SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378448682|ref|YP_005236041.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378448682|ref|YP_005236041.1|
Domain Number 1 Region: 277-325
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000609
Family AraC type transcriptional activator 0.093
Further Details:      
 
Domain Number 2 Region: 224-275
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000439
Family AraC type transcriptional activator 0.085
Further Details:      
 
Weak hits

Sequence:  gi|378448682|ref|YP_005236041.1|
Domain Number - Region: 71-125
Classification Level Classification E-value
Superfamily RmlC-like cupins 0.0645
Family TM1287-like 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|378448682|ref|YP_005236041.1|
Sequence length 334
Comment putative transcriptional regulator [Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S]
Sequence
MSPISCHSSAAPAMKKIFSVSDFIAFGERYGIDYRFPALPQYTQSSPVLHGDIEEIALPG
GICITRSDVHVLQPYETTSRHSSPLYMLVVLEGNVALAVNEQTFLLSAGMAFCSQLSEQQ
TIRAHHGADSKLRTLSLGMYPDGGWRERLPVSLADEWENSATSARVWQVPEFLLSGLRYA
QQPGPHAASRQLMLEGIMLQLLGYALNLCQPATQKRGLPVTGEYQRLELIRRLLEQTPEK
AYTLNELARRAAMSPSSLRCKFRHAYGCTVFDYLRDCRLARARRYLMEGYSVQQAAWMSG
YQHATNFATAFRRRYGCSPGELRDASLTASRHCA
Download sequence
Identical sequences A0A0D6HAM2 A0A0F6AXH3 A0A0F7J5T1 A0A0H3NHZ7 A0A0M0Q898 A0A0U1FUX0 A0A1C2ZPV5 A0A249V1R8 A0A265B990 A0A2D1XH51 A0A2D1XV54 A0A2D3ALM3 A0A2H9YNB1 E8XJR2 Q8ZRG0
gi|378448682|ref|YP_005236041.1| gi|198245639|ref|YP_002214315.1| gi|16763743|ref|NP_459358.1| gi|525841039|ref|YP_008256398.1| gi|526221989|ref|YP_008264613.1| gi|378698327|ref|YP_005180284.1| gi|386590296|ref|YP_006086696.1| gi|550899817|ref|YP_008668909.1| gi|207855845|ref|YP_002242496.1| gi|378982966|ref|YP_005246121.1| ABAO01000012|CDS_29147-30151 ABEL01000001|CDS_156285-157289 ABFG01000003|CDS_321332-320328 ABFH02000002|CDS_1722846-1721842 AE006468|CDS_411513-412517 AM933172|CDS_390820-391824 CP001120|CDS_458640-459644 CP001144|CDS_414906-415910 CP001363|CDS_412206-413210 FN424405|CDS_452017-453021 NZ_ACBF01000006|CDS_202467-201463 439851.SeD_A0394 454169.SeHA_C0457 550537.SEN0346 99287.STM0363 gi|549723077|ref|YP_008643267.1| gi|379699578|ref|YP_005241306.1| gi|525949650|ref|YP_008309793.1| NP_459358.1.58477 WP_000074605.1.100010 WP_000074605.1.100017 WP_000074605.1.100077 WP_000074605.1.100115 WP_000074605.1.100149 WP_000074605.1.100191 WP_000074605.1.100234 WP_000074605.1.100376 WP_000074605.1.100392 WP_000074605.1.100412 WP_000074605.1.100424 WP_000074605.1.100436 WP_000074605.1.100438 WP_000074605.1.100457 WP_000074605.1.100484 WP_000074605.1.100488 WP_000074605.1.100519 WP_000074605.1.100521 WP_000074605.1.100557 WP_000074605.1.100597 WP_000074605.1.100605 WP_000074605.1.100642 WP_000074605.1.100714 WP_000074605.1.100730 WP_000074605.1.10076 WP_000074605.1.100776 WP_000074605.1.100781 WP_000074605.1.100793 WP_000074605.1.10081 WP_000074605.1.100814 WP_000074605.1.100857 WP_000074605.1.100869 WP_000074605.1.100870 WP_000074605.1.100871 WP_000074605.1.100882 WP_000074605.1.100895 WP_000074605.1.100948 WP_000074605.1.101007 WP_000074605.1.101020 WP_000074605.1.101074 WP_000074605.1.101078 WP_000074605.1.101112 WP_000074605.1.101180 WP_000074605.1.101185 WP_000074605.1.101259 WP_000074605.1.101284 WP_000074605.1.101291 WP_000074605.1.1013 WP_000074605.1.101353 WP_000074605.1.101386 WP_000074605.1.101404 WP_000074605.1.101420 WP_000074605.1.101541 WP_000074605.1.101589 WP_000074605.1.101634 WP_000074605.1.101674 WP_000074605.1.101707 WP_000074605.1.101724 WP_000074605.1.101734 WP_000074605.1.101741 WP_000074605.1.101815 WP_000074605.1.101832 WP_000074605.1.101878 WP_000074605.1.101917 WP_000074605.1.101927 WP_000074605.1.101953 WP_000074605.1.102111 WP_000074605.1.10220 WP_000074605.1.10231 WP_000074605.1.10266 WP_000074605.1.10300 WP_000074605.1.10429 WP_000074605.1.10439 WP_000074605.1.10465 WP_000074605.1.10498 WP_000074605.1.10566 WP_000074605.1.10568 WP_000074605.1.10631 WP_000074605.1.10678 WP_000074605.1.10753 WP_000074605.1.10755 WP_000074605.1.10868 WP_000074605.1.10898 WP_000074605.1.10992 WP_000074605.1.11024 WP_000074605.1.11031 WP_000074605.1.11098 WP_000074605.1.1110 WP_000074605.1.11119 WP_000074605.1.11156 WP_000074605.1.11168 WP_000074605.1.11190 WP_000074605.1.11216 WP_000074605.1.11254 WP_000074605.1.11295 WP_000074605.1.11362 WP_000074605.1.1137 WP_000074605.1.11455 WP_000074605.1.11458 WP_000074605.1.11479 WP_000074605.1.1150 WP_000074605.1.11511 WP_000074605.1.11518 WP_000074605.1.11526 WP_000074605.1.11528 WP_000074605.1.11532 WP_000074605.1.11543 WP_000074605.1.1156 WP_000074605.1.11588 WP_000074605.1.11603 WP_000074605.1.11677 WP_000074605.1.11687 WP_000074605.1.1169 WP_000074605.1.11735 WP_000074605.1.1174 WP_000074605.1.11763 WP_000074605.1.11772 WP_000074605.1.11824 WP_000074605.1.11834 WP_000074605.1.11841 WP_000074605.1.11865 WP_000074605.1.11875 WP_000074605.1.11897 WP_000074605.1.11900 WP_000074605.1.11936 WP_000074605.1.11978 WP_000074605.1.12017 WP_000074605.1.12027 WP_000074605.1.12106 WP_000074605.1.12114 WP_000074605.1.1215 WP_000074605.1.12168 WP_000074605.1.12244 WP_000074605.1.12282 WP_000074605.1.12340 WP_000074605.1.12351 WP_000074605.1.12370 WP_000074605.1.12374 WP_000074605.1.1239 WP_000074605.1.12397 WP_000074605.1.12456 WP_000074605.1.12484 WP_000074605.1.12485 WP_000074605.1.12546 WP_000074605.1.12568 WP_000074605.1.12569 WP_000074605.1.12584 WP_000074605.1.12585 WP_000074605.1.1264 WP_000074605.1.12696 WP_000074605.1.12718 WP_000074605.1.12728 WP_000074605.1.12936 WP_000074605.1.12995 WP_000074605.1.1300 WP_000074605.1.13027 WP_000074605.1.13076 WP_000074605.1.13102 WP_000074605.1.13106 WP_000074605.1.13130 WP_000074605.1.13207 WP_000074605.1.13247 WP_000074605.1.13274 WP_000074605.1.13311 WP_000074605.1.13367 WP_000074605.1.13391 WP_000074605.1.13414 WP_000074605.1.1346 WP_000074605.1.13488 WP_000074605.1.13509 WP_000074605.1.13573 WP_000074605.1.13625 WP_000074605.1.13661 WP_000074605.1.13669 WP_000074605.1.13691 WP_000074605.1.13741 WP_000074605.1.13908 WP_000074605.1.13932 WP_000074605.1.13968 WP_000074605.1.14001 WP_000074605.1.14041 WP_000074605.1.14111 WP_000074605.1.1412 WP_000074605.1.14151 WP_000074605.1.14239 WP_000074605.1.14286 WP_000074605.1.14320 WP_000074605.1.14379 WP_000074605.1.14406 WP_000074605.1.14410 WP_000074605.1.14436 WP_000074605.1.14458 WP_000074605.1.14466 WP_000074605.1.14505 WP_000074605.1.14516 WP_000074605.1.14524 WP_000074605.1.14554 WP_000074605.1.146 WP_000074605.1.14618 WP_000074605.1.14708 WP_000074605.1.14725 WP_000074605.1.14737 WP_000074605.1.14789 WP_000074605.1.14793 WP_000074605.1.14819 WP_000074605.1.14852 WP_000074605.1.1489 WP_000074605.1.14913 WP_000074605.1.14932 WP_000074605.1.15055 WP_000074605.1.15067 WP_000074605.1.15079 WP_000074605.1.15100 WP_000074605.1.15102 WP_000074605.1.15124 WP_000074605.1.15214 WP_000074605.1.15223 WP_000074605.1.15226 WP_000074605.1.15276 WP_000074605.1.15316 WP_000074605.1.15318 WP_000074605.1.15369 WP_000074605.1.1540 WP_000074605.1.15508 WP_000074605.1.15585 WP_000074605.1.15586 WP_000074605.1.1568 WP_000074605.1.15775 WP_000074605.1.15777 WP_000074605.1.15784 WP_000074605.1.15830 WP_000074605.1.15862 WP_000074605.1.15909 WP_000074605.1.15910 WP_000074605.1.1592 WP_000074605.1.15986 WP_000074605.1.16004 WP_000074605.1.1601 WP_000074605.1.16047 WP_000074605.1.16062 WP_000074605.1.16063 WP_000074605.1.16103 WP_000074605.1.16172 WP_000074605.1.16226 WP_000074605.1.16233 WP_000074605.1.16284 WP_000074605.1.16328 WP_000074605.1.1635 WP_000074605.1.16361 WP_000074605.1.16363 WP_000074605.1.16365 