SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378448601|ref|YP_005235960.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378448601|ref|YP_005235960.1|
Domain Number 1 Region: 107-284
Classification Level Classification E-value
Superfamily Phage tail proteins 2.21e-52
Family Baseplate protein-like 0.0006
Further Details:      
 
Domain Number 2 Region: 300-460
Classification Level Classification E-value
Superfamily Phage tail proteins 4.93e-36
Family Baseplate protein-like 0.02
Further Details:      
 
Domain Number 3 Region: 540-714
Classification Level Classification E-value
Superfamily Phage fibre proteins 2.51e-33
Family Tail-associated lysozyme gp5, C-terminal domain 0.052
Further Details:      
 
Domain Number 4 Region: 462-549
Classification Level Classification E-value
Superfamily gp5 N-terminal domain-like 7.85e-33
Family gp4 N-terminal domain-like 0.0015
Further Details:      
 
Weak hits

Sequence:  gi|378448601|ref|YP_005235960.1|
Domain Number - Region: 34-139
Classification Level Classification E-value
Superfamily ALDH-like 0.0112
Family ALDH-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|378448601|ref|YP_005235960.1|
Sequence length 729
Comment putative cytoplasmic protein [Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S]
Sequence
MSFVSTNNKSGMGGLTTTTPPITGESGGVTADSVAGSVADAAESAVEQAAGSLFGALPEP
SGLVKAAVAAAQAAAAAGMAQDAVSAIVSAVAGGPGAHNVTVSGSAVPPGALLFASLDGG
ETLSELFSYVVQLKTPDTLNLGYVSPAANLPLKPMVGKDLCVNIELDGGGKRHISGLVTA
ARVVGHEGRSVTYELRMEPWVKLLTHTSDYKAFQNKTVVDILDEVLAEYPYPVEKRLVES
YPVRTWQVQYGETDFDFLQRLMQEWGIYWWFEHSEDSHTLVLADAISAHKACPDSPLVEW
HQEGLKLDKEFIHTITANESLRTGQWVLDDFDFTKPRSLLANTVANPRETGHATYEHYEW
PGDYFDKSEGEMLTRIRMEAQRSPGSRVLGGGNIRTLMTGYTFTLENYPTAEVNQEYLLM
QTLLFVQDNAQHSGQDQHFTFSTRFELHPTREVFRPQRTVSKPHTKGPQSAIVTGPAGQE
IWTDQYGRVKVQFGWDRYGKMDENSTCWIRVSYPWAGKGFGMIQIPRIGQEVLVDFKNGD
PDLPIIVGRTYNQDTMPPWGLPGMASQSGIFSHSLYGGPTNGNMLRFDDKTGAEEVKFHA
EKDLNTTVKNNETHTVMVDRTKTIIKNETNSIGEDRNTTVTKNDGLSVKLAQTINIGTTY
RLDVGDQFTLRCGNAALVLHKDGSIEFCGKQLMLHTSDVMQLIGKGIDMNPDGGTAVTAD
DIAPLLTSE
Download sequence
Identical sequences A0A0F6AX92 A0A0H3N8F5 A0A0W3N7H4 A0A2H9YC10 E8XIV4 Q93IR3
WP_000011535.1.100484 WP_000011535.1.100597 WP_000011535.1.100871 WP_000011535.1.101404 WP_000011535.1.11098 WP_000011535.1.11458 WP_000011535.1.12370 WP_000011535.1.13106 WP_000011535.1.13932 WP_000011535.1.14239 WP_000011535.1.14379 WP_000011535.1.14466 WP_000011535.1.14852 WP_000011535.1.1489 WP_000011535.1.15124 WP_000011535.1.17307 WP_000011535.1.17480 WP_000011535.1.17705 WP_000011535.1.18776 WP_000011535.1.19320 WP_000011535.1.19706 WP_000011535.1.19749 WP_000011535.1.19802 WP_000011535.1.20 WP_000011535.1.2010 WP_000011535.1.20908 WP_000011535.1.21603 WP_000011535.1.2221 WP_000011535.1.23482 WP_000011535.1.24779 WP_000011535.1.25988 WP_000011535.1.26319 WP_000011535.1.26551 WP_000011535.1.27010 WP_000011535.1.27173 WP_000011535.1.2763 WP_000011535.1.27761 WP_000011535.1.28094 WP_000011535.1.28170 WP_000011535.1.28625 WP_000011535.1.29619 WP_000011535.1.30027 WP_000011535.1.30972 WP_000011535.1.3119 WP_000011535.1.31195 WP_000011535.1.31504 WP_000011535.1.31515 WP_000011535.1.31578 WP_000011535.1.32438 WP_000011535.1.32702 WP_000011535.1.33553 WP_000011535.1.34279 WP_000011535.1.34319 WP_000011535.1.34610 WP_000011535.1.34856 WP_000011535.1.35045 WP_000011535.1.35408 