SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378448719|ref|YP_005236078.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378448719|ref|YP_005236078.1|
Domain Number 1 Region: 1-94
Classification Level Classification E-value
Superfamily RmlC-like cupins 2.44e-33
Family VPA0057-like 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|378448719|ref|YP_005236078.1|
Sequence length 94
Comment hypothetical protein STM14_0462 [Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S]
Sequence
MLQSNEYFSGKVKSIGFTSSSTGRASVGVMAEGEYTFGTAEPEEMTVVSGALKVLLPGTV
EWKVYTAGEVFNVPGHSEFHLQVAEPASYLCRYL
Download sequence
Identical sequences A0A0D6HBQ1 A0A0F6AXL0 A0A0F7J478 A0A0H3N873 A0A0W4AVI3 A0A2D3ALQ6 A0A2G1P9E8 A0A2H9YN72 A9MX47 E8XKH5 G5RBF3 Q8ZRE7
272994.SPAB_03199 99287.STM0391 gi|379699608|ref|YP_005241336.1| NP_459386.1.58477 WP_000941952.1.100010 WP_000941952.1.100115 WP_000941952.1.100234 WP_000941952.1.100258 WP_000941952.1.100376 WP_000941952.1.100424 WP_000941952.1.100436 WP_000941952.1.100484 WP_000941952.1.100488 WP_000941952.1.100597 WP_000941952.1.10076 WP_000941952.1.100781 WP_000941952.1.100793 WP_000941952.1.100869 WP_000941952.1.100871 WP_000941952.1.100882 WP_000941952.1.101007 WP_000941952.1.101020 WP_000941952.1.101042 WP_000941952.1.101074 WP_000941952.1.101078 WP_000941952.1.101180 WP_000941952.1.101185 WP_000941952.1.101259 WP_000941952.1.101284 WP_000941952.1.101291 WP_000941952.1.101320 WP_000941952.1.101353 WP_000941952.1.101386 WP_000941952.1.101404 WP_000941952.1.101420 WP_000941952.1.101589 WP_000941952.1.101707 WP_000941952.1.101734 WP_000941952.1.101841 WP_000941952.1.101878 WP_000941952.1.10191 WP_000941952.1.101953 WP_000941952.1.10220 WP_000941952.1.10266 WP_000941952.1.10429 WP_000941952.1.10439 WP_000941952.1.10521 WP_000941952.1.10678 WP_000941952.1.10753 WP_000941952.1.10992 WP_000941952.1.11000 WP_000941952.1.11024 WP_000941952.1.11031 WP_000941952.1.11098 WP_000941952.1.11168 WP_000941952.1.11190 WP_000941952.1.11295 WP_000941952.1.11455 WP_000941952.1.11458 WP_000941952.1.11518 WP_000941952.1.11532 WP_000941952.1.11543 WP_000941952.1.11763 WP_000941952.1.11772 WP_000941952.1.11897 WP_000941952.1.12025 WP_000941952.1.12114 WP_000941952.1.12244 WP_000941952.1.12351 WP_000941952.1.12370 WP_000941952.1.12546 WP_000941952.1.12584 WP_000941952.1.1264 WP_000941952.1.12718 WP_000941952.1.12728 WP_000941952.1.12879 WP_000941952.1.12936 WP_000941952.1.12995 WP_000941952.1.13027 WP_000941952.1.13106 WP_000941952.1.13130 WP_000941952.1.13334 WP_000941952.1.13414 WP_000941952.1.13488 WP_000941952.1.13509 WP_000941952.1.13669 WP_000941952.1.13741 WP_000941952.1.1387 WP_000941952.1.13908 WP_000941952.1.13932 WP_000941952.1.13968 WP_000941952.1.14001 WP_000941952.1.14151 WP_000941952.1.14239 WP_000941952.1.14286 WP_000941952.1.14320 WP_000941952.1.14379 WP_000941952.1.14406 WP_000941952.1.14410 WP_000941952.1.14466 WP_000941952.1.14516 WP_000941952.1.14524 WP_000941952.1.14554 WP_000941952.1.14725 WP_000941952.1.14852 WP_000941952.1.1489 WP_000941952.1.14932 WP_000941952.1.15055 WP_000941952.1.15124 WP_000941952.1.15223 WP_000941952.1.15226 WP_000941952.1.15316 WP_000941952.1.15369 WP_000941952.1.1540 WP_000941952.1.15508 WP_000941952.1.15784 WP_000941952.1.15830 WP_000941952.1.16062 WP_000941952.1.16063 WP_000941952.1.16103 WP_000941952.1.16226 WP_000941952.1.16233 WP_000941952.1.16244 WP_000941952.1.16284 WP_000941952.1.16328 WP_000941952.1.1635 WP_000941952.1.16468 WP_000941952.1.16614 WP_000941952.1.16650 WP_000941952.1.16686 WP_000941952.1.16691 WP_000941952.1.167 