WP_000074605.1.16366 WP_000074605.1.16394 WP_000074605.1.16453 WP_000074605.1.16468 WP_000074605.1.16474 WP_000074605.1.16525 WP_000074605.1.16581 WP_000074605.1.16614 WP_000074605.1.16650 WP_000074605.1.1668 WP_000074605.1.16686 WP_000074605.1.16691 WP_000074605.1.16729 WP_000074605.1.16732 WP_000074605.1.16735 WP_000074605.1.16786 WP_000074605.1.16819 WP_000074605.1.16858 WP_000074605.1.16873 WP_000074605.1.16896 WP_000074605.1.16903 WP_000074605.1.16916 WP_000074605.1.16949 WP_000074605.1.16965 WP_000074605.1.16972 WP_000074605.1.1700 WP_000074605.1.17060 WP_000074605.1.17093 WP_000074605.1.17096 WP_000074605.1.17105 WP_000074605.1.17307 WP_000074605.1.1733 WP_000074605.1.1737 WP_000074605.1.17390 WP_000074605.1.174 WP_000074605.1.17439 WP_000074605.1.17480 WP_000074605.1.17482 WP_000074605.1.17525 WP_000074605.1.17546 WP_000074605.1.17560 WP_000074605.1.17583 WP_000074605.1.17693 WP_000074605.1.17702 WP_000074605.1.17703 WP_000074605.1.17705 WP_000074605.1.17732 WP_000074605.1.17743 WP_000074605.1.17865 WP_000074605.1.17886 WP_000074605.1.17901 WP_000074605.1.17914 WP_000074605.1.17936 WP_000074605.1.1798 WP_000074605.1.18019 WP_000074605.1.18056 WP_000074605.1.18061 WP_000074605.1.18092 WP_000074605.1.18109 WP_000074605.1.18111 WP_000074605.1.18122 WP_000074605.1.18149 WP_000074605.1.18163 WP_000074605.1.1818 WP_000074605.1.18192 WP_000074605.1.18249 WP_000074605.1.18254 WP_000074605.1.18265 WP_000074605.1.18267 WP_000074605.1.18384 WP_000074605.1.18426 WP_000074605.1.18468 WP_000074605.1.18607 WP_000074605.1.18641 WP_000074605.1.18686 WP_000074605.1.18705 WP_000074605.1.18715 WP_000074605.1.18737 WP_000074605.1.18776 WP_000074605.1.18822 WP_000074605.1.18847 WP_000074605.1.18881 WP_000074605.1.18886 WP_000074605.1.18940 WP_000074605.1.18949 WP_000074605.1.1895 WP_000074605.1.18972 WP_000074605.1.19030 WP_000074605.1.19053 WP_000074605.1.19093 WP_000074605.1.19240 WP_000074605.1.19273 WP_000074605.1.19320 WP_000074605.1.19357 WP_000074605.1.19373 WP_000074605.1.19433 WP_000074605.1.19458 WP_000074605.1.19460 WP_000074605.1.19461 WP_000074605.1.1955 WP_000074605.1.19588 WP_000074605.1.19614 WP_000074605.1.19616 WP_000074605.1.19656 WP_000074605.1.19702 WP_000074605.1.19706 WP_000074605.1.19723 WP_000074605.1.19724 WP_000074605.1.19749 WP_000074605.1.19784 WP_000074605.1.19793 WP_000074605.1.19802 WP_000074605.1.19809 WP_000074605.1.19834 WP_000074605.1.19867 WP_000074605.1.1990 WP_000074605.1.19975 WP_000074605.1.1998 WP_000074605.1.20 WP_000074605.1.20034 WP_000074605.1.20086 WP_000074605.1.2010 WP_000074605.1.20212 WP_000074605.1.20261 WP_000074605.1.20266 WP_000074605.1.20271 WP_000074605.1.20362 WP_000074605.1.2041 WP_000074605.1.20418 WP_000074605.1.20437 WP_000074605.1.20443 WP_000074605.1.20446 WP_000074605.1.20503 WP_000074605.1.20525 WP_000074605.1.2054 WP_000074605.1.20553 WP_000074605.1.20614 WP_000074605.1.20626 WP_000074605.1.20631 WP_000074605.1.20646 WP_000074605.1.20721 WP_000074605.1.20760 WP_000074605.1.20767 WP_000074605.1.20839 WP_000074605.1.20886 WP_000074605.1.20908 WP_000074605.1.21049 WP_000074605.1.2107 WP_000074605.1.21079 WP_000074605.1.21089 WP_000074605.1.21103 WP_000074605.1.21136 WP_000074605.1.21146 WP_000074605.1.2116 WP_000074605.1.21194 WP_000074605.1.21202 WP_000074605.1.21241 WP_000074605.1.21245 WP_000074605.1.21246 WP_000074605.1.21269 WP_000074605.1.21309 WP_000074605.1.21326 WP_000074605.1.21332 WP_000074605.1.21351 WP_000074605.1.21400 WP_000074605.1.21497 WP_000074605.1.21499 WP_000074605.1.21603 WP_000074605.1.21616 WP_000074605.1.21681 WP_000074605.1.21692 WP_000074605.1.21715 WP_000074605.1.21730 WP_000074605.1.21751 WP_000074605.1.21757 WP_000074605.1.21825 WP_000074605.1.21909 WP_000074605.1.21950 WP_000074605.1.21981 WP_000074605.1.21991 WP_000074605.1.22024 WP_000074605.1.2205 WP_000074605.1.22051 WP_000074605.1.22062 WP_000074605.1.22067 WP_000074605.1.22096 WP_000074605.1.22136 WP_000074605.1.22158 WP_000074605.1.22162 WP_000074605.1.22169 WP_000074605.1.2221 WP_000074605.1.22235 WP_000074605.1.2224 WP_000074605.1.22240 WP_000074605.1.22296 WP_000074605.1.22323 WP_000074605.1.22346 WP_000074605.1.2235 WP_000074605.1.22379 WP_000074605.1.22427 WP_000074605.1.22449 WP_000074605.1.22454 WP_000074605.1.2246 WP_000074605.1.22460 WP_000074605.1.22485 WP_000074605.1.22575 WP_000074605.1.22582 WP_000074605.1.22590 WP_000074605.1.22595 WP_000074605.1.22605 WP_000074605.1.22620 WP_000074605.1.22676 WP_000074605.1.22692 WP_000074605.1.22758 WP_000074605.1.22760 WP_000074605.1.2283 WP_000074605.1.22845 WP_000074605.1.22857 WP_000074605.1.22864 WP_000074605.1.22870 WP_000074605.1.22880 WP_000074605.1.22902 WP_000074605.1.22947 WP_000074605.1.22979 WP_000074605.1.23102 WP_000074605.1.23114 WP_000074605.1.2314 WP_000074605.1.23172 WP_000074605.1.23192 WP_000074605.1.2324 WP_000074605.1.23246 WP_000074605.1.23259 WP_000074605.1.23329 WP_000074605.1.23379 WP_000074605.1.2342 WP_000074605.1.23442 WP_000074605.1.23444 WP_000074605.1.23460 WP_000074605.1.23466 WP_000074605.1.23472 WP_000074605.1.23482 WP_000074605.1.23509 WP_000074605.1.23513 WP_000074605.1.2358 WP_000074605.1.23621 WP_000074605.1.23631 WP_000074605.1.23634 WP_000074605.1.2364 WP_000074605.1.23643 WP_000074605.1.23685 WP_000074605.1.23746 WP_000074605.1.2376 WP_000074605.1.23932 WP_000074605.1.23959 WP_000074605.1.24017 WP_000074605.1.24082 WP_000074605.1.24145 WP_000074605.1.24206 WP_000074605.1.24214 WP_000074605.1.24250 WP_000074605.1.24259 WP_000074605.1.24297 WP_000074605.1.24308 WP_000074605.1.24325 WP_000074605.1.24361 WP_000074605.1.24376 WP_000074605.1.24392 WP_000074605.1.24408 WP_000074605.1.24409 WP_000074605.1.24419 WP_000074605.1.24450 WP_000074605.1.24476 WP_000074605.1.24494 WP_000074605.1.24555 WP_000074605.1.24578 WP_000074605.1.2467 WP_000074605.1.24673 WP_000074605.1.24737 WP_000074605.1.24779 WP_000074605.1.24803 WP_000074605.1.24901 WP_000074605.1.24944 WP_000074605.1.24995 WP_000074605.1.25008 WP_000074605.1.25015 WP_000074605.1.25119 WP_000074605.1.25159 WP_000074605.1.25175 WP_000074605.1.25354 WP_000074605.1.25405 WP_000074605.1.25421 WP_000074605.1.25426 WP_000074605.1.25454 WP_000074605.1.25493 WP_000074605.1.25498 WP_000074605.1.2554 WP_000074605.1.25618 WP_000074605.1.25668 WP_000074605.1.2568 WP_000074605.1.25690 WP_000074605.1.2570 WP_000074605.1.25709 WP_000074605.1.25740 WP_000074605.1.25780 WP_000074605.1.25793 WP_000074605.1.25814 WP_000074605.1.25951 WP_000074605.1.25988 WP_000074605.1.26030 WP_000074605.1.26083 WP_000074605.1.26194 WP_000074605.1.26199 WP_000074605.1.26282 WP_000074605.1.26311 WP_000074605.1.26319 WP_000074605.1.2634 WP_000074605.1.26384 WP_000074605.1.26429 WP_000074605.1.26440 WP_000074605.1.26441 WP_000074605.1.26493 WP_000074605.1.26532 WP_000074605.1.26551 WP_000074605.1.26567 WP_000074605.1.26576 WP_000074605.1.26587 WP_000074605.1.2667 WP_000074605.1.26687 WP_000074605.1.2672 WP_000074605.1.26741 WP_000074605.1.26794 WP_000074605.1.26919 WP_000074605.1.26924 WP_000074605.1.26936 WP_000074605.1.26980 WP_000074605.1.27010 WP_000074605.1.27055 WP_000074605.1.27084 WP_000074605.1.27173 WP_000074605.1.27206 WP_000074605.1.27223 WP_000074605.1.27255 WP_000074605.1.27272 WP_000074605.1.27279 WP_000074605.1.27314 WP_000074605.1.27342 WP_000074605.1.27383 WP_000074605.1.27423 WP_000074605.1.27513 WP_000074605.1.27523 WP_000074605.1.27544 WP_000074605.1.27547 WP_000074605.1.27556 WP_000074605.1.27561 WP_000074605.1.27616 WP_000074605.1.2763 WP_000074605.1.27632 WP_000074605.1.27638 WP_000074605.1.27658 WP_000074605.1.27665 WP_000074605.1.27679 WP_000074605.1.27707 WP_000074605.1.27761 