SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378448691|ref|YP_005236050.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378448691|ref|YP_005236050.1|
Domain Number 1 Region: 4-619
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 1.13e-154
Family Acetyl-CoA synthetase-like 0.00000000136
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|378448691|ref|YP_005236050.1|
Sequence length 628
Comment propionyl-CoA synthetase [Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S]
Sequence
MSFSEFYQRSINEPEAFWAEQARRIDWRQPFTQTLDHSRPPFARWFCGGTTNLCHNAVDR
WRDKQPEALALIAVSSETDEERTFTFSQLHDEVNIVAAMLLSLGVQRGDRVLVYMPMIAE
AQITLLACARIGAIHSVVFGGFASHSVAARIDDARPALIVSADAGARGGKILPYKKLLDD
AIAQAQHQPKHVLLVDRGLAKMAWVDGRDLDFATLRQQHLGASVPVAWLESNETSCILYT
SGTTGKPKGVQRDVGGYAVALATSMDTIFGGKAGGVFFCASDIGWVVGHSYIVYAPLLAG
MATIVYEGLPTYPDCGVWWKIVEKYQVNRMFSAPTAIRVLKKFPTAQIRNHDLSSLEALY
LAGEPLDEPTASWVTETLGVPVIDNYWQTESGWPIMALARALDDRPSRLGSPGVPMYGYN
VQLLNEVTGEPCGINEKGMLVIEGPLPPGCIQTIWGDDARFVKTYWSLFNRQVYATFDWG
IRDAEGYYFILGRTDDVINIAGHRLGTREIEESISSYPNVAEVAVVGIKDALKGQVAVAF
VIPKQSDTLADREAARDEENAIMALVDNQIGHFGRPAHVWFVSQLPKTRSGKMLRRTIQA
ICEGRDPGDLTTIDDPASLQQIRQAIEE
Download sequence
Identical sequences A0A0D6HC33 A0A0F6AXI2 A0A0F7J6L9 A0A0H3N850 A0A0U1FVK9 A0A0W4Q3L5 A0A2D3ALR7 A0A2H9YN92 E8XJS0 P55912
gi|383495180|ref|YP_005395869.1| gi|198245504|ref|YP_002214322.1| NP_459366.1.58477 WP_000010229.1.100010 WP_000010229.1.100234 WP_000010229.1.100376 WP_000010229.1.100424 WP_000010229.1.100436 WP_000010229.1.100484 WP_000010229.1.100488 WP_000010229.1.100597 WP_000010229.1.10076 WP_000010229.1.100781 WP_000010229.1.100793 WP_000010229.1.100869 WP_000010229.1.100871 WP_000010229.1.100882 WP_000010229.1.101007 WP_000010229.1.101020 WP_000010229.1.101074 WP_000010229.1.101078 WP_000010229.1.101180 WP_000010229.1.101259 WP_000010229.1.101284 WP_000010229.1.101291 WP_000010229.1.101353 WP_000010229.1.101386 WP_000010229.1.101404 WP_000010229.1.101420 WP_000010229.1.101589 WP_000010229.1.101707 WP_000010229.1.101734 WP_000010229.1.101878 WP_000010229.1.101953 WP_000010229.1.10220 WP_000010229.1.10266 WP_000010229.1.10429 WP_000010229.1.10439 WP_000010229.1.10678 WP_000010229.1.10753 WP_000010229.1.10992 WP_000010229.1.11024 WP_000010229.1.11031 WP_000010229.1.11098 WP_000010229.1.11168 WP_000010229.1.11190 WP_000010229.1.11295 WP_000010229.1.11455 WP_000010229.1.11458 WP_000010229.1.11518 WP_000010229.1.11532 WP_000010229.1.11763 WP_000010229.1.11772 WP_000010229.1.11897 WP_000010229.1.12114 WP_000010229.1.12351 WP_000010229.1.12370 WP_000010229.1.1239 WP_000010229.1.12546 WP_000010229.1.1264 WP_000010229.1.12728 WP_000010229.1.12879 WP_000010229.1.12936 WP_000010229.1.12995 WP_000010229.1.13106 WP_000010229.1.13130 WP_000010229.1.13414 WP_000010229.1.13488 WP_000010229.1.13509 WP_000010229.1.13669 WP_000010229.1.13741 WP_000010229.1.1387 WP_000010229.1.13908 WP_000010229.1.13932 WP_000010229.1.13968 WP_000010229.1.14001 WP_000010229.1.14151 WP_000010229.1.14320 WP_000010229.1.14379 WP_000010229.1.14406 WP_000010229.1.14410 