WP_000941952.1.16732 WP_000941952.1.16735 WP_000941952.1.16786 WP_000941952.1.16819 WP_000941952.1.16858 WP_000941952.1.16896 WP_000941952.1.16916 WP_000941952.1.16965 WP_000941952.1.1700 WP_000941952.1.17307 WP_000941952.1.174 WP_000941952.1.17480 WP_000941952.1.17546 WP_000941952.1.17702 WP_000941952.1.17705 WP_000941952.1.17747 WP_000941952.1.18019 WP_000941952.1.18111 WP_000941952.1.18163 WP_000941952.1.18265 WP_000941952.1.18267 WP_000941952.1.18281 WP_000941952.1.18282 WP_000941952.1.18468 WP_000941952.1.18607 WP_000941952.1.18692 WP_000941952.1.18705 WP_000941952.1.18715 WP_000941952.1.18776 WP_000941952.1.18822 WP_000941952.1.18881 WP_000941952.1.18940 WP_000941952.1.18949 WP_000941952.1.19053 WP_000941952.1.19320 WP_000941952.1.19458 WP_000941952.1.19460 WP_000941952.1.19461 WP_000941952.1.19614 WP_000941952.1.19642 WP_000941952.1.19702 WP_000941952.1.19706 WP_000941952.1.19724 WP_000941952.1.19749 WP_000941952.1.19784 WP_000941952.1.19802 WP_000941952.1.19809 WP_000941952.1.19867 WP_000941952.1.1998 WP_000941952.1.20 WP_000941952.1.2010 WP_000941952.1.20212 WP_000941952.1.20266 WP_000941952.1.20271 WP_000941952.1.20330 WP_000941952.1.20362 WP_000941952.1.20418 WP_000941952.1.20443 WP_000941952.1.20525 WP_000941952.1.2054 WP_000941952.1.20553 WP_000941952.1.20626 WP_000941952.1.20646 WP_000941952.1.20721 WP_000941952.1.20886 WP_000941952.1.20908 WP_000941952.1.21049 WP_000941952.1.21146 WP_000941952.1.21245 WP_000941952.1.21246 WP_000941952.1.21269 WP_000941952.1.21400 WP_000941952.1.21497 WP_000941952.1.21499 WP_000941952.1.21548 WP_000941952.1.21603 WP_000941952.1.21751 WP_000941952.1.21757 WP_000941952.1.22024 WP_000941952.1.2205 WP_000941952.1.22062 WP_000941952.1.22067 WP_000941952.1.2221 WP_000941952.1.2235 WP_000941952.1.22379 WP_000941952.1.22427 WP_000941952.1.2246 WP_000941952.1.22485 WP_000941952.1.22537 WP_000941952.1.22620 WP_000941952.1.22870 WP_000941952.1.22979 WP_000941952.1.23102 WP_000941952.1.23114 WP_000941952.1.2314 WP_000941952.1.23155 WP_000941952.1.23192 WP_000941952.1.23259 WP_000941952.1.23460 WP_000941952.1.23472 WP_000941952.1.23482 WP_000941952.1.23634 WP_000941952.1.2364 WP_000941952.1.23643 WP_000941952.1.23685 WP_000941952.1.23932 WP_000941952.1.24017 WP_000941952.1.24206 WP_000941952.1.24259 WP_000941952.1.24308 WP_000941952.1.24578 WP_000941952.1.24737 WP_000941952.1.24779 WP_000941952.1.25008 WP_000941952.1.25015 WP_000941952.1.25206 WP_000941952.1.25405 WP_000941952.1.25454 WP_000941952.1.25493 WP_000941952.1.25668 WP_000941952.1.25690 WP_000941952.1.2570 WP_000941952.1.25740 WP_000941952.1.25793 WP_000941952.1.25814 WP_000941952.1.25988 WP_000941952.1.26030 WP_000941952.1.26282 WP_000941952.1.26311 WP_000941952.1.26319 WP_000941952.1.2634 WP_000941952.1.26429 WP_000941952.1.26440 WP_000941952.1.26493 WP_000941952.1.26551 WP_000941952.1.26567 WP_000941952.1.26582 WP_000941952.1.27010 WP_000941952.1.27173 WP_000941952.1.27206 WP_000941952.1.27423 WP_000941952.1.27556 WP_000941952.1.27561 WP_000941952.1.2763 WP_000941952.1.27665 WP_000941952.1.27707 WP_000941952.1.27761 WP_000941952.1.2777 WP_000941952.1.27857 WP_000941952.1.27977 WP_000941952.1.28094 WP_000941952.1.28126 WP_000941952.1.28170 WP_000941952.1.28302 WP_000941952.1.2835 WP_000941952.1.28370 WP_000941952.1.28538 WP_000941952.1.28575 WP_000941952.1.28625 WP_000941952.1.28655 WP_000941952.1.28694 WP_000941952.1.2879 WP_000941952.1.2890 WP_000941952.1.28938 WP_000941952.1.28946 WP_000941952.1.29006 WP_000941952.1.29010 WP_000941952.1.2910 WP_000941952.1.29588 WP_000941952.1.29601 WP_000941952.1.29606 