WP_000074605.1.2777 WP_000074605.1.27776 WP_000074605.1.27800 WP_000074605.1.27815 WP_000074605.1.27833 WP_000074605.1.27857 WP_000074605.1.27883 WP_000074605.1.27969 WP_000074605.1.27977 WP_000074605.1.27995 WP_000074605.1.28032 WP_000074605.1.28037 WP_000074605.1.28056 WP_000074605.1.28094 WP_000074605.1.28116 WP_000074605.1.28139 WP_000074605.1.28170 WP_000074605.1.28200 WP_000074605.1.28232 WP_000074605.1.28233 WP_000074605.1.2825 WP_000074605.1.28301 WP_000074605.1.28302 WP_000074605.1.28303 WP_000074605.1.2835 WP_000074605.1.28370 WP_000074605.1.28393 WP_000074605.1.28462 WP_000074605.1.28514 WP_000074605.1.2853 WP_000074605.1.28538 WP_000074605.1.28570 WP_000074605.1.28575 WP_000074605.1.28620 WP_000074605.1.28625 WP_000074605.1.28655 WP_000074605.1.28694 WP_000074605.1.28773 WP_000074605.1.28775 WP_000074605.1.2879 WP_000074605.1.2890 WP_000074605.1.28946 WP_000074605.1.29006 WP_000074605.1.29010 WP_000074605.1.2910 WP_000074605.1.29113 WP_000074605.1.29168 WP_000074605.1.29218 WP_000074605.1.2924 WP_000074605.1.29274 WP_000074605.1.2932 WP_000074605.1.29379 WP_000074605.1.29422 WP_000074605.1.29436 WP_000074605.1.29509 WP_000074605.1.29530 WP_000074605.1.29576 WP_000074605.1.29588 WP_000074605.1.29601 WP_000074605.1.29606 WP_000074605.1.29615 WP_000074605.1.29619 WP_000074605.1.29682 WP_000074605.1.29704 WP_000074605.1.29768 WP_000074605.1.29827 WP_000074605.1.29923 WP_000074605.1.29924 WP_000074605.1.29969 WP_000074605.1.29990 WP_000074605.1.30006 WP_000074605.1.30022 WP_000074605.1.30027 WP_000074605.1.3005 WP_000074605.1.30059 WP_000074605.1.30165 WP_000074605.1.30180 WP_000074605.1.30202 WP_000074605.1.30210 WP_000074605.1.30246 WP_000074605.1.30278 WP_000074605.1.30469 WP_000074605.1.30492 WP_000074605.1.30505 WP_000074605.1.30507 WP_000074605.1.30535 WP_000074605.1.30547 WP_000074605.1.30548 WP_000074605.1.30573 WP_000074605.1.30589 WP_000074605.1.30619 WP_000074605.1.30627 WP_000074605.1.3067 WP_000074605.1.30752 WP_000074605.1.3076 WP_000074605.1.30794 WP_000074605.1.3080 WP_000074605.1.30833 WP_000074605.1.30835 WP_000074605.1.30934 WP_000074605.1.30968 WP_000074605.1.30972 WP_000074605.1.31 WP_000074605.1.31092 WP_000074605.1.31107 WP_000074605.1.31122 WP_000074605.1.3113 WP_000074605.1.31167 WP_000074605.1.31185 WP_000074605.1.3119 WP_000074605.1.31190 WP_000074605.1.31195 WP_000074605.1.31196 WP_000074605.1.3127 WP_000074605.1.31272 WP_000074605.1.31281 WP_000074605.1.31335 WP_000074605.1.31362 WP_000074605.1.31435 WP_000074605.1.31451 WP_000074605.1.31504 WP_000074605.1.31515 WP_000074605.1.31578 WP_000074605.1.31585 WP_000074605.1.31658 WP_000074605.1.3167 WP_000074605.1.31725 WP_000074605.1.31762 WP_000074605.1.31845 WP_000074605.1.31895 WP_000074605.1.31901 WP_000074605.1.31927 WP_000074605.1.31940 WP_000074605.1.31967 WP_000074605.1.31972 WP_000074605.1.31983 WP_000074605.1.32109 WP_000074605.1.32116 WP_000074605.1.32192 WP_000074605.1.32206 WP_000074605.1.32252 WP_000074605.1.32260 WP_000074605.1.32274 WP_000074605.1.32309 WP_000074605.1.32424 WP_000074605.1.32438 WP_000074605.1.32515 WP_000074605.1.32519 WP_000074605.1.32660 WP_000074605.1.32668 WP_000074605.1.32702 WP_000074605.1.32714 WP_000074605.1.32740 WP_000074605.1.32747 WP_000074605.1.32786 WP_000074605.1.32804 WP_000074605.1.32832 WP_000074605.1.32881 WP_000074605.1.32899 WP_000074605.1.32902 WP_000074605.1.32907 WP_000074605.1.32977 WP_000074605.1.33030 WP_000074605.1.33078 WP_000074605.1.33127 WP_000074605.1.33143 WP_000074605.1.33248 WP_000074605.1.33253 WP_000074605.1.33261 WP_000074605.1.33270 WP_000074605.1.333 WP_000074605.1.33409 WP_000074605.1.33492 WP_000074605.1.335 WP_000074605.1.33553 WP_000074605.1.3356 WP_000074605.1.33580 WP_000074605.1.33586 WP_000074605.1.33592 WP_000074605.1.33609 WP_000074605.1.3364 WP_000074605.1.33817 WP_000074605.1.33865 WP_000074605.1.33894 WP_000074605.1.3394 WP_000074605.1.3396 WP_000074605.1.34 WP_000074605.1.34043 WP_000074605.1.34075 WP_000074605.1.34091 WP_000074605.1.34185 WP_000074605.1.34257 WP_000074605.1.34279 WP_000074605.1.34292 WP_000074605.1.34319 WP_000074605.1.3438 WP_000074605.1.34417 WP_000074605.1.34431 WP_000074605.1.34453 WP_000074605.1.34454 WP_000074605.1.34610 WP_000074605.1.34614 WP_000074605.1.34667 WP_000074605.1.34684 WP_000074605.1.34711 WP_000074605.1.34745 WP_000074605.1.34817 WP_000074605.1.34820 WP_000074605.1.34856 WP_000074605.1.34975 WP_000074605.1.35035 WP_000074605.1.35045 WP_000074605.1.35075 WP_000074605.1.35129 WP_000074605.1.35184 WP_000074605.1.35193 WP_000074605.1.35298 WP_000074605.1.35321 WP_000074605.1.35332 WP_000074605.1.35404 WP_000074605.1.35408 WP_000074605.1.3541 WP_000074605.1.35425 WP_000074605.1.35446 WP_000074605.1.35460 WP_000074605.1.35463 WP_000074605.1.35503 WP_000074605.1.35509 WP_000074605.1.3556 WP_000074605.1.35563 WP_000074605.1.35570 WP_000074605.1.35590 WP_000074605.1.35594 WP_000074605.1.35619 WP_000074605.1.35624 WP_000074605.1.35648 WP_000074605.1.3566 WP_000074605.1.3572 WP_000074605.1.35887 WP_000074605.1.35892 WP_000074605.1.35936 WP_000074605.1.35940 WP_000074605.1.35961 WP_000074605.1.36003 WP_000074605.1.3601 WP_000074605.1.36017 WP_000074605.1.36037 WP_000074605.1.36063 WP_000074605.1.3610 WP_000074605.1.36409 WP_000074605.1.36445 WP_000074605.1.36547 WP_000074605.1.36584 WP_000074605.1.36609 WP_000074605.1.36685 WP_000074605.1.36690 WP_000074605.1.3670 WP_000074605.1.36705 WP_000074605.1.36721 WP_000074605.1.36764 WP_000074605.1.3688 WP_000074605.1.36889 WP_000074605.1.36899 WP_000074605.1.36918 WP_000074605.1.36931 WP_000074605.1.36978 WP_000074605.1.37013 WP_000074605.1.37029 WP_000074605.1.37073 WP_000074605.1.37111 WP_000074605.1.37112 WP_000074605.1.37114 WP_000074605.1.37191 WP_000074605.1.37256 WP_000074605.1.3726 WP_000074605.1.37293 WP_000074605.1.37297 WP_000074605.1.37370 WP_000074605.1.37376 WP_000074605.1.37405 WP_000074605.1.3744 WP_000074605.1.3748 WP_000074605.1.37498 WP_000074605.1.37504 WP_000074605.1.37521 WP_000074605.1.37618 WP_000074605.1.3771 WP_000074605.1.37719 WP_000074605.1.3778 WP_000074605.1.37864 WP_000074605.1.3790 WP_000074605.1.37968 WP_000074605.1.37978 WP_000074605.1.38001 WP_000074605.1.38037 WP_000074605.1.38047 WP_000074605.1.38125 WP_000074605.1.38145 WP_000074605.1.383 WP_000074605.1.38344 WP_000074605.1.38393 WP_000074605.1.38408 WP_000074605.1.3848 WP_000074605.1.38569 WP_000074605.1.38613 WP_000074605.1.38673 WP_000074605.1.38693 WP_000074605.1.38773 WP_000074605.1.38781 WP_000074605.1.38797 WP_000074605.1.38881 WP_000074605.1.38882 WP_000074605.1.38895 WP_000074605.1.38913 WP_000074605.1.38942 WP_000074605.1.39003 WP_000074605.1.39048 WP_000074605.1.39055 WP_000074605.1.39065 WP_000074605.1.39113 WP_000074605.1.39136 WP_000074605.1.39197 WP_000074605.1.39229 WP_000074605.1.39265 WP_000074605.1.39312 WP_000074605.1.39385 WP_000074605.1.39395 WP_000074605.1.39405 WP_000074605.1.39414 WP_000074605.1.39420 WP_000074605.1.39449 WP_000074605.1.39471 WP_000074605.1.39512 WP_000074605.1.39553 WP_000074605.1.39584 WP_000074605.1.39614 WP_000074605.1.39629 WP_000074605.1.39723 WP_000074605.1.39724 WP_000074605.1.39763 WP_000074605.1.39862 WP_000074605.1.39921 WP_000074605.1.39923 WP_000074605.1.40017 WP_000074605.1.40072 WP_000074605.1.40073 WP_000074605.1.40081 WP_000074605.1.4011 WP_000074605.1.40158 WP_000074605.1.40205 WP_000074605.1.40208 WP_000074605.1.40229 WP_000074605.1.40240 WP_000074605.1.40254 WP_000074605.1.40257 WP_000074605.1.40284 WP_000074605.1.40292 WP_000074605.1.40305 WP_000074605.1.40307 WP_000074605.1.40311 WP_000074605.1.40341 WP_000074605.1.40374 WP_000074605.1.40380 WP_000074605.1.40395 