP_000119443.1.82232 WP_000119443.1.82258 WP_000119443.1.82269 WP_000119443.1.82337 WP_000119443.1.8236 WP_000119443.1.82369 WP_000119443.1.82464 WP_000119443.1.82479 WP_000119443.1.82503 WP_000119443.1.82515 WP_000119443.1.82530 WP_000119443.1.82570 WP_000119443.1.82584 WP_000119443.1.82636 WP_000119443.1.82648 WP_000119443.1.82676 WP_000119443.1.82761 WP_000119443.1.8282 WP_000119443.1.82867 WP_000119443.1.82944 WP_000119443.1.82946 WP_000119443.1.82956 WP_000119443.1.82964 WP_000119443.1.82992 WP_000119443.1.83061 WP_000119443.1.83119 WP_000119443.1.83128 WP_000119443.1.83139 WP_000119443.1.83163 WP_000119443.1.8322 WP_000119443.1.83221 WP_000119443.1.83252 WP_000119443.1.83305 WP_000119443.1.83365 WP_000119443.1.83491 WP_000119443.1.83516 WP_000119443.1.83523 WP_000119443.1.8354 WP_000119443.1.83598 WP_000119443.1.83651 WP_000119443.1.83710 WP_000119443.1.83721 WP_000119443.1.83760 WP_000119443.1.83897 WP_000119443.1.83960 WP_000119443.1.83995 WP_000119443.1.84031 WP_000119443.1.84077 WP_000119443.1.84100 WP_000119443.1.84103 WP_000119443.1.84168 WP_000119443.1.84179 WP_000119443.1.84283 WP_000119443.1.84291 WP_000119443.1.84373 WP_000119443.1.84397 WP_000119443.1.8441 WP_000119443.1.84461 WP_000119443.1.84532 WP_000119443.1.84644 WP_000119443.1.84659 WP_000119443.1.84683 WP_000119443.1.84693 WP_000119443.1.84711 WP_000119443.1.84745 WP_000119443.1.84899 WP_000119443.1.849 WP_000119443.1.8497 WP_000119443.1.85040 WP_000119443.1.85094 WP_000119443.1.85126 WP_000119443.1.85178 WP_000119443.1.85180 WP_000119443.1.85192 WP_000119443.1.8537 WP_000119443.1.85433 WP_000119443.1.8545 WP_000119443.1.85456 WP_000119443.1.85483 WP_000119443.1.85541 WP_000119443.1.85568 WP_000119443.1.85615 WP_000119443.1.85617 WP_000119443.1.85663 WP_000119443.1.85672 WP_000119443.1.85675 WP_000119443.1.85723 WP_000119443.1.85742 WP_000119443.1.85777 WP_000119443.1.85780 WP_000119443.1.85784 WP_000119443.1.85797 WP_000119443.1.85886 WP_000119443.1.85900 WP_000119443.1.8591 WP_000119443.1.85976 WP_000119443.1.86007 WP_000119443.1.86010 WP_000119443.1.86043 WP_000119443.1.86120 WP_000119443.1.86173 WP_000119443.1.86224 WP_000119443.1.86259 WP_000119443.1.86285 WP_000119443.1.86316 WP_000119443.1.86335 WP_000119443.1.86356 WP_000119443.1.86389 WP_000119443.1.86450 WP_000119443.1.86469 WP_000119443.1.86588 WP_000119443.1.86593 WP_000119443.1.86601 WP_000119443.1.86661 WP_000119443.1.86699 WP_000119443.1.8671 WP_000119443.1.86744 WP_000119443.1.8678 WP_000119443.1.86807 WP_000119443.1.86810 WP_000119443.1.8684 WP_000119443.1.86860 WP_000119443.1.86902 WP_000119443.1.86982 WP_000119443.1.87051 WP_000119443.1.87095 WP_000119443.1.87143 WP_000119443.1.87148 WP_000119443.1.8722 WP_000119443.1.87283 WP_000119443.1.8736 WP_000119443.1.87365 WP_000119443.1.87460 WP_000119443.1.87552 WP_000119443.1.87584 WP_000119443.1.87618 WP_000119443.1.8767 WP_000119443.1.87695 WP_000119443.1.87779 WP_000119443.1.87899 WP_000119443.1.8792 WP_000119443.1.87999 WP_000119443.1.88019 WP_000119443.1.88073 WP_000119443.1.8809 WP_000119443.1.88092 WP_000119443.1.88165 WP_000119443.1.88174 WP_000119443.1.88222 WP_000119443.1.88244 