WP_000941952.1.29615 WP_000941952.1.29619 WP_000941952.1.29704 WP_000941952.1.29775 WP_000941952.1.29969 WP_000941952.1.30006 WP_000941952.1.30027 WP_000941952.1.30180 WP_000941952.1.30238 WP_000941952.1.30469 WP_000941952.1.30505 WP_000941952.1.30507 WP_000941952.1.30535 WP_000941952.1.30547 WP_000941952.1.30794 WP_000941952.1.30833 WP_000941952.1.30835 WP_000941952.1.30972 WP_000941952.1.31 WP_000941952.1.3113 WP_000941952.1.31171 WP_000941952.1.31185 WP_000941952.1.3119 WP_000941952.1.31190 WP_000941952.1.31195 WP_000941952.1.31196 WP_000941952.1.31219 WP_000941952.1.31281 WP_000941952.1.31362 WP_000941952.1.31504 WP_000941952.1.31515 WP_000941952.1.31578 WP_000941952.1.31658 WP_000941952.1.31762 WP_000941952.1.31940 WP_000941952.1.31967 WP_000941952.1.31972 WP_000941952.1.32192 WP_000941952.1.32206 WP_000941952.1.32438 WP_000941952.1.32515 WP_000941952.1.32527 WP_000941952.1.32660 WP_000941952.1.32702 WP_000941952.1.32714 WP_000941952.1.32786 WP_000941952.1.32804 WP_000941952.1.32860 WP_000941952.1.32907 WP_000941952.1.33030 WP_000941952.1.33078 WP_000941952.1.33127 WP_000941952.1.33143 WP_000941952.1.33248 WP_000941952.1.33261 WP_000941952.1.333 WP_000941952.1.33492 WP_000941952.1.33553 WP_000941952.1.33592 WP_000941952.1.33825 WP_000941952.1.33894 WP_000941952.1.34043 WP_000941952.1.34075 WP_000941952.1.34257 WP_000941952.1.34279 WP_000941952.1.34319 WP_000941952.1.3445 WP_000941952.1.34453 WP_000941952.1.34610 WP_000941952.1.34667 WP_000941952.1.34856 WP_000941952.1.34975 WP_000941952.1.34977 WP_000941952.1.35045 WP_000941952.1.35129 WP_000941952.1.35184 WP_000941952.1.35404 WP_000941952.1.35408 WP_000941952.1.35425 WP_000941952.1.35429 WP_000941952.1.35446 WP_000941952.1.35463 WP_000941952.1.35503 WP_000941952.1.35509 WP_000941952.1.35590 WP_000941952.1.35940 WP_000941952.1.36003 WP_000941952.1.3601 WP_000941952.1.36609 WP_000941952.1.36690 WP_000941952.1.3670 WP_000941952.1.36705 WP_000941952.1.36899 WP_000941952.1.36918 WP_000941952.1.36931 WP_000941952.1.37063 WP_000941952.1.37073 WP_000941952.1.37111 WP_000941952.1.37112 WP_000941952.1.37256 WP_000941952.1.37293 WP_000941952.1.37370 WP_000941952.1.37376 WP_000941952.1.3744 WP_000941952.1.37498 WP_000941952.1.37504 WP_000941952.1.3756 WP_000941952.1.37618 WP_000941952.1.37687 WP_000941952.1.37968 WP_000941952.1.37978 WP_000941952.1.38001 WP_000941952.1.38026 WP_000941952.1.38125 WP_000941952.1.38145 WP_000941952.1.383 WP_000941952.1.3848 WP_000941952.1.38613 WP_000941952.1.38673 WP_000941952.1.3869 WP_000941952.1.38693 WP_000941952.1.38773 WP_000941952.1.38882 WP_000941952.1.38913 WP_000941952.1.39003 WP_000941952.1.39082 WP_000941952.1.39136 WP_000941952.1.39197 WP_000941952.1.39229 WP_000941952.1.39385 WP_000941952.1.39405 WP_000941952.1.39420 WP_000941952.1.39449 WP_000941952.1.39512 WP_000941952.1.39553 WP_000941952.1.39556 WP_000941952.1.39629 WP_000941952.1.39763 WP_000941952.1.39862 WP_000941952.1.39921 WP_000941952.1.39923 WP_000941952.1.40017 WP_000941952.1.40072 WP_000941952.1.40073 WP_000941952.1.4011 WP_000941952.1.40208 WP_000941952.1.40224 WP_000941952.1.40240 WP_000941952.1.40257 WP_000941952.1.40292 WP_000941952.1.40305 WP_000941952.1.40311 WP_000941952.1.40380 WP_000941952.1.40395 WP_000941952.1.40465 WP_000941952.1.40508 WP_000941952.1.40710 WP_000941952.1.4075 WP_000941952.1.4087 WP_000941952.1.40877 WP_000941952.1.41017 WP_000941952.1.41086 WP_000941952.1.41091 WP_000941952.1.41226 WP_000941952.1.41279 WP_000941952.1.41516 WP_000941952.1.41554 WP_000941952.1.41572 WP_000941952.1.41591 WP_000941952.1.41662 