WP_000074605.1.40465 WP_000074605.1.40493 WP_000074605.1.40533 WP_000074605.1.40577 WP_000074605.1.40583 WP_000074605.1.40622 WP_000074605.1.40695 WP_000074605.1.40710 WP_000074605.1.40745 WP_000074605.1.4075 WP_000074605.1.40849 WP_000074605.1.4087 WP_000074605.1.40877 WP_000074605.1.40930 WP_000074605.1.40973 WP_000074605.1.40979 WP_000074605.1.40996 WP_000074605.1.41017 WP_000074605.1.41018 WP_000074605.1.41048 WP_000074605.1.41050 WP_000074605.1.41086 WP_000074605.1.41091 WP_000074605.1.41116 WP_000074605.1.41128 WP_000074605.1.41192 WP_000074605.1.41226 WP_000074605.1.41277 WP_000074605.1.41279 WP_000074605.1.41345 WP_000074605.1.4141 WP_000074605.1.41427 WP_000074605.1.41434 WP_000074605.1.41516 WP_000074605.1.41528 WP_000074605.1.41554 WP_000074605.1.41572 WP_000074605.1.41591 WP_000074605.1.41610 WP_000074605.1.41662 WP_000074605.1.41688 WP_000074605.1.41690 WP_000074605.1.41708 WP_000074605.1.41761 WP_000074605.1.41799 WP_000074605.1.41882 WP_000074605.1.41911 WP_000074605.1.41949 WP_000074605.1.41978 WP_000074605.1.41979 WP_000074605.1.41985 WP_000074605.1.41994 WP_000074605.1.42104 WP_000074605.1.42136 WP_000074605.1.42156 WP_000074605.1.422 WP_000074605.1.4222 WP_000074605.1.42243 WP_000074605.1.42263 WP_000074605.1.42276 WP_000074605.1.42320 WP_000074605.1.42322 WP_000074605.1.42328 WP_000074605.1.42342 WP_000074605.1.4239 WP_000074605.1.42392 WP_000074605.1.42422 WP_000074605.1.42444 WP_000074605.1.42491 WP_000074605.1.42666 WP_000074605.1.42675 WP_000074605.1.42676 WP_000074605.1.42683 WP_000074605.1.42707 WP_000074605.1.42734 WP_000074605.1.4276 WP_000074605.1.42767 WP_000074605.1.42864 WP_000074605.1.4288 WP_000074605.1.4289 WP_000074605.1.42892 WP_000074605.1.42932 WP_000074605.1.42957 WP_000074605.1.43018 WP_000074605.1.43041 WP_000074605.1.43077 WP_000074605.1.43160 WP_000074605.1.43201 WP_000074605.1.43244 WP_000074605.1.43276 WP_000074605.1.43299 WP_000074605.1.43312 WP_000074605.1.4332 WP_000074605.1.43334 WP_000074605.1.43339 WP_000074605.1.43371 WP_000074605.1.43437 WP_000074605.1.43438 WP_000074605.1.4344 WP_000074605.1.43441 WP_000074605.1.43476 WP_000074605.1.43508 WP_000074605.1.43522 WP_000074605.1.43535 WP_000074605.1.43613 WP_000074605.1.43668 WP_000074605.1.43685 WP_000074605.1.43710 WP_000074605.1.43711 WP_000074605.1.43778 WP_000074605.1.43785 WP_000074605.1.43873 WP_000074605.1.43886 WP_000074605.1.43951 WP_000074605.1.44005 WP_000074605.1.44010 WP_000074605.1.44043 WP_000074605.1.44099 WP_000074605.1.44121 WP_000074605.1.44191 WP_000074605.1.44291 WP_000074605.1.44300 WP_000074605.1.44310 WP_000074605.1.44337 WP_000074605.1.44386 WP_000074605.1.44397 WP_000074605.1.44433 WP_000074605.1.44438 WP_000074605.1.44474 WP_000074605.1.44479 WP_000074605.1.44578 WP_000074605.1.44640 WP_000074605.1.4467 WP_000074605.1.44705 WP_000074605.1.44747 WP_000074605.1.44831 WP_000074605.1.4485 WP_000074605.1.44877 WP_000074605.1.44887 WP_000074605.1.44927 WP_000074605.1.44933 WP_000074605.1.44966 WP_000074605.1.44978 WP_000074605.1.44997 WP_000074605.1.4500 WP_000074605.1.45067 WP_000074605.1.45074 WP_000074605.1.45079 WP_000074605.1.45098 WP_000074605.1.45145 WP_000074605.1.45173 WP_000074605.1.45177 WP_000074605.1.45184 WP_000074605.1.45259 WP_000074605.1.45302 WP_000074605.1.4531 WP_000074605.1.45349 WP_000074605.1.45365 WP_000074605.1.45432 WP_000074605.1.45434 WP_000074605.1.45468 WP_000074605.1.45522 WP_000074605.1.45549 WP_000074605.1.45550 WP_000074605.1.45569 WP_000074605.1.45571 WP_000074605.1.45582 WP_000074605.1.45583 WP_000074605.1.45585 WP_000074605.1.45622 WP_000074605.1.45660 WP_000074605.1.45690 WP_000074605.1.458 WP_000074605.1.45844 WP_000074605.1.45848 WP_000074605.1.45906 WP_000074605.1.45918 WP_000074605.1.4592 WP_000074605.1.46011 WP_000074605.1.46028 WP_000074605.1.46069 WP_000074605.1.46091 WP_000074605.1.46112 WP_000074605.1.46173 WP_000074605.1.46174 WP_000074605.1.46187 WP_000074605.1.46215 WP_000074605.1.46243 WP_000074605.1.46278 WP_000074605.1.46286 WP_000074605.1.46303 WP_000074605.1.46322 WP_000074605.1.46345 WP_000074605.1.46434 WP_000074605.1.46499 WP_000074605.1.46574 WP_000074605.1.46578 WP_000074605.1.46595 WP_000074605.1.46666 WP_000074605.1.46675 WP_000074605.1.46689 WP_000074605.1.46693 WP_000074605.1.46726 WP_000074605.1.46732 WP_000074605.1.4674 WP_000074605.1.46803 WP_000074605.1.4686 WP_000074605.1.46967 WP_000074605.1.46976 WP_000074605.1.47008 WP_000074605.1.47057 WP_000074605.1.47214 WP_000074605.1.47429 WP_000074605.1.47448 WP_000074605.1.4747 WP_000074605.1.47472 WP_000074605.1.47478 WP_000074605.1.47507 WP_000074605.1.47567 WP_000074605.1.47576 WP_000074605.1.47579 WP_000074605.1.4758 WP_000074605.1.47587 WP_000074605.1.47621 WP_000074605.1.47649 WP_000074605.1.47799 WP_000074605.1.47814 WP_000074605.1.47817 WP_000074605.1.47829 WP_000074605.1.47849 WP_000074605.1.47850 WP_000074605.1.47875 WP_000074605.1.47911 WP_000074605.1.47928 WP_000074605.1.4795 WP_000074605.1.47988 WP_000074605.1.48132 WP_000074605.1.48209 WP_000074605.1.48242 WP_000074605.1.48253 WP_000074605.1.48268 WP_000074605.1.483 WP_000074605.1.48367 WP_000074605.1.48377 WP_000074605.1.4839 WP_000074605.1.48493 WP_000074605.1.4853 WP_000074605.1.48570 WP_000074605.1.48788 WP_000074605.1.48797 WP_000074605.1.4885 WP_000074605.1.48886 WP_000074605.1.48894 WP_000074605.1.48919 WP_000074605.1.48985 WP_000074605.1.49005 WP_000074605.1.49113 WP_000074605.1.49155 WP_000074605.1.49204 WP_000074605.1.49239 WP_000074605.1.49256 WP_000074605.1.49276 WP_000074605.1.49290 WP_000074605.1.49304 WP_000074605.1.49311 WP_000074605.1.49334 WP_000074605.1.49340 WP_000074605.1.49366 WP_000074605.1.49490 WP_000074605.1.49515 WP_000074605.1.49550 WP_000074605.1.49572 WP_000074605.1.49590 WP_000074605.1.49647 WP_000074605.1.49686 WP_000074605.1.49770 WP_000074605.1.49778 WP_000074605.1.4979 WP_000074605.1.49803 WP_000074605.1.49805 WP_000074605.1.49827 WP_000074605.1.49929 WP_000074605.1.50080 WP_000074605.1.50128 WP_000074605.1.50161 WP_000074605.1.50211 WP_000074605.1.50332 WP_000074605.1.50376 WP_000074605.1.50389 WP_000074605.1.50404 WP_000074605.1.50449 WP_000074605.1.50469 WP_000074605.1.50480 WP_000074605.1.50517 WP_000074605.1.50563 WP_000074605.1.50576 WP_000074605.1.50593 WP_000074605.1.50652 WP_000074605.1.50676 WP_000074605.1.50684 WP_000074605.1.50804 WP_000074605.1.50808 WP_000074605.1.5088 WP_000074605.1.50882 WP_000074605.1.50905 WP_000074605.1.50908 WP_000074605.1.50941 WP_000074605.1.50960 WP_000074605.1.50999 WP_000074605.1.51014 WP_000074605.1.51022 WP_000074605.1.51066 WP_000074605.1.51117 WP_000074605.1.51179 WP_000074605.1.51182 WP_000074605.1.51186 WP_000074605.1.51224 WP_000074605.1.51331 WP_000074605.1.51356 WP_000074605.1.51394 WP_000074605.1.51412 WP_000074605.1.51414 WP_000074605.1.51451 WP_000074605.1.51464 WP_000074605.1.51487 WP_000074605.1.51488 WP_000074605.1.51502 WP_000074605.1.51594 WP_000074605.1.51613 WP_000074605.1.51634 WP_000074605.1.51642 WP_000074605.1.51649 WP_000074605.1.51686 WP_000074605.1.51764 WP_000074605.1.51810 WP_000074605.1.51831 WP_000074605.1.51841 WP_000074605.1.51868 WP_000074605.1.51888 WP_000074605.1.51911 WP_000074605.1.51930 WP_000074605.1.51932 WP_000074605.1.51989 WP_000074605.1.51994 WP_000074605.1.520 WP_000074605.1.5211 WP_000074605.1.52121 WP_000074605.1.52156 WP_000074605.1.52161 WP_000074605.1.52170 WP_000074605.1.52301 WP_000074605.1.52321 WP_000074605.1.52336 WP_000074605.1.52346 WP_000074605.1.52353 WP_000074605.1.52356 WP_000074605.1.52361 WP_000074605.1.52438 WP_000074605.1.52582 WP_000074605.1.52586 WP_000074605.1.52653 WP_000074605.1.52656 