WP_000010229.1.14466 WP_000010229.1.14524 WP_000010229.1.14554 WP_000010229.1.14725 WP_000010229.1.14852 WP_000010229.1.1489 WP_000010229.1.14932 WP_000010229.1.15055 WP_000010229.1.15124 WP_000010229.1.15223 WP_000010229.1.15226 WP_000010229.1.15316 WP_000010229.1.15369 WP_000010229.1.1540 WP_000010229.1.15508 WP_000010229.1.15784 WP_000010229.1.15830 WP_000010229.1.16062 WP_000010229.1.16063 WP_000010229.1.16103 WP_000010229.1.16226 WP_000010229.1.16233 WP_000010229.1.16284 WP_000010229.1.16328 WP_000010229.1.1635 WP_000010229.1.16468 WP_000010229.1.16614 WP_000010229.1.16650 WP_000010229.1.16686 WP_000010229.1.16691 WP_000010229.1.16732 WP_000010229.1.16735 WP_000010229.1.16786 WP_000010229.1.16858 WP_000010229.1.16896 WP_000010229.1.16965 WP_000010229.1.1700 WP_000010229.1.17307 WP_000010229.1.174 WP_000010229.1.17480 WP_000010229.1.17546 WP_000010229.1.17702 WP_000010229.1.17705 WP_000010229.1.18019 WP_000010229.1.18111 WP_000010229.1.18163 WP_000010229.1.18265 WP_000010229.1.18267 WP_000010229.1.18468 WP_000010229.1.18607 WP_000010229.1.18705 WP_000010229.1.18715 WP_000010229.1.18776 WP_000010229.1.18822 WP_000010229.1.18881 WP_000010229.1.18949 WP_000010229.1.19053 WP_000010229.1.19320 WP_000010229.1.19458 WP_000010229.1.19461 WP_000010229.1.19614 WP_000010229.1.19702 WP_000010229.1.19706 WP_000010229.1.19724 WP_000010229.1.19784 WP_000010229.1.19802 WP_000010229.1.19809 WP_000010229.1.19867 WP_000010229.1.1998 WP_000010229.1.20 WP_000010229.1.2010 WP_000010229.1.20212 WP_000010229.1.20266 WP_000010229.1.20271 WP_000010229.1.20362 WP_000010229.1.20418 WP_000010229.1.20443 WP_000010229.1.2054 WP_000010229.1.20553 WP_000010229.1.20626 WP_000010229.1.20646 WP_000010229.1.20886 WP_000010229.1.20908 WP_000010229.1.21049 WP_000010229.1.21146 WP_000010229.1.21245 WP_000010229.1.21246 WP_000010229.1.21269 WP_000010229.1.21400 WP_000010229.1.21497 WP_000010229.1.21499 WP_000010229.1.21603 WP_000010229.1.21751 WP_000010229.1.21757 WP_000010229.1.22024 WP_000010229.1.2205 WP_000010229.1.22062 WP_000010229.1.22067 WP_000010229.1.2221 WP_000010229.1.22379 WP_000010229.1.22427 WP_000010229.1.2246 WP_000010229.1.22485 WP_000010229.1.22620 WP_000010229.1.22870 WP_000010229.1.22979 WP_000010229.1.23102 WP_000010229.1.23114 WP_000010229.1.2314 WP_000010229.1.23192 WP_000010229.1.23259 WP_000010229.1.23460 WP_000010229.1.23472 WP_000010229.1.23482 WP_000010229.1.23634 WP_000010229.1.2364 WP_000010229.1.23932 WP_000010229.1.24017 WP_000010229.1.24206 WP_000010229.1.24308 WP_000010229.1.24578 WP_000010229.1.24737 WP_000010229.1.24779 WP_000010229.1.25008 WP_000010229.1.25015 WP_000010229.1.25454 WP_000010229.1.25493 WP_000010229.1.25668 WP_000010229.1.25690 WP_000010229.1.2570 WP_000010229.1.25740 WP_000010229.1.25814 WP_000010229.1.25988 WP_000010229.1.26282 WP_000010229.1.26311 WP_000010229.1.26319 WP_000010229.1.26429 WP_000010229.1.26440 WP_000010229.1.26493 WP_000010229.1.26551 WP_000010229.1.26567 WP_000010229.1.27173 WP_000010229.1.27206 WP_000010229.1.27423 WP_000010229.1.2763 