WP_000941952.1.41708 WP_000941952.1.41761 WP_000941952.1.41859 WP_000941952.1.41882 WP_000941952.1.41979 WP_000941952.1.41985 WP_000941952.1.42104 WP_000941952.1.42320 WP_000941952.1.42342 WP_000941952.1.4239 WP_000941952.1.42422 WP_000941952.1.4276 WP_000941952.1.42864 WP_000941952.1.4288 WP_000941952.1.42957 WP_000941952.1.43018 WP_000941952.1.43041 WP_000941952.1.43244 WP_000941952.1.43312 WP_000941952.1.43334 WP_000941952.1.43351 WP_000941952.1.43437 WP_000941952.1.43522 WP_000941952.1.43528 WP_000941952.1.43613 WP_000941952.1.43668 WP_000941952.1.43886 WP_000941952.1.44005 WP_000941952.1.44043 WP_000941952.1.44099 WP_000941952.1.44121 WP_000941952.1.44291 WP_000941952.1.44310 WP_000941952.1.44386 WP_000941952.1.44479 WP_000941952.1.44640 WP_000941952.1.4467 WP_000941952.1.44747 WP_000941952.1.44781 WP_000941952.1.4485 WP_000941952.1.44877 WP_000941952.1.44927 WP_000941952.1.44971 WP_000941952.1.45067 WP_000941952.1.45074 WP_000941952.1.45079 WP_000941952.1.45098 WP_000941952.1.45177 WP_000941952.1.45184 WP_000941952.1.45259 WP_000941952.1.45344 WP_000941952.1.45349 WP_000941952.1.45365 WP_000941952.1.45544 WP_000941952.1.45550 WP_000941952.1.45585 WP_000941952.1.45660 WP_000941952.1.45690 WP_000941952.1.45797 WP_000941952.1.458 WP_000941952.1.46011 WP_000941952.1.46069 WP_000941952.1.46112 WP_000941952.1.46173 WP_000941952.1.46174 WP_000941952.1.46187 WP_000941952.1.46286 WP_000941952.1.46303 WP_000941952.1.46574 WP_000941952.1.46595 WP_000941952.1.46666 WP_000941952.1.46675 WP_000941952.1.46930 WP_000941952.1.47057 WP_000941952.1.47214 WP_000941952.1.47429 WP_000941952.1.47448 WP_000941952.1.4747 WP_000941952.1.47472 WP_000941952.1.47478 WP_000941952.1.47621 WP_000941952.1.47649 WP_000941952.1.4775 WP_000941952.1.47799 WP_000941952.1.47814 WP_000941952.1.48209 WP_000941952.1.48242 WP_000941952.1.48253 WP_000941952.1.483 WP_000941952.1.48367 WP_000941952.1.48377 WP_000941952.1.48493 WP_000941952.1.4853 WP_000941952.1.48570 WP_000941952.1.48788 WP_000941952.1.4885 WP_000941952.1.48876 WP_000941952.1.48894 WP_000941952.1.48919 WP_000941952.1.48985 WP_000941952.1.49084 WP_000941952.1.49155 WP_000941952.1.49204 WP_000941952.1.49239 WP_000941952.1.49256 WP_000941952.1.49290 WP_000941952.1.49309 WP_000941952.1.49340 WP_000941952.1.49366 WP_000941952.1.49472 WP_000941952.1.49490 WP_000941952.1.49515 WP_000941952.1.49572 WP_000941952.1.4979 WP_000941952.1.49803 WP_000941952.1.49805 WP_000941952.1.49929 WP_000941952.1.50080 WP_000941952.1.50161 WP_000941952.1.50211 WP_000941952.1.50376 WP_000941952.1.50389 WP_000941952.1.50576 WP_000941952.1.50676 WP_000941952.1.50774 WP_000941952.1.50804 WP_000941952.1.50808 WP_000941952.1.5088 WP_000941952.1.50908 WP_000941952.1.50941 WP_000941952.1.51014 WP_000941952.1.51022 WP_000941952.1.51179 WP_000941952.1.51182 WP_000941952.1.51186 WP_000941952.1.51487 WP_000941952.1.51488 WP_000941952.1.51555 WP_000941952.1.51634 WP_000941952.1.51649 WP_000941952.1.51686 WP_000941952.1.51756 WP_000941952.1.51911 WP_000941952.1.51932 WP_000941952.1.51989 WP_000941952.1.52047 WP_000941952.1.52121 WP_000941952.1.52148 WP_000941952.1.52346 WP_000941952.1.52353 WP_000941952.1.52361 WP_000941952.1.52438 WP_000941952.1.52653 WP_000941952.1.52656 WP_000941952.1.52743 WP_000941952.1.52857 WP_000941952.1.52898 WP_000941952.1.52915 WP_000941952.1.53190 WP_000941952.1.53406 WP_000941952.1.53436 WP_000941952.1.53466 WP_000941952.1.53529 WP_000941952.1.53543 WP_000941952.1.53757 WP_000941952.1.53812 WP_000941952.1.53935 WP_000941952.1.54033 WP_000941952.1.54075 WP_000941952.1.54196 