WP_000119443.1.88291 WP_000119443.1.8837 WP_000119443.1.88393 WP_000119443.1.8849 WP_000119443.1.88609 WP_000119443.1.88620 WP_000119443.1.88698 WP_000119443.1.88703 WP_000119443.1.88845 WP_000119443.1.88902 WP_000119443.1.8891 WP_000119443.1.88957 WP_000119443.1.88967 WP_000119443.1.88980 WP_000119443.1.89008 WP_000119443.1.89054 WP_000119443.1.89114 WP_000119443.1.89116 WP_000119443.1.89119 WP_000119443.1.89138 WP_000119443.1.89174 WP_000119443.1.89188 WP_000119443.1.89215 WP_000119443.1.89291 WP_000119443.1.89452 WP_000119443.1.89462 WP_000119443.1.89512 WP_000119443.1.89527 WP_000119443.1.89570 WP_000119443.1.89580 WP_000119443.1.89604 WP_000119443.1.89622 WP_000119443.1.89632 WP_000119443.1.89647 WP_000119443.1.89657 WP_000119443.1.89659 WP_000119443.1.89765 WP_000119443.1.89777 WP_000119443.1.89817 WP_000119443.1.89870 WP_000119443.1.89902 WP_000119443.1.8996 WP_000119443.1.89965 WP_000119443.1.89975 WP_000119443.1.90033 WP_000119443.1.90097 WP_000119443.1.90211 WP_000119443.1.90252 WP_000119443.1.90311 WP_000119443.1.90348 WP_000119443.1.90440 WP_000119443.1.90453 WP_000119443.1.90458 WP_000119443.1.90472 WP_000119443.1.90585 WP_000119443.1.9064 WP_000119443.1.90641 WP_000119443.1.90701 WP_000119443.1.90734 WP_000119443.1.90792 WP_000119443.1.90814 WP_000119443.1.90876 WP_000119443.1.9093 WP_000119443.1.90984 WP_000119443.1.91003 WP_000119443.1.91042 WP_000119443.1.91056 WP_000119443.1.91069 WP_000119443.1.91107 WP_000119443.1.91156 WP_000119443.1.91179 WP_000119443.1.91189 WP_000119443.1.91278 WP_000119443.1.9131 WP_000119443.1.91334 WP_000119443.1.91459 WP_000119443.1.91512 WP_000119443.1.91524 WP_000119443.1.91580 WP_000119443.1.91621 WP_000119443.1.91625 WP_000119443.1.91628 WP_000119443.1.91655 WP_000119443.1.91724 WP_000119443.1.91732 WP_000119443.1.91736 WP_000119443.1.91806 WP_000119443.1.91880 WP_000119443.1.92013 WP_000119443.1.92044 WP_000119443.1.92047 WP_000119443.1.92060 WP_000119443.1.92067 WP_000119443.1.92093 WP_000119443.1.92122 WP_000119443.1.92165 WP_000119443.1.92171 WP_000119443.1.92213 WP_000119443.1.92310 WP_000119443.1.92318 WP_000119443.1.92399 WP_000119443.1.92408 WP_000119443.1.92411 WP_000119443.1.92443 WP_000119443.1.92529 WP_000119443.1.92531 WP_000119443.1.92575 WP_000119443.1.92669 WP_000119443.1.92671 WP_000119443.1.92738 WP_000119443.1.92758 WP_000119443.1.92875 WP_000119443.1.92893 WP_000119443.1.92895 WP_000119443.1.93059 WP_000119443.1.93061 WP_000119443.1.93086 WP_000119443.1.93101 WP_000119443.1.93322 WP_000119443.1.93339 WP_000119443.1.93365 WP_000119443.1.93376 WP_000119443.1.93596 WP_000119443.1.93604 WP_000119443.1.93650 WP_000119443.1.93656 WP_000119443.1.93662 WP_000119443.1.93691 WP_000119443.1.937 WP_000119443.1.93804 WP_000119443.1.93837 WP_000119443.1.9389 WP_000119443.1.93937 WP_000119443.1.93986 WP_000119443.1.94039 WP_000119443.1.94070 WP_000119443.1.94132 WP_000119443.1.94168 WP_000119443.1.94181 WP_000119443.1.94198 WP_000119443.1.9432 WP_000119443.1.94352 WP_000119443.1.94354 WP_000119443.1.94379 WP_000119443.1.94380 WP_000119443.1.94383 WP_000119443.1.94412 WP_000119443.1.94458 WP_000119443.1.94562 