WP_000010229.1.27665 WP_000010229.1.27707 WP_000010229.1.27761 WP_000010229.1.2777 WP_000010229.1.27815 WP_000010229.1.27857 WP_000010229.1.27977 WP_000010229.1.28094 WP_000010229.1.28170 WP_000010229.1.28302 WP_000010229.1.2835 WP_000010229.1.28370 WP_000010229.1.28538 WP_000010229.1.28575 WP_000010229.1.28625 WP_000010229.1.28655 WP_000010229.1.28694 WP_000010229.1.2879 WP_000010229.1.2890 WP_000010229.1.28938 WP_000010229.1.28946 WP_000010229.1.29006 WP_000010229.1.29010 WP_000010229.1.2910 WP_000010229.1.29588 WP_000010229.1.29601 WP_000010229.1.29606 WP_000010229.1.29615 WP_000010229.1.29704 WP_000010229.1.29969 WP_000010229.1.30006 WP_000010229.1.30027 WP_000010229.1.30180 WP_000010229.1.30469 WP_000010229.1.30505 WP_000010229.1.30507 WP_000010229.1.30535 WP_000010229.1.30547 WP_000010229.1.30794 WP_000010229.1.30833 WP_000010229.1.30835 WP_000010229.1.30972 WP_000010229.1.31 WP_000010229.1.3113 WP_000010229.1.31185 WP_000010229.1.3119 WP_000010229.1.31190 WP_000010229.1.31195 WP_000010229.1.31196 WP_000010229.1.31281 WP_000010229.1.31362 WP_000010229.1.31504 WP_000010229.1.31515 WP_000010229.1.31578 WP_000010229.1.31658 WP_000010229.1.31940 WP_000010229.1.31967 WP_000010229.1.31972 WP_000010229.1.32192 WP_000010229.1.32206 WP_000010229.1.32438 WP_000010229.1.32515 WP_000010229.1.32660 WP_000010229.1.32702 WP_000010229.1.32714 WP_000010229.1.32786 WP_000010229.1.32804 WP_000010229.1.32907 WP_000010229.1.33030 WP_000010229.1.33127 WP_000010229.1.33143 WP_000010229.1.33248 WP_000010229.1.33261 WP_000010229.1.333 WP_000010229.1.33492 WP_000010229.1.33553 WP_000010229.1.33592 WP_000010229.1.33865 WP_000010229.1.33894 WP_000010229.1.34043 WP_000010229.1.34075 WP_000010229.1.34257 WP_000010229.1.34279 WP_000010229.1.34319 WP_000010229.1.34453 WP_000010229.1.34610 WP_000010229.1.34856 WP_000010229.1.34975 WP_000010229.1.35045 WP_000010229.1.35129 WP_000010229.1.35184 WP_000010229.1.35404 WP_000010229.1.35408 WP_000010229.1.35425 WP_000010229.1.35446 WP_000010229.1.35503 WP_000010229.1.35509 WP_000010229.1.35590 WP_000010229.1.35940 WP_000010229.1.36003 WP_000010229.1.3601 WP_000010229.1.36609 WP_000010229.1.36690 WP_000010229.1.3670 WP_000010229.1.36705 WP_000010229.1.36918 WP_000010229.1.36931 WP_000010229.1.37073 WP_000010229.1.37111 WP_000010229.1.37112 WP_000010229.1.37256 WP_000010229.1.37293 WP_000010229.1.37370 WP_000010229.1.37376 WP_000010229.1.3744 WP_000010229.1.37498 WP_000010229.1.37504 WP_000010229.1.37618 WP_000010229.1.37968 WP_000010229.1.37978 WP_000010229.1.38125 WP_000010229.1.38145 WP_000010229.1.383 WP_000010229.1.3848 WP_000010229.1.38613 WP_000010229.1.38673 WP_000010229.1.38693 WP_000010229.1.38773 WP_000010229.1.38882 WP_000010229.1.38913 WP_000010229.1.39003 WP_000010229.1.39136 WP_000010229.1.39197 WP_000010229.1.39229 WP_000010229.1.39405 WP_000010229.1.39420 WP_000010229.1.39449 WP_000010229.1.39512 WP_000010229.1.39629 WP_000010229.1.39763 WP_000010229.1.39862 WP_000010229.1.39923 WP_000010229.1.40017 WP_000010229.1.40072 WP_000010229.1.4011 WP_000010229.1.40208 