WP_000941952.1.542 WP_000941952.1.54209 WP_000941952.1.54271 WP_000941952.1.54273 WP_000941952.1.54274 WP_000941952.1.54319 WP_000941952.1.54364 WP_000941952.1.54400 WP_000941952.1.54644 WP_000941952.1.54662 WP_000941952.1.54722 WP_000941952.1.54749 WP_000941952.1.54764 WP_000941952.1.54827 WP_000941952.1.55008 WP_000941952.1.55152 WP_000941952.1.55156 WP_000941952.1.55285 WP_000941952.1.55475 WP_000941952.1.55647 WP_000941952.1.55743 WP_000941952.1.55768 WP_000941952.1.55782 WP_000941952.1.55796 WP_000941952.1.55993 WP_000941952.1.56002 WP_000941952.1.56012 WP_000941952.1.56105 WP_000941952.1.56238 WP_000941952.1.56286 WP_000941952.1.56304 WP_000941952.1.56414 WP_000941952.1.56438 WP_000941952.1.56560 WP_000941952.1.56597 WP_000941952.1.56601 WP_000941952.1.56614 WP_000941952.1.56671 WP_000941952.1.56682 WP_000941952.1.56853 WP_000941952.1.56875 WP_000941952.1.56877 WP_000941952.1.56893 WP_000941952.1.57168 WP_000941952.1.57187 WP_000941952.1.57232 WP_000941952.1.57307 WP_000941952.1.57377 WP_000941952.1.57418 WP_000941952.1.57433 WP_000941952.1.57515 WP_000941952.1.57529 WP_000941952.1.57576 WP_000941952.1.57601 WP_000941952.1.57607 WP_000941952.1.57763 WP_000941952.1.57862 WP_000941952.1.57890 WP_000941952.1.57891 WP_000941952.1.57978 WP_000941952.1.5801 WP_000941952.1.58040 WP_000941952.1.58041 WP_000941952.1.58418 WP_000941952.1.5854 WP_000941952.1.58548 WP_000941952.1.5858 WP_000941952.1.58662 WP_000941952.1.58669 WP_000941952.1.58745 WP_000941952.1.58803 WP_000941952.1.5886 WP_000941952.1.59094 WP_000941952.1.59224 WP_000941952.1.59321 WP_000941952.1.59336 WP_000941952.1.59375 WP_000941952.1.59381 WP_000941952.1.59458 WP_000941952.1.59490 WP_000941952.1.59508 WP_000941952.1.5953 WP_000941952.1.59641 WP_000941952.1.59684 WP_000941952.1.59694 WP_000941952.1.59771 WP_000941952.1.5979 WP_000941952.1.59830 WP_000941952.1.59953 WP_000941952.1.60008 WP_000941952.1.60021 WP_000941952.1.60069 WP_000941952.1.60140 WP_000941952.1.60155 WP_000941952.1.60285 WP_000941952.1.60379 WP_000941952.1.60464 WP_000941952.1.60874 WP_000941952.1.60919 WP_000941952.1.60941 WP_000941952.1.61078 WP_000941952.1.6114 WP_000941952.1.61201 WP_000941952.1.61232 WP_000941952.1.6129 WP_000941952.1.61296 WP_000941952.1.61345 WP_000941952.1.61417 WP_000941952.1.61574 WP_000941952.1.61609 WP_000941952.1.6164 WP_000941952.1.61712 WP_000941952.1.61714 WP_000941952.1.61730 WP_000941952.1.61857 WP_000941952.1.61918 WP_000941952.1.61952 WP_000941952.1.62007 WP_000941952.1.62025 WP_000941952.1.62076 WP_000941952.1.62204 WP_000941952.1.62304 WP_000941952.1.62364 WP_000941952.1.62374 WP_000941952.1.62403 WP_000941952.1.6253 WP_000941952.1.62570 WP_000941952.1.62853 WP_000941952.1.62903 WP_000941952.1.62910 WP_000941952.1.62955 WP_000941952.1.63063 WP_000941952.1.63181 WP_000941952.1.63203 WP_000941952.1.63256 WP_000941952.1.63290 WP_000941952.1.63382 WP_000941952.1.63432 WP_000941952.1.63461 WP_000941952.1.63479 WP_000941952.1.63577 WP_000941952.1.63664 WP_000941952.1.63718 WP_000941952.1.6375 WP_000941952.1.63757 WP_000941952.1.63834 WP_000941952.1.63934 WP_000941952.1.64007 WP_000941952.1.64046 WP_000941952.1.6423 WP_000941952.1.64244 WP_000941952.1.64403 WP_000941952.1.64569 WP_000941952.1.64649 WP_000941952.1.64702 WP_000941952.1.64757 WP_000941952.1.64781 WP_000941952.1.64831 WP_000941952.1.6489 WP_000941952.1.64920 WP_000941952.1.65018 WP_000941952.1.65028 WP_000941952.1.65171 WP_000941952.1.65248 WP_000941952.1.6535 WP_000941952.1.65474 WP_000941952.1.65572 WP_000941952.1.65633 WP_000941952.1.6565 WP_000941952.1.65696 