WP_000074605.1.52692 WP_000074605.1.52743 WP_000074605.1.52833 WP_000074605.1.52851 WP_000074605.1.52857 WP_000074605.1.52866 WP_000074605.1.52898 WP_000074605.1.52915 WP_000074605.1.52949 WP_000074605.1.52985 WP_000074605.1.53107 WP_000074605.1.53119 WP_000074605.1.5313 WP_000074605.1.53190 WP_000074605.1.53198 WP_000074605.1.53234 WP_000074605.1.53272 WP_000074605.1.5333 WP_000074605.1.53362 WP_000074605.1.53385 WP_000074605.1.53406 WP_000074605.1.53466 WP_000074605.1.53529 WP_000074605.1.53543 WP_000074605.1.53567 WP_000074605.1.53664 WP_000074605.1.53688 WP_000074605.1.53757 WP_000074605.1.53778 WP_000074605.1.53781 WP_000074605.1.53812 WP_000074605.1.53896 WP_000074605.1.53905 WP_000074605.1.53935 WP_000074605.1.53961 WP_000074605.1.54033 WP_000074605.1.54075 WP_000074605.1.54196 WP_000074605.1.54209 WP_000074605.1.54271 WP_000074605.1.54274 WP_000074605.1.54283 WP_000074605.1.54319 WP_000074605.1.54333 WP_000074605.1.54364 WP_000074605.1.54366 WP_000074605.1.54400 WP_000074605.1.54469 WP_000074605.1.54526 WP_000074605.1.54607 WP_000074605.1.54615 WP_000074605.1.54644 WP_000074605.1.54662 WP_000074605.1.54694 WP_000074605.1.54722 WP_000074605.1.54749 WP_000074605.1.54764 WP_000074605.1.54833 WP_000074605.1.54877 WP_000074605.1.54936 WP_000074605.1.55008 WP_000074605.1.55152 WP_000074605.1.55156 WP_000074605.1.55223 WP_000074605.1.55285 WP_000074605.1.55325 WP_000074605.1.55430 WP_000074605.1.55475 WP_000074605.1.55554 WP_000074605.1.55559 WP_000074605.1.5560 WP_000074605.1.55614 WP_000074605.1.55640 WP_000074605.1.55647 WP_000074605.1.55680 WP_000074605.1.5572 WP_000074605.1.55743 WP_000074605.1.55768 WP_000074605.1.5577 WP_000074605.1.55782 WP_000074605.1.55796 WP_000074605.1.55853 WP_000074605.1.55923 WP_000074605.1.55948 WP_000074605.1.55973 WP_000074605.1.56002 WP_000074605.1.56012 WP_000074605.1.56105 WP_000074605.1.56235 WP_000074605.1.56238 WP_000074605.1.56244 WP_000074605.1.56263 WP_000074605.1.56286 WP_000074605.1.56304 WP_000074605.1.56354 WP_000074605.1.56368 WP_000074605.1.56414 WP_000074605.1.56438 WP_000074605.1.56559 WP_000074605.1.56560 WP_000074605.1.56601 WP_000074605.1.56614 WP_000074605.1.56651 WP_000074605.1.56660 WP_000074605.1.56671 WP_000074605.1.5668 WP_000074605.1.56682 WP_000074605.1.56851 WP_000074605.1.56853 WP_000074605.1.56875 WP_000074605.1.56877 WP_000074605.1.56893 WP_000074605.1.56898 WP_000074605.1.56950 WP_000074605.1.57026 WP_000074605.1.57039 WP_000074605.1.57056 WP_000074605.1.5711 WP_000074605.1.57143 WP_000074605.1.57168 WP_000074605.1.57187 WP_000074605.1.57246 WP_000074605.1.57296 WP_000074605.1.57307 WP_000074605.1.57356 WP_000074605.1.57362 WP_000074605.1.57377 WP_000074605.1.57418 WP_000074605.1.57433 WP_000074605.1.57510 WP_000074605.1.57515 WP_000074605.1.57529 WP_000074605.1.57559 WP_000074605.1.57576 WP_000074605.1.57601 WP_000074605.1.57607 WP_000074605.1.57631 WP_000074605.1.57735 WP_000074605.1.5774 WP_000074605.1.57763 WP_000074605.1.57778 WP_000074605.1.57781 WP_000074605.1.57835 WP_000074605.1.57862 WP_000074605.1.57890 WP_000074605.1.57891 WP_000074605.1.57893 WP_000074605.1.57978 WP_000074605.1.5801 WP_000074605.1.58040 WP_000074605.1.58041 WP_000074605.1.58090 WP_000074605.1.58157 WP_000074605.1.5828 WP_000074605.1.58290 WP_000074605.1.58358 WP_000074605.1.58372 WP_000074605.1.58407 WP_000074605.1.58418 WP_000074605.1.58443 WP_000074605.1.58486 WP_000074605.1.58489 WP_000074605.1.58548 WP_000074605.1.58564 WP_000074605.1.5858 WP_000074605.1.58633 WP_000074605.1.58662 WP_000074605.1.58669 WP_000074605.1.58675 WP_000074605.1.58698 WP_000074605.1.587 WP_000074605.1.58745 WP_000074605.1.58749 WP_000074605.1.58803 WP_000074605.1.58834 WP_000074605.1.5886 WP_000074605.1.58884 WP_000074605.1.58926 WP_000074605.1.59094 WP_000074605.1.59097 WP_000074605.1.59125 WP_000074605.1.59136 WP_000074605.1.59142 WP_000074605.1.59163 WP_000074605.1.59224 WP_000074605.1.59236 WP_000074605.1.59295 WP_000074605.1.59321 WP_000074605.1.59335 WP_000074605.1.59336 WP_000074605.1.59375 WP_000074605.1.59381 WP_000074605.1.59420 WP_000074605.1.59427 WP_000074605.1.59439 WP_000074605.1.59458 WP_000074605.1.59486 WP_000074605.1.59490 WP_000074605.1.59508 WP_000074605.1.59512 WP_000074605.1.59538 WP_000074605.1.59548 WP_000074605.1.59587 WP_000074605.1.59641 WP_000074605.1.59646 WP_000074605.1.59684 WP_000074605.1.59694 WP_000074605.1.59771 WP_000074605.1.5979 WP_000074605.1.59830 WP_000074605.1.59848 WP_000074605.1.59953 WP_000074605.1.60008 WP_000074605.1.60021 WP_000074605.1.60052 WP_000074605.1.60069 WP_000074605.1.60106 WP_000074605.1.60126 WP_000074605.1.60137 WP_000074605.1.60140 WP_000074605.1.60155 WP_000074605.1.60213 WP_000074605.1.60285 WP_000074605.1.60320 WP_000074605.1.6033 WP_000074605.1.60370 WP_000074605.1.60379 WP_000074605.1.60425 WP_000074605.1.60464 WP_000074605.1.60507 WP_000074605.1.6052 WP_000074605.1.60545 WP_000074605.1.60560 WP_000074605.1.60561 WP_000074605.1.60608 WP_000074605.1.60713 WP_000074605.1.60772 WP_000074605.1.608 WP_000074605.1.60851 WP_000074605.1.60857 WP_000074605.1.60866 WP_000074605.1.60874 WP_000074605.1.60897 WP_000074605.1.60919 WP_000074605.1.60941 WP_000074605.1.61078 WP_000074605.1.6108 WP_000074605.1.61087 WP_000074605.1.6114 WP_000074605.1.61201 WP_000074605.1.61232 WP_000074605.1.6129 WP_000074605.1.61296 WP_000074605.1.61345 WP_000074605.1.61356 WP_000074605.1.61381 WP_000074605.1.61417 WP_000074605.1.61501 WP_000074605.1.61509 WP_000074605.1.61574 WP_000074605.1.61594 WP_000074605.1.61595 WP_000074605.1.6164 WP_000074605.1.61662 WP_000074605.1.61671 WP_000074605.1.61712 WP_000074605.1.61714 WP_000074605.1.61730 WP_000074605.1.61857 WP_000074605.1.61908 WP_000074605.1.61918 WP_000074605.1.61952 WP_000074605.1.62007 WP_000074605.1.62020 WP_000074605.1.62025 WP_000074605.1.6209 WP_000074605.1.62142 WP_000074605.1.62158 WP_000074605.1.62201 WP_000074605.1.62204 WP_000074605.1.62210 WP_000074605.1.62222 WP_000074605.1.62245 WP_000074605.1.62257 WP_000074605.1.62304 WP_000074605.1.62364 WP_000074605.1.62374 WP_000074605.1.62403 WP_000074605.1.62412 WP_000074605.1.6253 WP_000074605.1.62677 WP_000074605.1.627 WP_000074605.1.62745 WP_000074605.1.62757 WP_000074605.1.62853 WP_000074605.1.62903 WP_000074605.1.62910 WP_000074605.1.6292 WP_000074605.1.62955 WP_000074605.1.62983 WP_000074605.1.62988 WP_000074605.1.63045 WP_000074605.1.63102 WP_000074605.1.63150 WP_000074605.1.63155 WP_000074605.1.63181 WP_000074605.1.63203 WP_000074605.1.63229 WP_000074605.1.63243 WP_000074605.1.63250 WP_000074605.1.63256 WP_000074605.1.63290 WP_000074605.1.63358 WP_000074605.1.63382 WP_000074605.1.63432 WP_000074605.1.63461 WP_000074605.1.63479 WP_000074605.1.63497 WP_000074605.1.63499 WP_000074605.1.63509 WP_000074605.1.63529 WP_000074605.1.63568 WP_000074605.1.63577 WP_000074605.1.63585 WP_000074605.1.63603 WP_000074605.1.63664 WP_000074605.1.6370 WP_000074605.1.63718 WP_000074605.1.63748 WP_000074605.1.6375 WP_000074605.1.63757 WP_000074605.1.63797 WP_000074605.1.63834 WP_000074605.1.63851 WP_000074605.1.63863 WP_000074605.1.63934 WP_000074605.1.64007 WP_000074605.1.64010 WP_000074605.1.64018 WP_000074605.1.64046 WP_000074605.1.64085 WP_000074605.1.64109 WP_000074605.1.64121 WP_000074605.1.64157 WP_000074605.1.64208 WP_000074605.1.64229 WP_000074605.1.6423 WP_000074605.1.64244 WP_000074605.1.64294 WP_000074605.1.64350 WP_000074605.1.64385 WP_000074605.1.64387 WP_000074605.1.64403 WP_000074605.1.64462 WP_000074605.1.64500 WP_000074605.1.64597 WP_000074605.1.64649 WP_000074605.1.64702 WP_000074605.1.64711 WP_000074605.1.64757 WP_000074605.1.64771 WP_000074605.1.64781 WP_000074605.1.64831 