WP_000119443.1.94565 WP_000119443.1.94622 WP_000119443.1.94655 WP_000119443.1.94669 WP_000119443.1.94674 WP_000119443.1.94785 WP_000119443.1.94796 WP_000119443.1.9481 WP_000119443.1.94849 WP_000119443.1.94862 WP_000119443.1.94959 WP_000119443.1.94982 WP_000119443.1.9503 WP_000119443.1.95051 WP_000119443.1.95085 WP_000119443.1.95094 WP_000119443.1.95121 WP_000119443.1.95152 WP_000119443.1.9516 WP_000119443.1.95248 WP_000119443.1.95249 WP_000119443.1.95277 WP_000119443.1.95282 WP_000119443.1.95298 WP_000119443.1.95320 WP_000119443.1.95388 WP_000119443.1.95404 WP_000119443.1.95579 WP_000119443.1.95630 WP_000119443.1.95641 WP_000119443.1.95670 WP_000119443.1.95691 WP_000119443.1.95701 WP_000119443.1.95703 WP_000119443.1.9574 WP_000119443.1.95744 WP_000119443.1.95805 WP_000119443.1.95826 WP_000119443.1.95911 WP_000119443.1.95939 WP_000119443.1.95940 WP_000119443.1.96004 WP_000119443.1.96045 WP_000119443.1.96139 WP_000119443.1.96162 WP_000119443.1.96172 WP_000119443.1.96260 WP_000119443.1.96317 WP_000119443.1.96429 WP_000119443.1.9644 WP_000119443.1.96469 WP_000119443.1.96497 WP_000119443.1.96533 WP_000119443.1.96555 WP_000119443.1.96563 WP_000119443.1.96600 WP_000119443.1.96640 WP_000119443.1.96732 WP_000119443.1.9674 WP_000119443.1.96758 WP_000119443.1.96761 WP_000119443.1.96771 WP_000119443.1.96798 WP_000119443.1.9686 WP_000119443.1.96890 WP_000119443.1.97015 WP_000119443.1.97043 WP_000119443.1.97047 WP_000119443.1.97089 WP_000119443.1.97109 WP_000119443.1.97143 WP_000119443.1.97145 WP_000119443.1.97190 WP_000119443.1.97224 WP_000119443.1.97297 WP_000119443.1.97318 WP_000119443.1.97386 WP_000119443.1.97413 WP_000119443.1.97477 WP_000119443.1.97480 WP_000119443.1.97487 WP_000119443.1.97534 WP_000119443.1.97597 WP_000119443.1.97613 WP_000119443.1.97620 WP_000119443.1.97626 WP_000119443.1.97628 WP_000119443.1.97631 WP_000119443.1.97691 WP_000119443.1.97693 WP_000119443.1.97726 WP_000119443.1.97727 WP_000119443.1.97736 WP_000119443.1.9775 WP_000119443.1.97768 WP_000119443.1.97772 WP_000119443.1.97800 WP_000119443.1.97846 WP_000119443.1.97907 WP_000119443.1.97983 WP_000119443.1.9799 WP_000119443.1.98006 WP_000119443.1.98019 WP_000119443.1.98022 WP_000119443.1.98107 WP_000119443.1.9811 WP_000119443.1.98124 WP_000119443.1.98170 WP_000119443.1.98219 WP_000119443.1.9826 WP_000119443.1.98402 WP_000119443.1.9841 WP_000119443.1.98483 WP_000119443.1.98495 WP_000119443.1.98531 WP_000119443.1.98551 WP_000119443.1.98577 WP_000119443.1.98634 WP_000119443.1.98677 WP_000119443.1.98843 WP_000119443.1.98947 WP_000119443.1.9898 WP_000119443.1.99072 WP_000119443.1.99107 WP_000119443.1.99184 WP_000119443.1.9919 WP_000119443.1.99197 WP_000119443.1.99219 WP_000119443.1.99267 WP_000119443.1.99276 WP_000119443.1.99327 WP_000119443.1.99339 WP_000119443.1.9954 WP_000119443.1.99561 WP_000119443.1.99626 WP_000119443.1.99646 WP_000119443.1.99657 WP_000119443.1.99660 WP_000119443.1.99712 WP_000119443.1.99813 WP_000119443.1.99889 gi|378987678|ref|YP_005250842.1| gi|525816147|ref|YP_008246165.1| 423368.SNSL254_A0305 454169.SeHA_C0317 99287.STM0279

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]