WP_000941952.1.6575 WP_000941952.1.65782 WP_000941952.1.6630 WP_000941952.1.66314 WP_000941952.1.66358 WP_000941952.1.66362 WP_000941952.1.6638 WP_000941952.1.6640 WP_000941952.1.66600 WP_000941952.1.66698 WP_000941952.1.6680 WP_000941952.1.66834 WP_000941952.1.66901 WP_000941952.1.66962 WP_000941952.1.67037 WP_000941952.1.67045 WP_000941952.1.67181 WP_000941952.1.67268 WP_000941952.1.67288 WP_000941952.1.67347 WP_000941952.1.67465 WP_000941952.1.67552 WP_000941952.1.67682 WP_000941952.1.67829 WP_000941952.1.67887 WP_000941952.1.68073 WP_000941952.1.68201 WP_000941952.1.68206 WP_000941952.1.6827 WP_000941952.1.68275 WP_000941952.1.6849 WP_000941952.1.68532 WP_000941952.1.68547 WP_000941952.1.68589 WP_000941952.1.68655 WP_000941952.1.68656 WP_000941952.1.6869 WP_000941952.1.68778 WP_000941952.1.68787 WP_000941952.1.68894 WP_000941952.1.68928 WP_000941952.1.68975 WP_000941952.1.69006 WP_000941952.1.6913 WP_000941952.1.69146 WP_000941952.1.69255 WP_000941952.1.69397 WP_000941952.1.69564 WP_000941952.1.69636 WP_000941952.1.69644 WP_000941952.1.69704 WP_000941952.1.7021 WP_000941952.1.70241 WP_000941952.1.70269 WP_000941952.1.70289 WP_000941952.1.70321 WP_000941952.1.70447 WP_000941952.1.70485 WP_000941952.1.70488 WP_000941952.1.70580 WP_000941952.1.70643 WP_000941952.1.70683 WP_000941952.1.70883 WP_000941952.1.70914 WP_000941952.1.70922 WP_000941952.1.70948 WP_000941952.1.71116 WP_000941952.1.71146 WP_000941952.1.71165 WP_000941952.1.71188 WP_000941952.1.71202 WP_000941952.1.71243 WP_000941952.1.71248 WP_000941952.1.71306 WP_000941952.1.71337 WP_000941952.1.71378 WP_000941952.1.71401 WP_000941952.1.71446 WP_000941952.1.71481 WP_000941952.1.71691 WP_000941952.1.71702 WP_000941952.1.7174 WP_000941952.1.71750 WP_000941952.1.71756 WP_000941952.1.71845 WP_000941952.1.71881 WP_000941952.1.71908 WP_000941952.1.71952 WP_000941952.1.71973 WP_000941952.1.72065 WP_000941952.1.72105 WP_000941952.1.72203 WP_000941952.1.72226 WP_000941952.1.72372 WP_000941952.1.72376 WP_000941952.1.72594 WP_000941952.1.72871 WP_000941952.1.72975 WP_000941952.1.73062 WP_000941952.1.7315 WP_000941952.1.73200 WP_000941952.1.7334 WP_000941952.1.73377 WP_000941952.1.73481 WP_000941952.1.7356 WP_000941952.1.73561 WP_000941952.1.73581 WP_000941952.1.73617 WP_000941952.1.73667 WP_000941952.1.73753 WP_000941952.1.73758 WP_000941952.1.73794 WP_000941952.1.73831 WP_000941952.1.7387 WP_000941952.1.73924 WP_000941952.1.73926 WP_000941952.1.73945 WP_000941952.1.74029 WP_000941952.1.74181 WP_000941952.1.74191 WP_000941952.1.7433 WP_000941952.1.74379 WP_000941952.1.74410 WP_000941952.1.74466 WP_000941952.1.74529 WP_000941952.1.74545 WP_000941952.1.74745 WP_000941952.1.75129 WP_000941952.1.75187 WP_000941952.1.75288 WP_000941952.1.75334 WP_000941952.1.75362 WP_000941952.1.75385 WP_000941952.1.75392 WP_000941952.1.75402 WP_000941952.1.75760 WP_000941952.1.75764 WP_000941952.1.75828 WP_000941952.1.75837 WP_000941952.1.75874 WP_000941952.1.75945 WP_000941952.1.76020 WP_000941952.1.76097 WP_000941952.1.76252 WP_000941952.1.76364 WP_000941952.1.76445 WP_000941952.1.7660 WP_000941952.1.76673 WP_000941952.1.76706 WP_000941952.1.76721 WP_000941952.1.76756 WP_000941952.1.76760 WP_000941952.1.76806 WP_000941952.1.76875 WP_000941952.1.76880 WP_000941952.1.76899 WP_000941952.1.77038 WP_000941952.1.77047 WP_000941952.1.77080 WP_000941952.1.7712 WP_000941952.1.77180 WP_000941952.1.77244 WP_000941952.1.77292 WP_000941952.1.77349 WP_000941952.1.77414 WP_000941952.1.77514 WP_000941952.1.77529 WP_000941952.1.77549 WP_000941952.1.77692 WP_000941952.1.7782 