WP_000074605.1.6489 WP_000074605.1.64894 WP_000074605.1.64920 WP_000074605.1.65011 WP_000074605.1.65016 WP_000074605.1.65018 WP_000074605.1.65022 WP_000074605.1.65028 WP_000074605.1.65168 WP_000074605.1.65171 WP_000074605.1.65238 WP_000074605.1.65248 WP_000074605.1.65269 WP_000074605.1.6535 WP_000074605.1.65357 WP_000074605.1.65474 WP_000074605.1.65538 WP_000074605.1.65558 WP_000074605.1.6560 WP_000074605.1.65601 WP_000074605.1.65633 WP_000074605.1.6565 WP_000074605.1.65696 WP_000074605.1.65698 WP_000074605.1.6575 WP_000074605.1.65771 WP_000074605.1.65782 WP_000074605.1.65881 WP_000074605.1.65883 WP_000074605.1.65901 WP_000074605.1.65940 WP_000074605.1.6595 WP_000074605.1.65956 WP_000074605.1.66049 WP_000074605.1.66122 WP_000074605.1.66129 WP_000074605.1.66171 WP_000074605.1.66250 WP_000074605.1.66289 WP_000074605.1.6630 WP_000074605.1.66314 WP_000074605.1.66315 WP_000074605.1.66330 WP_000074605.1.66358 WP_000074605.1.66362 WP_000074605.1.6638 WP_000074605.1.66385 WP_000074605.1.6640 WP_000074605.1.66400 WP_000074605.1.66428 WP_000074605.1.66446 WP_000074605.1.66462 WP_000074605.1.66539 WP_000074605.1.66630 WP_000074605.1.66678 WP_000074605.1.66698 WP_000074605.1.66702 WP_000074605.1.66733 WP_000074605.1.66779 WP_000074605.1.6680 WP_000074605.1.66807 WP_000074605.1.66820 WP_000074605.1.66834 WP_000074605.1.66901 WP_000074605.1.66937 WP_000074605.1.66959 WP_000074605.1.66962 WP_000074605.1.67037 WP_000074605.1.67045 WP_000074605.1.67075 WP_000074605.1.6710 WP_000074605.1.67100 WP_000074605.1.67173 WP_000074605.1.67181 WP_000074605.1.67235 WP_000074605.1.67268 WP_000074605.1.67279 WP_000074605.1.67288 WP_000074605.1.67347 WP_000074605.1.6739 WP_000074605.1.67465 WP_000074605.1.67552 WP_000074605.1.6760 WP_000074605.1.67682 WP_000074605.1.6782 WP_000074605.1.67829 WP_000074605.1.67887 WP_000074605.1.67932 WP_000074605.1.67942 WP_000074605.1.68073 WP_000074605.1.68140 WP_000074605.1.68159 WP_000074605.1.68201 WP_000074605.1.68206 WP_000074605.1.6827 WP_000074605.1.68275 WP_000074605.1.6833 WP_000074605.1.68401 WP_000074605.1.68477 WP_000074605.1.6849 WP_000074605.1.68532 WP_000074605.1.68547 WP_000074605.1.68589 WP_000074605.1.68652 WP_000074605.1.68655 WP_000074605.1.68656 WP_000074605.1.68677 WP_000074605.1.68690 WP_000074605.1.68778 WP_000074605.1.68787 WP_000074605.1.6883 WP_000074605.1.68893 WP_000074605.1.68894 WP_000074605.1.68895 WP_000074605.1.68928 WP_000074605.1.68958 WP_000074605.1.68975 WP_000074605.1.69001 WP_000074605.1.69006 WP_000074605.1.69011 WP_000074605.1.6904 WP_000074605.1.6905 WP_000074605.1.69080 WP_000074605.1.69086 WP_000074605.1.6913 WP_000074605.1.69131 WP_000074605.1.69146 WP_000074605.1.69151 WP_000074605.1.69236 WP_000074605.1.69255 WP_000074605.1.69273 WP_000074605.1.69320 WP_000074605.1.69346 WP_000074605.1.69357 WP_000074605.1.69359 WP_000074605.1.69397 WP_000074605.1.69485 WP_000074605.1.6954 WP_000074605.1.69564 WP_000074605.1.69575 WP_000074605.1.69588 WP_000074605.1.69592 WP_000074605.1.69616 WP_000074605.1.69636 WP_000074605.1.69644 WP_000074605.1.69704 WP_000074605.1.69754 WP_000074605.1.69758 WP_000074605.1.69767 WP_000074605.1.69807 WP_000074605.1.69817 WP_000074605.1.69965 WP_000074605.1.70087 WP_000074605.1.70088 WP_000074605.1.7010 WP_000074605.1.7021 WP_000074605.1.70241 WP_000074605.1.70248 WP_000074605.1.70269 WP_000074605.1.70272 WP_000074605.1.70289 WP_000074605.1.70303 WP_000074605.1.70321 WP_000074605.1.70440 WP_000074605.1.70447 WP_000074605.1.70485 WP_000074605.1.70488 WP_000074605.1.70531 WP_000074605.1.70580 WP_000074605.1.70596 WP_000074605.1.70643 WP_000074605.1.70678 WP_000074605.1.70683 WP_000074605.1.70685 WP_000074605.1.70785 WP_000074605.1.70837 WP_000074605.1.70869 WP_000074605.1.70883 WP_000074605.1.70922 WP_000074605.1.70929 WP_000074605.1.70948 WP_000074605.1.70959 WP_000074605.1.70977 WP_000074605.1.70985 WP_000074605.1.71007 WP_000074605.1.71023 WP_000074605.1.71069 WP_000074605.1.7110 WP_000074605.1.71116 WP_000074605.1.71120 WP_000074605.1.71146 WP_000074605.1.71150 WP_000074605.1.71165 WP_000074605.1.71172 WP_000074605.1.71184 WP_000074605.1.71188 WP_000074605.1.71201 WP_000074605.1.71202 WP_000074605.1.71243 WP_000074605.1.71305 WP_000074605.1.71306 WP_000074605.1.71337 WP_000074605.1.71363 WP_000074605.1.71378 WP_000074605.1.71401 WP_000074605.1.71407 WP_000074605.1.71446 WP_000074605.1.71600 WP_000074605.1.71626 WP_000074605.1.71636 WP_000074605.1.71649 WP_000074605.1.71702 WP_000074605.1.7174 WP_000074605.1.71798 WP_000074605.1.71845 WP_000074605.1.71881 WP_000074605.1.71908 WP_000074605.1.71929 WP_000074605.1.71952 WP_000074605.1.71973 WP_000074605.1.71979 WP_000074605.1.71984 WP_000074605.1.720 WP_000074605.1.72100 WP_000074605.1.72105 WP_000074605.1.72107 WP_000074605.1.72182 WP_000074605.1.72190 WP_000074605.1.72203 WP_000074605.1.72221 WP_000074605.1.72226 WP_000074605.1.72300 WP_000074605.1.72325 WP_000074605.1.72339 WP_000074605.1.72351 WP_000074605.1.72376 WP_000074605.1.72403 WP_000074605.1.72412 WP_000074605.1.72470 WP_000074605.1.72532 WP_000074605.1.72594 WP_000074605.1.72602 WP_000074605.1.72625 WP_000074605.1.72689 WP_000074605.1.72716 WP_000074605.1.72718 WP_000074605.1.72728 WP_000074605.1.72850 WP_000074605.1.72865 WP_000074605.1.72871 WP_000074605.1.7295 WP_000074605.1.72975 WP_000074605.1.7304 WP_000074605.1.73068 WP_000074605.1.73125 WP_000074605.1.7315 WP_000074605.1.73164 WP_000074605.1.73200 WP_000074605.1.7334 WP_000074605.1.73362 WP_000074605.1.73377 WP_000074605.1.73379 WP_000074605.1.73461 WP_000074605.1.73481 WP_000074605.1.7356 WP_000074605.1.73581 WP_000074605.1.73617 WP_000074605.1.73708 WP_000074605.1.73753 WP_000074605.1.73758 WP_000074605.1.73764 WP_000074605.1.73794 WP_000074605.1.73831 WP_000074605.1.73847 WP_000074605.1.7387 WP_000074605.1.73924 WP_000074605.1.7394 WP_000074605.1.74029 WP_000074605.1.74049 WP_000074605.1.74174 WP_000074605.1.74181 WP_000074605.1.74191 WP_000074605.1.74207 WP_000074605.1.743 WP_000074605.1.74300 WP_000074605.1.7433 WP_000074605.1.74379 WP_000074605.1.74410 WP_000074605.1.74422 WP_000074605.1.74428 WP_000074605.1.74466 WP_000074605.1.745 WP_000074605.1.74529 WP_000074605.1.74545 WP_000074605.1.74578 WP_000074605.1.74620 WP_000074605.1.74639 WP_000074605.1.74745 WP_000074605.1.74826 WP_000074605.1.7491 WP_000074605.1.74972 WP_000074605.1.75051 WP_000074605.1.75056 WP_000074605.1.75058 WP_000074605.1.75129 WP_000074605.1.75148 WP_000074605.1.75159 WP_000074605.1.75177 WP_000074605.1.75180 WP_000074605.1.75187 WP_000074605.1.75288 WP_000074605.1.75334 WP_000074605.1.75362 WP_000074605.1.75385 WP_000074605.1.75392 WP_000074605.1.75400 WP_000074605.1.75402 WP_000074605.1.75450 WP_000074605.1.7558 WP_000074605.1.75607 WP_000074605.1.75609 WP_000074605.1.75716 WP_000074605.1.75751 WP_000074605.1.75760 WP_000074605.1.75764 WP_000074605.1.75794 WP_000074605.1.75810 WP_000074605.1.75837 WP_000074605.1.75863 WP_000074605.1.75874 WP_000074605.1.75902 WP_000074605.1.75945 WP_000074605.1.75957 WP_000074605.1.76020 WP_000074605.1.76097 WP_000074605.1.76108 WP_000074605.1.76137 WP_000074605.1.76252 WP_000074605.1.76327 WP_000074605.1.76345 WP_000074605.1.76364 WP_000074605.1.76445 WP_000074605.1.76451 WP_000074605.1.76471 WP_000074605.1.76495 WP_000074605.1.76532 WP_000074605.1.7657 WP_000074605.1.7660 WP_000074605.1.76673 WP_000074605.1.76706 WP_000074605.1.76721 WP_000074605.1.76724 WP_000074605.1.76738 WP_000074605.1.76756 WP_000074605.1.76760 WP_000074605.1.76776 WP_000074605.1.76806 WP_000074605.1.76875 WP_000074605.1.76880 WP_000074605.1.76899 WP_000074605.1.76913 WP_000074605.1.76968 WP_000074605.1.77038 