WP_000011535.1.35446 WP_000011535.1.35463 WP_000011535.1.35503 WP_000011535.1.37073 WP_000011535.1.37978 WP_000011535.1.3848 WP_000011535.1.38913 WP_000011535.1.39921 WP_000011535.1.39923 WP_000011535.1.4011 WP_000011535.1.40240 WP_000011535.1.40257 WP_000011535.1.40380 WP_000011535.1.41572 WP_000011535.1.41591 WP_000011535.1.42864 WP_000011535.1.43244 WP_000011535.1.43312 WP_000011535.1.43334 WP_000011535.1.44099 WP_000011535.1.44640 WP_000011535.1.4467 WP_000011535.1.45067 WP_000011535.1.45184 WP_000011535.1.45585 WP_000011535.1.46303 WP_000011535.1.47472 WP_000011535.1.47478 WP_000011535.1.4885 WP_000011535.1.49515 WP_000011535.1.50080 WP_000011535.1.50376 WP_000011535.1.50389 WP_000011535.1.51649 WP_000011535.1.52346 WP_000011535.1.52656 WP_000011535.1.53406 WP_000011535.1.54033 WP_000011535.1.54075 WP_000011535.1.54400 WP_000011535.1.55743 WP_000011535.1.55768 WP_000011535.1.56012 WP_000011535.1.56601 WP_000011535.1.56671 WP_000011535.1.57607 WP_000011535.1.57891 WP_000011535.1.58803 WP_000011535.1.5886 WP_000011535.1.59490 WP_000011535.1.61296 WP_000011535.1.61345 WP_000011535.1.61574 WP_000011535.1.61918 WP_000011535.1.62204 WP_000011535.1.63181 WP_000011535.1.63432 WP_000011535.1.63757 WP_000011535.1.64403 WP_000011535.1.6535 WP_000011535.1.6630 WP_000011535.1.66358 WP_000011535.1.67347 WP_000011535.1.67465 WP_000011535.1.67552 WP_000011535.1.67829 WP_000011535.1.68073 WP_000011535.1.69006 WP_000011535.1.7021 WP_000011535.1.70683 WP_000011535.1.71248 WP_000011535.1.71337 WP_000011535.1.71378 WP_000011535.1.71702 WP_000011535.1.71845 WP_000011535.1.72376 WP_000011535.1.7315 WP_000011535.1.7334 WP_000011535.1.73377 WP_000011535.1.73924 WP_000011535.1.74029 WP_000011535.1.7433 WP_000011535.1.75129 WP_000011535.1.75187 WP_000011535.1.75362 WP_000011535.1.75764 WP_000011535.1.75837 WP_000011535.1.77529 WP_000011535.1.77898 WP_000011535.1.77960 WP_000011535.1.79167 WP_000011535.1.79490 WP_000011535.1.79495 WP_000011535.1.79570 WP_000011535.1.79659 WP_000011535.1.79708 WP_000011535.1.80077 WP_000011535.1.80137 WP_000011535.1.81193 WP_000011535.1.81902 WP_000011535.1.82515 WP_000011535.1.82676 WP_000011535.1.82761 WP_000011535.1.83305 WP_000011535.1.8354 WP_000011535.1.84659 WP_000011535.1.85134 WP_000011535.1.85180 WP_000011535.1.85617 WP_000011535.1.85976 WP_000011535.1.87095 WP_000011535.1.87552 WP_000011535.1.87945 WP_000011535.1.88019 WP_000011535.1.88073 WP_000011535.1.89008 WP_000011535.1.89304 WP_000011535.1.89570 WP_000011535.1.90453 WP_000011535.1.91003 WP_000011535.1.91564 WP_000011535.1.91655 WP_000011535.1.92183 WP_000011535.1.92443 WP_000011535.1.92531 WP_000011535.1.93136 WP_000011535.1.93994 WP_000011535.1.94458 WP_000011535.1.94584 WP_000011535.1.95051 WP_000011535.1.95630 WP_000011535.1.96500 WP_000011535.1.97145 WP_000011535.1.98019 WP_000011535.1.98219 WP_000011535.1.98676 WP_000011535.1.98677 WP_000011535.1.9898 WP_000011535.1.99267 WP_000011535.1.99712 gi|526219220|ref|YP_008264541.1| ABAO01000023|CDS_17468-19657 CP001363|CDS_330558-332747 FN424405|CDS_329844-332033 gi|378698261|ref|YP_005180218.1| gi|378443735|ref|YP_005231367.1| gi|383495105|ref|YP_005395794.1| gi|378448601|ref|YP_005235960.1| gi|378987688|ref|YP_005250852.1| gi|549723007|ref|YP_008643197.1| gi|379699505|ref|YP_005241233.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]