WP_000941952.1.77851 WP_000941952.1.77898 WP_000941952.1.77918 WP_000941952.1.77960 WP_000941952.1.78033 WP_000941952.1.78076 WP_000941952.1.78096 WP_000941952.1.78100 WP_000941952.1.78110 WP_000941952.1.78120 WP_000941952.1.78201 WP_000941952.1.78383 WP_000941952.1.78407 WP_000941952.1.7861 WP_000941952.1.78618 WP_000941952.1.78673 WP_000941952.1.78735 WP_000941952.1.78802 WP_000941952.1.78830 WP_000941952.1.78835 WP_000941952.1.78871 WP_000941952.1.78874 WP_000941952.1.78918 WP_000941952.1.78930 WP_000941952.1.79151 WP_000941952.1.79167 WP_000941952.1.79335 WP_000941952.1.79462 WP_000941952.1.79472 WP_000941952.1.79490 WP_000941952.1.79495 WP_000941952.1.79529 WP_000941952.1.79570 WP_000941952.1.7964 WP_000941952.1.79659 WP_000941952.1.79668 WP_000941952.1.79708 WP_000941952.1.79845 WP_000941952.1.80077 WP_000941952.1.80137 WP_000941952.1.80182 WP_000941952.1.80296 WP_000941952.1.80366 WP_000941952.1.80529 WP_000941952.1.80780 WP_000941952.1.80831 WP_000941952.1.80850 WP_000941952.1.80881 WP_000941952.1.80939 WP_000941952.1.8096 WP_000941952.1.81037 WP_000941952.1.81069 WP_000941952.1.81149 WP_000941952.1.81175 WP_000941952.1.8119 WP_000941952.1.81193 WP_000941952.1.81354 WP_000941952.1.81410 WP_000941952.1.81425 WP_000941952.1.81750 WP_000941952.1.81785 WP_000941952.1.81902 WP_000941952.1.81974 WP_000941952.1.82337 WP_000941952.1.82395 WP_000941952.1.82479 WP_000941952.1.82503 WP_000941952.1.82515 WP_000941952.1.82529 WP_000941952.1.82676 WP_000941952.1.82761 WP_000941952.1.8282 WP_000941952.1.82841 WP_000941952.1.82944 WP_000941952.1.82956 WP_000941952.1.82992 WP_000941952.1.83092 WP_000941952.1.83163 WP_000941952.1.83305 WP_000941952.1.83365 WP_000941952.1.83413 WP_000941952.1.83491 WP_000941952.1.83523 WP_000941952.1.8354 WP_000941952.1.83650 WP_000941952.1.83651 WP_000941952.1.83721 WP_000941952.1.83760 WP_000941952.1.83854 WP_000941952.1.83995 WP_000941952.1.84103 WP_000941952.1.84283 WP_000941952.1.84355 WP_000941952.1.84392 WP_000941952.1.8441 WP_000941952.1.84532 WP_000941952.1.84554 WP_000941952.1.84659 WP_000941952.1.84693 WP_000941952.1.84899 WP_000941952.1.8497 WP_000941952.1.85040 WP_000941952.1.85134 WP_000941952.1.85178 WP_000941952.1.85180 WP_000941952.1.85190 WP_000941952.1.8533 WP_000941952.1.8545 WP_000941952.1.85481 WP_000941952.1.85483 WP_000941952.1.85541 WP_000941952.1.8556 WP_000941952.1.85615 WP_000941952.1.85617 WP_000941952.1.85663 WP_000941952.1.85671 WP_000941952.1.85672 WP_000941952.1.85777 WP_000941952.1.85855 WP_000941952.1.85886 WP_000941952.1.85900 WP_000941952.1.85904 WP_000941952.1.85976 WP_000941952.1.86306 WP_000941952.1.86356 WP_000941952.1.86450 WP_000941952.1.86453 WP_000941952.1.86469 WP_000941952.1.86580 WP_000941952.1.86588 WP_000941952.1.86661 WP_000941952.1.8672 WP_000941952.1.8678 WP_000941952.1.86810 WP_000941952.1.8684 WP_000941952.1.86895 WP_000941952.1.86906 WP_000941952.1.87095 WP_000941952.1.87323 WP_000941952.1.8736 WP_000941952.1.87460 WP_000941952.1.87552 WP_000941952.1.87779 WP_000941952.1.87875 WP_000941952.1.87945 WP_000941952.1.88019 WP_000941952.1.88073 WP_000941952.1.8809 WP_000941952.1.88291 WP_000941952.1.88293 WP_000941952.1.8837 WP_000941952.1.88393 WP_000941952.1.88703 WP_000941952.1.88762 WP_000941952.1.88792 WP_000941952.1.88902 WP_000941952.1.8891 WP_000941952.1.88981 WP_000941952.1.89008 WP_000941952.1.89116 WP_000941952.1.89138 WP_000941952.1.89304 WP_000941952.1.89512 WP_000941952.1.89527 WP_000941952.1.89570 WP_000941952.1.89604 WP_000941952.1.89622 WP_000941952.1.89659 WP_000941952.1.89902 WP_000941952.1.8996 WP_000941952.1.9002 