WP_000074605.1.77047 WP_000074605.1.77067 WP_000074605.1.77080 WP_000074605.1.7712 WP_000074605.1.77177 WP_000074605.1.77180 WP_000074605.1.77193 WP_000074605.1.77244 WP_000074605.1.77267 WP_000074605.1.77292 WP_000074605.1.77306 WP_000074605.1.77349 WP_000074605.1.77356 WP_000074605.1.77414 WP_000074605.1.77436 WP_000074605.1.77475 WP_000074605.1.77496 WP_000074605.1.77514 WP_000074605.1.77529 WP_000074605.1.77549 WP_000074605.1.77575 WP_000074605.1.77692 WP_000074605.1.77710 WP_000074605.1.77754 WP_000074605.1.77761 WP_000074605.1.7782 WP_000074605.1.77851 WP_000074605.1.77898 WP_000074605.1.77918 WP_000074605.1.7792 WP_000074605.1.7793 WP_000074605.1.77951 WP_000074605.1.77960 WP_000074605.1.77983 WP_000074605.1.77989 WP_000074605.1.7802 WP_000074605.1.78033 WP_000074605.1.78051 WP_000074605.1.78053 WP_000074605.1.78076 WP_000074605.1.78096 WP_000074605.1.78100 WP_000074605.1.78110 WP_000074605.1.78120 WP_000074605.1.78201 WP_000074605.1.78372 WP_000074605.1.78383 WP_000074605.1.78407 WP_000074605.1.78443 WP_000074605.1.78501 WP_000074605.1.78603 WP_000074605.1.7861 WP_000074605.1.78618 WP_000074605.1.78632 WP_000074605.1.78658 WP_000074605.1.78673 WP_000074605.1.78697 WP_000074605.1.78734 WP_000074605.1.78735 WP_000074605.1.7877 WP_000074605.1.78802 WP_000074605.1.78815 WP_000074605.1.78830 WP_000074605.1.78835 WP_000074605.1.78838 WP_000074605.1.78862 WP_000074605.1.78871 WP_000074605.1.78874 WP_000074605.1.78877 WP_000074605.1.78896 WP_000074605.1.7891 WP_000074605.1.78918 WP_000074605.1.78930 WP_000074605.1.79099 WP_000074605.1.79151 WP_000074605.1.79167 WP_000074605.1.79189 WP_000074605.1.79203 WP_000074605.1.79289 WP_000074605.1.79297 WP_000074605.1.79335 WP_000074605.1.79462 WP_000074605.1.79468 WP_000074605.1.79472 WP_000074605.1.79490 WP_000074605.1.79495 WP_000074605.1.79529 WP_000074605.1.79570 WP_000074605.1.79580 WP_000074605.1.79586 WP_000074605.1.7964 WP_000074605.1.79659 WP_000074605.1.79668 WP_000074605.1.79708 WP_000074605.1.79734 WP_000074605.1.79757 WP_000074605.1.79778 WP_000074605.1.7982 WP_000074605.1.79832 WP_000074605.1.79845 WP_000074605.1.79867 WP_000074605.1.79892 WP_000074605.1.79914 WP_000074605.1.80077 WP_000074605.1.80137 WP_000074605.1.80182 WP_000074605.1.80249 WP_000074605.1.80254 WP_000074605.1.80296 WP_000074605.1.80366 WP_000074605.1.80380 WP_000074605.1.80448 WP_000074605.1.80479 WP_000074605.1.80529 WP_000074605.1.80586 WP_000074605.1.80609 WP_000074605.1.80741 WP_000074605.1.80760 WP_000074605.1.80780 WP_000074605.1.80831 WP_000074605.1.80850 WP_000074605.1.80868 WP_000074605.1.80874 WP_000074605.1.80876 WP_000074605.1.80881 WP_000074605.1.80913 WP_000074605.1.80939 WP_000074605.1.8096 WP_000074605.1.81037 WP_000074605.1.8106 WP_000074605.1.81069 WP_000074605.1.81109 WP_000074605.1.81110 WP_000074605.1.81149 WP_000074605.1.81175 WP_000074605.1.8119 WP_000074605.1.81193 WP_000074605.1.81197 WP_000074605.1.81225 WP_000074605.1.8130 WP_000074605.1.81305 WP_000074605.1.81328 WP_000074605.1.8134 WP_000074605.1.81354 WP_000074605.1.81388 WP_000074605.1.81425 WP_000074605.1.81455 WP_000074605.1.81528 WP_000074605.1.81668 WP_000074605.1.81727 WP_000074605.1.81735 WP_000074605.1.81750 WP_000074605.1.81760 WP_000074605.1.81768 WP_000074605.1.81785 WP_000074605.1.81902 WP_000074605.1.81965 WP_000074605.1.81974 WP_000074605.1.81995 WP_000074605.1.82037 WP_000074605.1.82099 WP_000074605.1.82149 WP_000074605.1.82192 WP_000074605.1.82232 WP_000074605.1.82337 WP_000074605.1.82352 WP_000074605.1.82401 WP_000074605.1.82420 WP_000074605.1.82434 WP_000074605.1.82464 WP_000074605.1.8247 WP_000074605.1.82474 WP_000074605.1.82479 WP_000074605.1.82503 WP_000074605.1.82515 WP_000074605.1.82529 WP_000074605.1.82569 WP_000074605.1.82584 WP_000074605.1.82637 WP_000074605.1.82676 WP_000074605.1.82761 WP_000074605.1.82763 WP_000074605.1.8282 WP_000074605.1.82841 WP_000074605.1.82843 WP_000074605.1.82867 WP_000074605.1.82886 WP_000074605.1.82899 WP_000074605.1.82937 WP_000074605.1.82944 WP_000074605.1.82956 WP_000074605.1.83005 WP_000074605.1.83006 WP_000074605.1.83092 WP_000074605.1.83163 WP_000074605.1.83204 WP_000074605.1.83247 WP_000074605.1.83301 WP_000074605.1.83305 WP_000074605.1.83331 WP_000074605.1.83354 WP_000074605.1.83356 WP_000074605.1.83388 WP_000074605.1.83413 WP_000074605.1.83491 WP_000074605.1.83516 WP_000074605.1.83523 WP_000074605.1.8354 WP_000074605.1.83558 WP_000074605.1.83650 WP_000074605.1.83710 WP_000074605.1.83721 WP_000074605.1.83759 WP_000074605.1.83760 WP_000074605.1.83854 WP_000074605.1.83979 WP_000074605.1.8399 WP_000074605.1.83995 WP_000074605.1.84000 WP_000074605.1.84011 WP_000074605.1.84075 WP_000074605.1.84077 WP_000074605.1.84083 WP_000074605.1.84086 WP_000074605.1.84103 WP_000074605.1.84154 WP_000074605.1.84229 WP_000074605.1.8425 WP_000074605.1.84283 WP_000074605.1.84291 WP_000074605.1.84300 WP_000074605.1.84355 WP_000074605.1.84392 WP_000074605.1.84397 WP_000074605.1.8441 WP_000074605.1.84497 WP_000074605.1.84515 WP_000074605.1.84532 WP_000074605.1.84551 WP_000074605.1.84554 WP_000074605.1.84572 WP_000074605.1.84598 WP_000074605.1.84659 WP_000074605.1.84711 WP_000074605.1.84876 WP_000074605.1.84899 WP_000074605.1.8497 WP_000074605.1.84983 WP_000074605.1.850 WP_000074605.1.85014 WP_000074605.1.85031 WP_000074605.1.85040 WP_000074605.1.85079 WP_000074605.1.85134 WP_000074605.1.85147 WP_000074605.1.85178 WP_000074605.1.85180 WP_000074605.1.85190 WP_000074605.1.8526 WP_000074605.1.85271 WP_000074605.1.85301 WP_000074605.1.8533 WP_000074605.1.8545 WP_000074605.1.85481 WP_000074605.1.85483 WP_000074605.1.85541 WP_000074605.1.8556 WP_000074605.1.85568 WP_000074605.1.85615 WP_000074605.1.85617 WP_000074605.1.85663 WP_000074605.1.85671 WP_000074605.1.85672 WP_000074605.1.85742 WP_000074605.1.85759 WP_000074605.1.85777 WP_000074605.1.85886 WP_000074605.1.85900 WP_000074605.1.85904 WP_000074605.1.85943 WP_000074605.1.85976 WP_000074605.1.85982 WP_000074605.1.86017 WP_000074605.1.86043 WP_000074605.1.86138 WP_000074605.1.86157 WP_000074605.1.86159 WP_000074605.1.8616 WP_000074605.1.86173 WP_000074605.1.86240 WP_000074605.1.86285 WP_000074605.1.86306 WP_000074605.1.86347 WP_000074605.1.86356 WP_000074605.1.86380 WP_000074605.1.86450 WP_000074605.1.86453 WP_000074605.1.86469 WP_000074605.1.8647 WP_000074605.1.86514 WP_000074605.1.86580 WP_000074605.1.86588 WP_000074605.1.86610 WP_000074605.1.86634 WP_000074605.1.86661 WP_000074605.1.8671 WP_000074605.1.8672 WP_000074605.1.8678 WP_000074605.1.86807 WP_000074605.1.86810 WP_000074605.1.8684 WP_000074605.1.86860 WP_000074605.1.86895 WP_000074605.1.86906 WP_000074605.1.86921 WP_000074605.1.87038 WP_000074605.1.87051 WP_000074605.1.87095 WP_000074605.1.87143 WP_000074605.1.87187 WP_000074605.1.87219 WP_000074605.1.8722 WP_000074605.1.87265 WP_000074605.1.87283 WP_000074605.1.87323 WP_000074605.1.8736 WP_000074605.1.87460 WP_000074605.1.87484 WP_000074605.1.87500 WP_000074605.1.87552 WP_000074605.1.87583 WP_000074605.1.87695 WP_000074605.1.87712 WP_000074605.1.87760 WP_000074605.1.87779 WP_000074605.1.87875 WP_000074605.1.87899 WP_000074605.1.87905 WP_000074605.1.8792 WP_000074605.1.87936 WP_000074605.1.87945 WP_000074605.1.87999 WP_000074605.1.88019 WP_000074605.1.88052 WP_000074605.1.88073 WP_000074605.1.8809 WP_000074605.1.88092 WP_000074605.1.88165 WP_000074605.1.88185 WP_000074605.1.88275 WP_000074605.1.88291 WP_000074605.1.88293 WP_000074605.1.88303 WP_000074605.1.88356 WP_000074605.1.8837 WP_000074605.1.88393 WP_000074605.1.88474 WP_000074605.1.88508 WP_000074605.1.88597 WP_000074605.1.88698 WP_000074605.1.88703 WP_000074605.1.88731 