WP_000010229.1.40240 WP_000010229.1.40257 WP_000010229.1.40292 WP_000010229.1.40305 WP_000010229.1.40311 WP_000010229.1.40380 WP_000010229.1.40395 WP_000010229.1.40465 WP_000010229.1.40710 WP_000010229.1.4075 WP_000010229.1.4087 WP_000010229.1.40877 WP_000010229.1.41017 WP_000010229.1.41086 WP_000010229.1.41091 WP_000010229.1.41226 WP_000010229.1.41279 WP_000010229.1.41516 WP_000010229.1.41554 WP_000010229.1.41572 WP_000010229.1.41591 WP_000010229.1.41662 WP_000010229.1.41708 WP_000010229.1.41761 WP_000010229.1.41882 WP_000010229.1.41979 WP_000010229.1.41985 WP_000010229.1.42104 WP_000010229.1.42320 WP_000010229.1.42342 WP_000010229.1.42422 WP_000010229.1.4276 WP_000010229.1.42864 WP_000010229.1.4288 WP_000010229.1.43018 WP_000010229.1.43041 WP_000010229.1.43244 WP_000010229.1.43312 WP_000010229.1.43334 WP_000010229.1.43437 WP_000010229.1.43522 WP_000010229.1.43613 WP_000010229.1.43668 WP_000010229.1.43886 WP_000010229.1.44005 WP_000010229.1.44043 WP_000010229.1.44099 WP_000010229.1.44121 WP_000010229.1.44291 WP_000010229.1.44310 WP_000010229.1.44386 WP_000010229.1.44479 WP_000010229.1.44640 WP_000010229.1.4467 WP_000010229.1.44747 WP_000010229.1.4485 WP_000010229.1.44877 WP_000010229.1.44927 WP_000010229.1.45067 WP_000010229.1.45074 WP_000010229.1.45079 WP_000010229.1.45098 WP_000010229.1.45177 WP_000010229.1.45184 WP_000010229.1.45259 WP_000010229.1.45349 WP_000010229.1.45365 WP_000010229.1.45550 WP_000010229.1.45585 WP_000010229.1.45660 WP_000010229.1.45690 WP_000010229.1.458 WP_000010229.1.46011 WP_000010229.1.46069 WP_000010229.1.46112 WP_000010229.1.46173 WP_000010229.1.46174 WP_000010229.1.46187 WP_000010229.1.46303 WP_000010229.1.46595 WP_000010229.1.46675 WP_000010229.1.47057 WP_000010229.1.47214 WP_000010229.1.47429 WP_000010229.1.47448 WP_000010229.1.4747 WP_000010229.1.47472 WP_000010229.1.47478 WP_000010229.1.47621 WP_000010229.1.47799 WP_000010229.1.48242 WP_000010229.1.48253 WP_000010229.1.483 WP_000010229.1.48367 WP_000010229.1.48377 WP_000010229.1.4853 WP_000010229.1.48788 WP_000010229.1.4885 WP_000010229.1.48894 WP_000010229.1.48919 WP_000010229.1.49084 WP_000010229.1.49155 WP_000010229.1.49204 WP_000010229.1.49239 WP_000010229.1.49256 WP_000010229.1.49290 WP_000010229.1.49340 WP_000010229.1.49366 WP_000010229.1.49490 WP_000010229.1.49515 WP_000010229.1.49572 WP_000010229.1.4979 WP_000010229.1.49803 WP_000010229.1.49805 WP_000010229.1.49929 WP_000010229.1.50080 WP_000010229.1.50161 WP_000010229.1.50211 WP_000010229.1.50376 WP_000010229.1.50389 WP_000010229.1.50676 WP_000010229.1.50804 WP_000010229.1.50808 WP_000010229.1.5088 WP_000010229.1.50908 WP_000010229.1.50941 WP_000010229.1.51014 WP_000010229.1.51022 WP_000010229.1.51179 WP_000010229.1.51182 WP_000010229.1.51186 WP_000010229.1.51487 WP_000010229.1.51488 WP_000010229.1.51634 WP_000010229.1.51649 WP_000010229.1.51686 WP_000010229.1.51756 WP_000010229.1.51911 WP_000010229.1.51932 WP_000010229.1.51989 WP_000010229.1.52121 WP_000010229.1.52353 WP_000010229.1.52361 WP_000010229.1.52653 WP_000010229.1.52656 