WP_000941952.1.90097 WP_000941952.1.90252 WP_000941952.1.90417 WP_000941952.1.90453 WP_000941952.1.90458 WP_000941952.1.90472 WP_000941952.1.90557 WP_000941952.1.90585 WP_000941952.1.90641 WP_000941952.1.90734 WP_000941952.1.91003 WP_000941952.1.91069 WP_000941952.1.91278 WP_000941952.1.9131 WP_000941952.1.91470 WP_000941952.1.91512 WP_000941952.1.91524 WP_000941952.1.91564 WP_000941952.1.91628 WP_000941952.1.91655 WP_000941952.1.91724 WP_000941952.1.91732 WP_000941952.1.91788 WP_000941952.1.92013 WP_000941952.1.92060 WP_000941952.1.92093 WP_000941952.1.92108 WP_000941952.1.92171 WP_000941952.1.92183 WP_000941952.1.92208 WP_000941952.1.92268 WP_000941952.1.92310 WP_000941952.1.92318 WP_000941952.1.92443 WP_000941952.1.92482 WP_000941952.1.92531 WP_000941952.1.92669 WP_000941952.1.92671 WP_000941952.1.92729 WP_000941952.1.92738 WP_000941952.1.92975 WP_000941952.1.93086 WP_000941952.1.93101 WP_000941952.1.93136 WP_000941952.1.93155 WP_000941952.1.93275 WP_000941952.1.93365 WP_000941952.1.93376 WP_000941952.1.93543 WP_000941952.1.93650 WP_000941952.1.93656 WP_000941952.1.93662 WP_000941952.1.937 WP_000941952.1.93705 WP_000941952.1.93804 WP_000941952.1.9389 WP_000941952.1.93994 WP_000941952.1.94072 WP_000941952.1.94162 WP_000941952.1.94168 WP_000941952.1.94198 WP_000941952.1.9432 WP_000941952.1.94352 WP_000941952.1.94354 WP_000941952.1.94380 WP_000941952.1.94458 WP_000941952.1.94565 WP_000941952.1.94584 WP_000941952.1.94674 WP_000941952.1.94796 WP_000941952.1.94959 WP_000941952.1.95051 WP_000941952.1.95085 WP_000941952.1.95121 WP_000941952.1.95282 WP_000941952.1.95546 WP_000941952.1.95630 WP_000941952.1.95911 WP_000941952.1.96139 WP_000941952.1.96317 WP_000941952.1.96335 WP_000941952.1.96343 WP_000941952.1.9644 WP_000941952.1.96469 WP_000941952.1.96497 WP_000941952.1.96500 WP_000941952.1.96555 WP_000941952.1.96563 WP_000941952.1.96732 WP_000941952.1.96771 WP_000941952.1.97015 WP_000941952.1.97145 WP_000941952.1.97190 WP_000941952.1.97318 WP_000941952.1.97369 WP_000941952.1.97594 WP_000941952.1.97597 WP_000941952.1.97613 WP_000941952.1.97620 WP_000941952.1.97727 WP_000941952.1.97732 WP_000941952.1.97736 WP_000941952.1.9775 WP_000941952.1.97846 WP_000941952.1.98006 WP_000941952.1.98019 WP_000941952.1.98022 WP_000941952.1.98110 WP_000941952.1.98146 WP_000941952.1.98219 WP_000941952.1.98236 WP_000941952.1.98314 WP_000941952.1.9841 WP_000941952.1.98495 WP_000941952.1.98531 WP_000941952.1.98577 WP_000941952.1.98676 WP_000941952.1.98677 WP_000941952.1.98760 WP_000941952.1.98843 WP_000941952.1.98899 WP_000941952.1.9898 WP_000941952.1.99072 WP_000941952.1.99098 WP_000941952.1.99184 WP_000941952.1.99267 WP_000941952.1.99276 WP_000941952.1.99646 WP_000941952.1.99657 WP_000941952.1.99660 WP_000941952.1.99712 WP_000941952.1.99813 WP_000941952.1.99858 WP_000941952.1.99889 WP_000941952.1.99958 gi|525839150|ref|YP_008256369.1| gi|16763771|ref|NP_459386.1| gi|525948217|ref|YP_008309763.1| gi|378987792|ref|YP_005250956.1| gi|161615428|ref|YP_001589393.1| gi|378443895|ref|YP_005231527.1| APC22952 gi|378698355|ref|YP_005180312.1| gi|549723105|ref|YP_008643295.1| gi|378448719|ref|YP_005236078.1| gi|383495200|ref|YP_005395889.1| gi|378982994|ref|YP_005246149.1| gi|550899845|ref|YP_008668937.1| gi|526219294|ref|YP_008264642.1| ABAM02000001|CDS_941552-941836 ABAO01000012|CDS_60241-60525 ABFH02000002|CDS_1691753-1691469 AE006468|CDS_442607-442891 CP000886|CDS_2675788-2675504 CP001363|CDS_443300-443584 FN424405|CDS_483111-483395 gi|482905024|ref|YP_007903584.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]