WP_000074605.1.88792 WP_000074605.1.88845 WP_000074605.1.88854 WP_000074605.1.88902 WP_000074605.1.8891 WP_000074605.1.88942 WP_000074605.1.88957 WP_000074605.1.88966 WP_000074605.1.88967 WP_000074605.1.88968 WP_000074605.1.88980 WP_000074605.1.88981 WP_000074605.1.88982 WP_000074605.1.88995 WP_000074605.1.88998 WP_000074605.1.89008 WP_000074605.1.89114 WP_000074605.1.89116 WP_000074605.1.89119 WP_000074605.1.89120 WP_000074605.1.89138 WP_000074605.1.89177 WP_000074605.1.89221 WP_000074605.1.89362 WP_000074605.1.89408 WP_000074605.1.89425 WP_000074605.1.89512 WP_000074605.1.89527 WP_000074605.1.89570 WP_000074605.1.89604 WP_000074605.1.89606 WP_000074605.1.8961 WP_000074605.1.89622 WP_000074605.1.89632 WP_000074605.1.89634 WP_000074605.1.89657 WP_000074605.1.89659 WP_000074605.1.89680 WP_000074605.1.89765 WP_000074605.1.89817 WP_000074605.1.89832 WP_000074605.1.89902 WP_000074605.1.89940 WP_000074605.1.8996 WP_000074605.1.9002 WP_000074605.1.9003 WP_000074605.1.90084 WP_000074605.1.90097 WP_000074605.1.90211 WP_000074605.1.90248 WP_000074605.1.90252 WP_000074605.1.90409 WP_000074605.1.90417 WP_000074605.1.90421 WP_000074605.1.90440 WP_000074605.1.90453 WP_000074605.1.90458 WP_000074605.1.90472 WP_000074605.1.90522 WP_000074605.1.90540 WP_000074605.1.90557 WP_000074605.1.90563 WP_000074605.1.90585 WP_000074605.1.9064 WP_000074605.1.90641 WP_000074605.1.90686 WP_000074605.1.90734 WP_000074605.1.90748 WP_000074605.1.90759 WP_000074605.1.90859 WP_000074605.1.90866 WP_000074605.1.90959 WP_000074605.1.90973 WP_000074605.1.91003 WP_000074605.1.91023 WP_000074605.1.91049 WP_000074605.1.91056 WP_000074605.1.91069 WP_000074605.1.91107 WP_000074605.1.91179 WP_000074605.1.91215 WP_000074605.1.91278 WP_000074605.1.9137 WP_000074605.1.91372 WP_000074605.1.91424 WP_000074605.1.91470 WP_000074605.1.91473 WP_000074605.1.91474 WP_000074605.1.91505 WP_000074605.1.91512 WP_000074605.1.91564 WP_000074605.1.91621 WP_000074605.1.91628 WP_000074605.1.91655 WP_000074605.1.91724 WP_000074605.1.91732 WP_000074605.1.91742 WP_000074605.1.91772 WP_000074605.1.91776 WP_000074605.1.91788 WP_000074605.1.91795 WP_000074605.1.91898 WP_000074605.1.91903 WP_000074605.1.91904 WP_000074605.1.91974 WP_000074605.1.92013 WP_000074605.1.92044 WP_000074605.1.92082 WP_000074605.1.92093 WP_000074605.1.92108 WP_000074605.1.92129 WP_000074605.1.92149 WP_000074605.1.92165 WP_000074605.1.92183 WP_000074605.1.92208 WP_000074605.1.9222 WP_000074605.1.92268 WP_000074605.1.92310 WP_000074605.1.92375 WP_000074605.1.92443 WP_000074605.1.92452 WP_000074605.1.92482 WP_000074605.1.92531 WP_000074605.1.92557 WP_000074605.1.92562 WP_000074605.1.92628 WP_000074605.1.92669 WP_000074605.1.92671 WP_000074605.1.92729 WP_000074605.1.92738 WP_000074605.1.92754 WP_000074605.1.92758 WP_000074605.1.92806 WP_000074605.1.92890 WP_000074605.1.92893 WP_000074605.1.92895 WP_000074605.1.92929 WP_000074605.1.92975 WP_000074605.1.92988 WP_000074605.1.93059 WP_000074605.1.93076 WP_000074605.1.93086 WP_000074605.1.93101 WP_000074605.1.93136 WP_000074605.1.93155 WP_000074605.1.93215 WP_000074605.1.93339 WP_000074605.1.93350 WP_000074605.1.93365 WP_000074605.1.93410 WP_000074605.1.93524 WP_000074605.1.93543 WP_000074605.1.93577 WP_000074605.1.93650 WP_000074605.1.93656 WP_000074605.1.93662 WP_000074605.1.93691 WP_000074605.1.937 WP_000074605.1.93705 WP_000074605.1.93741 WP_000074605.1.93761 WP_000074605.1.9380 WP_000074605.1.93804 WP_000074605.1.93809 WP_000074605.1.9389 WP_000074605.1.93937 WP_000074605.1.93956 WP_000074605.1.93994 WP_000074605.1.94039 WP_000074605.1.94072 WP_000074605.1.94162 WP_000074605.1.94168 WP_000074605.1.94198 WP_000074605.1.9432 WP_000074605.1.94354 WP_000074605.1.94379 WP_000074605.1.94380 WP_000074605.1.9440 WP_000074605.1.94458 WP_000074605.1.94473 WP_000074605.1.94562 WP_000074605.1.94565 WP_000074605.1.94584 WP_000074605.1.94598 WP_000074605.1.94649 WP_000074605.1.94655 WP_000074605.1.94670 WP_000074605.1.94674 WP_000074605.1.94796 WP_000074605.1.94835 WP_000074605.1.94959 WP_000074605.1.94971 WP_000074605.1.94982 WP_000074605.1.94983 WP_000074605.1.95051 WP_000074605.1.95085 WP_000074605.1.95121 WP_000074605.1.95136 WP_000074605.1.95248 WP_000074605.1.95249 WP_000074605.1.9527 WP_000074605.1.95277 WP_000074605.1.95282 WP_000074605.1.95289 WP_000074605.1.95388 WP_000074605.1.95434 WP_000074605.1.95447 WP_000074605.1.95456 WP_000074605.1.95546 WP_000074605.1.95558 WP_000074605.1.95579 WP_000074605.1.95607 WP_000074605.1.95630 WP_000074605.1.95656 WP_000074605.1.95670 WP_000074605.1.95691 WP_000074605.1.95757 WP_000074605.1.95840 WP_000074605.1.9586 WP_000074605.1.95866 WP_000074605.1.95911 WP_000074605.1.95939 WP_000074605.1.95963 WP_000074605.1.96004 WP_000074605.1.9609 WP_000074605.1.96107 WP_000074605.1.96139 WP_000074605.1.96162 WP_000074605.1.96206 WP_000074605.1.9624 WP_000074605.1.96317 WP_000074605.1.96335 WP_000074605.1.96340 WP_000074605.1.96343 WP_000074605.1.96348 WP_000074605.1.96349 WP_000074605.1.96380 WP_000074605.1.9644 WP_000074605.1.96469 WP_000074605.1.96490 WP_000074605.1.96500 WP_000074605.1.96521 WP_000074605.1.96537 WP_000074605.1.96555 WP_000074605.1.96563 WP_000074605.1.96584 WP_000074605.1.96588 WP_000074605.1.96590 WP_000074605.1.96732 WP_000074605.1.96735 WP_000074605.1.9674 WP_000074605.1.96758 WP_000074605.1.96761 WP_000074605.1.96771 WP_000074605.1.96876 WP_000074605.1.96917 WP_000074605.1.96993 WP_000074605.1.97015 WP_000074605.1.97047 WP_000074605.1.97103 WP_000074605.1.97143 WP_000074605.1.97145 WP_000074605.1.97190 WP_000074605.1.97297 WP_000074605.1.97318 WP_000074605.1.97322 WP_000074605.1.97328 WP_000074605.1.97369 WP_000074605.1.97477 WP_000074605.1.97480 WP_000074605.1.97487 WP_000074605.1.97534 WP_000074605.1.97547 WP_000074605.1.97594 WP_000074605.1.97597 WP_000074605.1.97613 WP_000074605.1.97620 WP_000074605.1.97631 WP_000074605.1.97648 WP_000074605.1.97656 WP_000074605.1.97704 WP_000074605.1.97727 WP_000074605.1.97732 WP_000074605.1.97736 WP_000074605.1.9774 WP_000074605.1.9775 WP_000074605.1.97846 WP_000074605.1.9793 WP_000074605.1.97981 WP_000074605.1.97983 WP_000074605.1.9799 WP_000074605.1.97991 WP_000074605.1.98006 WP_000074605.1.98019 WP_000074605.1.98022 WP_000074605.1.98110 WP_000074605.1.98119 WP_000074605.1.98146 WP_000074605.1.98170 WP_000074605.1.98219 WP_000074605.1.9826 WP_000074605.1.98314 WP_000074605.1.98338 WP_000074605.1.9841 WP_000074605.1.98440 WP_000074605.1.98472 WP_000074605.1.98495 WP_000074605.1.98531 WP_000074605.1.98570 WP_000074605.1.98577 WP_000074605.1.98627 WP_000074605.1.98676 WP_000074605.1.98677 WP_000074605.1.98726 WP_000074605.1.98760 WP_000074605.1.98763 WP_000074605.1.98843 WP_000074605.1.98899 WP_000074605.1.9898 WP_000074605.1.9899 WP_000074605.1.99057 WP_000074605.1.99097 WP_000074605.1.99098 WP_000074605.1.99164 WP_000074605.1.99184 WP_000074605.1.99215 WP_000074605.1.99267 WP_000074605.1.99276 WP_000074605.1.99456 WP_000074605.1.99490 WP_000074605.1.99493 WP_000074605.1.99577 WP_000074605.1.99613 WP_000074605.1.99626 WP_000074605.1.99630 WP_000074605.1.99637 WP_000074605.1.99646 WP_000074605.1.99657 WP_000074605.1.99660 WP_000074605.1.99712 WP_000074605.1.99725 WP_000074605.1.99813 WP_000074605.1.99858 WP_000074605.1.99889 WP_000074605.1.99924 WP_000074605.1.99958 WP_000074605.1.99961 gi|482905052|ref|YP_007903612.1| gi|525816294|ref|YP_008246312.1| gi|378987764|ref|YP_005250928.1| 391499 APC24304 gi|549481744|ref|YP_008612212.1| gi|525830325|ref|YP_008250246.1| gi|383495172|ref|YP_005395861.1| gi|378443867|ref|YP_005231499.1| gi|194449970|ref|YP_002044393.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]