WP_000010229.1.52743 WP_000010229.1.52857 WP_000010229.1.52898 WP_000010229.1.52915 WP_000010229.1.53190 WP_000010229.1.53406 WP_000010229.1.53466 WP_000010229.1.53529 WP_000010229.1.53543 WP_000010229.1.53757 WP_000010229.1.53812 WP_000010229.1.54033 WP_000010229.1.54075 WP_000010229.1.54196 WP_000010229.1.54209 WP_000010229.1.54271 WP_000010229.1.54274 WP_000010229.1.54319 WP_000010229.1.54364 WP_000010229.1.54400 WP_000010229.1.54644 WP_000010229.1.54662 WP_000010229.1.54722 WP_000010229.1.54749 WP_000010229.1.54764 WP_000010229.1.55008 WP_000010229.1.55152 WP_000010229.1.55156 WP_000010229.1.55285 WP_000010229.1.55475 WP_000010229.1.55647 WP_000010229.1.55743 WP_000010229.1.55768 WP_000010229.1.55782 WP_000010229.1.55796 WP_000010229.1.56002 WP_000010229.1.56012 WP_000010229.1.56105 WP_000010229.1.56238 WP_000010229.1.56286 WP_000010229.1.56304 WP_000010229.1.56414 WP_000010229.1.56438 WP_000010229.1.56560 WP_000010229.1.56601 WP_000010229.1.56614 WP_000010229.1.56671 WP_000010229.1.56682 WP_000010229.1.56877 WP_000010229.1.57168 WP_000010229.1.57187 WP_000010229.1.57377 WP_000010229.1.57418 WP_000010229.1.57433 WP_000010229.1.57515 WP_000010229.1.57529 WP_000010229.1.57576 WP_000010229.1.57601 WP_000010229.1.57607 WP_000010229.1.57763 WP_000010229.1.57862 WP_000010229.1.57890 WP_000010229.1.57891 WP_000010229.1.57978 WP_000010229.1.5801 WP_000010229.1.58041 WP_000010229.1.58418 WP_000010229.1.58548 WP_000010229.1.5858 WP_000010229.1.58662 WP_000010229.1.58669 WP_000010229.1.58745 WP_000010229.1.58803 WP_000010229.1.5886 WP_000010229.1.59094 WP_000010229.1.59224 WP_000010229.1.59321 WP_000010229.1.59375 WP_000010229.1.59458 WP_000010229.1.59490 WP_000010229.1.59508 WP_000010229.1.59684 WP_000010229.1.59694 WP_000010229.1.59771 WP_000010229.1.5979 WP_000010229.1.59953 WP_000010229.1.60008 WP_000010229.1.60021 WP_000010229.1.60069 WP_000010229.1.60140 WP_000010229.1.60155 WP_000010229.1.60285 WP_000010229.1.60379 WP_000010229.1.60464 WP_000010229.1.60874 WP_000010229.1.60941 WP_000010229.1.61078 WP_000010229.1.6114 WP_000010229.1.61232 WP_000010229.1.6129 WP_000010229.1.61345 WP_000010229.1.61417 WP_000010229.1.61574 WP_000010229.1.61712 WP_000010229.1.61714 WP_000010229.1.61730 WP_000010229.1.61857 WP_000010229.1.61918 WP_000010229.1.61952 WP_000010229.1.62007 WP_000010229.1.62025 WP_000010229.1.62204 WP_000010229.1.62304 WP_000010229.1.62364 WP_000010229.1.62374 WP_000010229.1.62403 WP_000010229.1.6253 WP_000010229.1.62853 WP_000010229.1.62903 WP_000010229.1.62955 WP_000010229.1.63181 WP_000010229.1.63203 WP_000010229.1.63256 WP_000010229.1.63290 WP_000010229.1.63382 WP_000010229.1.63432 WP_000010229.1.63461 WP_000010229.1.63479 WP_000010229.1.63577 WP_000010229.1.63664 WP_000010229.1.63718 WP_000010229.1.6375 WP_000010229.1.63757 WP_000010229.1.63834 WP_000010229.1.64046 WP_000010229.1.6423 WP_000010229.1.64244 WP_000010229.1.64403 WP_000010229.1.64649 WP_000010229.1.64702 WP_000010229.1.64757 WP_000010229.1.64781 WP_000010229.1.64831 WP_000010229.1.6489 WP_000010229.1.65018 WP_000010229.1.65028 WP_000010229.1.65171 WP_000010229.1.65248 WP_000010229.1.65474 WP_000010229.1.65633 WP_000010229.1.6565 WP_000010229.1.65696 WP_000010229.1.6575 WP_000010229.1.65782 WP_000010229.1.6630 WP_000010229.1.66314 WP_000010229.1.66358 WP_000010229.1.66362 WP_000010229.1.6638 WP_000010229.1.6640 WP_000010229.1.66698 WP_000010229.1.6680 WP_000010229.1.66834 WP_000010229.1.66901 WP_000010229.1.67037 WP_000010229.1.67045 WP_000010229.1.67181 WP_000010229.1.67268 WP_000010229.1.67347 WP_000010229.1.67465 WP_000010229.1.67552 WP_000010229.1.67682 WP_000010229.1.67829 WP_000010229.1.67887 WP_000010229.1.68201 WP_000010229.1.68206 WP_000010229.1.6827 WP_000010229.1.68275 WP_000010229.1.6849 WP_000010229.1.68547 WP_000010229.1.68589 WP_000010229.1.68655 WP_000010229.1.68656 WP_000010229.1.68778 WP_000010229.1.68787 WP_000010229.1.68894 WP_000010229.1.68928 WP_000010229.1.68975 WP_000010229.1.69006 WP_000010229.1.6913 WP_000010229.1.69146 WP_000010229.1.69255 WP_000010229.1.69397 WP_000010229.1.69564 WP_000010229.1.69644 WP_000010229.1.69704 WP_000010229.1.7021 WP_000010229.1.70241 WP_000010229.1.70269 WP_000010229.1.70289 WP_000010229.1.70447 WP_000010229.1.70485 WP_000010229.1.70643 WP_000010229.1.70683 WP_000010229.1.70883 WP_000010229.1.70922 WP_000010229.1.70929 WP_000010229.1.70948 WP_000010229.1.71116 WP_000010229.1.71146 WP_000010229.1.71165 WP_000010229.1.71188 WP_000010229.1.71202 WP_000010229.1.71243 WP_000010229.1.71306 WP_000010229.1.71337 WP_000010229.1.71378 WP_000010229.1.71401 WP_000010229.1.71600 WP_000010229.1.71702 WP_000010229.1.71750 WP_000010229.1.71845 WP_000010229.1.71881 WP_000010229.1.71908 WP_000010229.1.71952 WP_000010229.1.71973 WP_000010229.1.72105 WP_000010229.1.72203 WP_000010229.1.72376 WP_000010229.1.72594 WP_000010229.1.72871 WP_000010229.1.72975 WP_000010229.1.7315 WP_000010229.1.73200 WP_000010229.1.7334 WP_000010229.1.73377 WP_000010229.1.73481 WP_000010229.1.7356 WP_000010229.1.73581 WP_000010229.1.73617 WP_000010229.1.73753 WP_000010229.1.73758 WP_000010229.1.73794 WP_000010229.1.7387 WP_000010229.1.74029 WP_000010229.1.74181 WP_000010229.1.74191 WP_000010229.1.7433 WP_000010229.1.74379 WP_000010229.1.74410 WP_000010229.1.74529 WP_000010229.1.74545 WP_000010229.1.74745 WP_000010229.1.74826 WP_000010229.1.75129 WP_000010229.1.75187 WP_000010229.1.75288 WP_000010229.1.75334 WP_000010229.1.75362 WP_000010229.1.75385 WP_000010229.1.75392 WP_000010229.1.75760 WP_000010229.1.75764 WP_000010229.1.75837 WP_000010229.1.75874 WP_000010229.1.75945 WP_000010229.1.76020 WP_000010229.1.76252 WP_000010229.1.76445 WP_000010229.1.7660 WP_000010229.1.76673 WP_000010229.1.76706 WP_000010229.1.76721 WP_000010229.1.76756 WP_000010229.1.76760 WP_000010229.1.76875 WP_000010229.1.76880 WP_000010229.1.76899 WP_000010229.1.77038 WP_000010229.1.77047 WP_000010229.1.77067 WP_000010229.1.77080 WP_000010229.1.7712 WP_000010229.1.77180 WP_000010229.1.77244 WP_000010229.1.77292 WP_000010229.1.77349 WP_000010229.1.77514 WP_000010229.1.77529 WP_000010229.1.77549 WP_000010229.1.77692 WP_000010229.1.7782 WP_000010229.1.77851 WP_000010229.1.77898 WP_000010229.1.77918 WP_000010229.1.78053 WP_000010229.1.78076 WP_000010229.1.78096 WP_000010229.1.78100 WP_000010229.1.78110 WP_000010229.1.78120 WP_000010229.1.78407 WP_000010229.1.7861 WP_000010229.1.78618 WP_000010229.1.78673 WP_000010229.1.78735 WP_000010229.1.78802 WP_000010229.1.78830 WP_000010229.1.78835 WP_000010229.1.78871 WP_000010229.1.78874 WP_000010229.1.78918 WP_000010229.1.78930 WP_000010229.1.79151 WP_000010229.1.79167 WP_000010229.1.79335 WP_000010229.1.79462 WP_000010229.1.79472 WP_000010229.1.79490 WP_000010229.1.79495 WP_000010229.1.79529 WP_000010229.1.79570 WP_000010229.1.7964 WP_000010229.1.79659 WP_000010229.1.79668 WP_000010229.1.79708 WP_000010229.1.79845 WP_000010229.1.80077 WP_000010229.1.80137 WP_000010229.1.80182 WP_000010229.1.80296 WP_000010229.1.80366 WP_000010229.1.80780 WP_000010229.1.80831 WP_000010229.1.80850 WP_000010229.1.80881 WP_000010229.1.80939 WP_000010229.1.8096 WP_000010229.1.81037 WP_000010229.1.81069 WP_000010229.1.81175 WP_000010229.1.8119 WP_000010229.1.81354 WP_000010229.1.81425 WP_000010229.1.81750 WP_000010229.1.81785 WP_000010229.1.81902 WP_000010229.1.81974 WP_000010229.1.82337 WP_000010229.1.82479 WP_000010229.1.82503 WP_000010229.1.82515 WP_000010229.1.82676 WP_000010229.1.82761 WP_000010229.1.8282 WP_000010229.1.82944 WP_000010229.1.82956 WP_000010229.1.83092 WP_000010229.1.83163 WP_000010229.1.83305 WP_000010229.1.83491 WP_000010229.1.83523 WP_000010229.1.8354 WP_000010229.1.83721 WP_000010229.1.83760 WP_000010229.1.83995 WP_000010229.1.84103 WP_000010229.1.84283 WP_000010229.1.84392 WP_000010229.1.8441 WP_000010229.1.84659 WP_000010229.1.84899 WP_000010229.1.85040 WP_000010229.1.85178 WP_000010229.1.85190 WP_000010229.1.8533 WP_000010229.1.8545 WP_000010229.1.85481 WP_000010229.1.85483 WP_000010229.1.85541 WP_000010229.1.8556 WP_000010229.1.85615 WP_000010229.1.85617 WP_000010229.1.85663 WP_000010229.1.85671 WP_000010229.1.85672 WP_000010229.1.85777 WP_000010229.1.85886 WP_000010229.1.85900 WP_000010229.1.85904 WP_000010229.1.85976 WP_000010229.1.86306 WP_000010229.1.86356 WP_000010229.1.86450 WP_000010229.1.86469 WP_000010229.1.86580 WP_000010229.1.86588 WP_000010229.1.86661 WP_000010229.1.8672 WP_000010229.1.8678 WP_000010229.1.86810 WP_000010229.1.8684 WP_000010229.1.86895 WP_000010229.1.86906 WP_000010229.1.87095 WP_000010229.1.8736 WP_000010229.1.87460 WP_000010229.1.87552 WP_000010229.1.87779 WP_000010229.1.87936 WP_000010229.1.87945 WP_000010229.1.88019 WP_000010229.1.88073 WP_000010229.1.8809 WP_000010229.1.88291 WP_000010229.1.88293 WP_000010229.1.8837 WP_000010229.1.88393 WP_000010229.1.88703 WP_000010229.1.88792 WP_000010229.1.88902 WP_000010229.1.8891 WP_000010229.1.89008 WP_000010229.1.89116 WP_000010229.1.89138 WP_000010229.1.89304 WP_000010229.1.89512 WP_000010229.1.89527 WP_000010229.1.89570 WP_000010229.1.89604 WP_000010229.1.89622 WP_000010229.1.89659 WP_000010229.1.89902 WP_000010229.1.8996 WP_000010229.1.90097 WP_000010229.1.90252 WP_000010229.1.90417 WP_000010229.1.90453 WP_000010229.1.90458 WP_000010229.1.90557 WP_000010229.1.90585 WP_000010229.1.90641 WP_000010229.1.90734 WP_000010229.1.91003 WP_000010229.1.91069 WP_000010229.1.91278 WP_000010229.1.91512 WP_000010229.1.91564 WP_000010229.1.91628 WP_000010229.1.91655 WP_000010229.1.91724 WP_000010229.1.91732 WP_000010229.1.91788 WP_000010229.1.92013 WP_000010229.1.92093 WP_000010229.1.92108 WP_000010229.1.92183 WP_000010229.1.92208 WP_000010229.1.92268 WP_000010229.1.92310 WP_000010229.1.92443 WP_000010229.1.92482 WP_000010229.1.92531 WP_000010229.1.92669 WP_000010229.1.92671 WP_000010229.1.92738 WP_000010229.1.93086 WP_000010229.1.93101 WP_000010229.1.93136 WP_000010229.1.93155 WP_000010229.1.93365 WP_000010229.1.93543 WP_000010229.1.93650 WP_000010229.1.93656 WP_000010229.1.93662 WP_000010229.1.937 WP_000010229.1.93705 WP_000010229.1.93804 WP_000010229.1.9389 WP_000010229.1.93994 WP_000010229.1.94072 WP_000010229.1.94162 WP_000010229.1.94168 WP_000010229.1.94198 WP_000010229.1.9432 WP_000010229.1.94354 WP_000010229.1.94380 WP_000010229.1.94458 WP_000010229.1.94565 WP_000010229.1.94584 WP_000010229.1.94674 WP_000010229.1.94796 WP_000010229.1.94959 WP_000010229.1.94983 WP_000010229.1.95051 WP_000010229.1.95085 WP_000010229.1.95121 WP_000010229.1.95282 WP_000010229.1.95630 WP_000010229.1.95911 WP_000010229.1.96139 WP_000010229.1.96317 WP_000010229.1.96343 WP_000010229.1.9644 WP_000010229.1.96469 WP_000010229.1.96490 WP_000010229.1.96500 WP_000010229.1.96563 WP_000010229.1.96732 WP_000010229.1.96771 WP_000010229.1.97015 WP_000010229.1.97145 WP_000010229.1.97190 WP_000010229.1.97318 WP_000010229.1.97369 WP_000010229.1.97594 WP_000010229.1.97597 WP_000010229.1.97613 WP_000010229.1.97620 WP_000010229.1.97727 WP_000010229.1.97732 WP_000010229.1.97736 WP_000010229.1.9775 WP_000010229.1.97846 WP_000010229.1.98006 WP_000010229.1.98019 WP_000010229.1.98022 WP_000010229.1.98110 WP_000010229.1.98146 WP_000010229.1.98219 WP_000010229.1.9841 WP_000010229.1.98495 WP_000010229.1.98531 WP_000010229.1.98577 WP_000010229.1.98676 WP_000010229.1.98677 WP_000010229.1.98760 WP_000010229.1.98843 WP_000010229.1.9898 WP_000010229.1.99098 WP_000010229.1.99184 WP_000010229.1.99267 WP_000010229.1.99276 WP_000010229.1.99646 WP_000010229.1.99657 WP_000010229.1.99660 WP_000010229.1.99712 WP_000010229.1.99813 WP_000010229.1.99858 WP_000010229.1.99889 WP_000010229.1.99958 gi|16763751|ref|NP_459366.1| gi|526219274|ref|YP_008264621.1| gi|482905044|ref|YP_007903604.1| gi|379699586|ref|YP_005241314.1| gi|378443875|ref|YP_005231507.1| gi|550899825|ref|YP_008668917.1| gi|378698335|ref|YP_005180292.1| gi|378987772|ref|YP_005250936.1| ABAO01000012|CDS_39322-41208 AE006468|CDS_421688-423574 CP001144|CDS_424986-426872 CP001363|CDS_422381-424267 FN424405|CDS_462192-464078 gi|378982974|ref|YP_005246129.1| gi|549723085|ref|YP_008643275.1| gi|378448691|ref|YP_005236050.1| gi|525839170|ref|YP_008256390.1| 439851.SeD_A0403 99287.STM0371

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]