SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378448859|ref|YP_005236218.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378448859|ref|YP_005236218.1|
Domain Number 1 Region: 2-156
Classification Level Classification E-value
Superfamily RmlC-like cupins 1.82e-52
Family Ureidoglycolate hydrolase AllA 0.000000132
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|378448859|ref|YP_005236218.1|
Sequence length 160
Comment ureidoglycolate hydrolase [Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S]
Sequence
MKLEVLPLDQKTFSAYGDVIETQEREFFHINNGLVERYHDLAKVEVLEQDRTLISINRAQ
PAAMPIVVHELERHPLGTQAFVPMNGEAFVVIVALGDDKPDLSTLRAFISNGRQGVNYHR
NVWHHPLFAWQTVTDFLTVDRGGSDNCDVESIPTHELCFA
Download sequence
Identical sequences A0A0D6H871 A0A0F6AY00 A0A0F7DI05 A0A0H3NDU1 A0A0U1F316 A0A0W4B994 A0A2D3ANF7 A0A2H9YMU2 E8X8A2 Q8ZR87
ABAO01000003|CDS_75029-75511 AE006468|CDS_576003-576485 CP001363|CDS_576697-577179 FN424405|CDS_616508-616990 gi|525839042|ref|YP_008256242.1| 99287.STM0515 gi|378448859|ref|YP_005236218.1| gi|16763895|ref|NP_459510.1| gi|482904897|ref|YP_007903457.1| gi|550899965|ref|YP_008669057.1| gi|378987917|ref|YP_005251081.1| APC22977 StR9 gi|526219402|ref|YP_008264768.1| gi|383495322|ref|YP_005396011.1| gi|378444018|ref|YP_005231650.1| gi|378983121|ref|YP_005246276.1| gi|549723227|ref|YP_008643417.1| NP_459510.1.58477 WP_000764664.1.100010 WP_000764664.1.100234 WP_000764664.1.100266 WP_000764664.1.100376 WP_000764664.1.100424 WP_000764664.1.100436 WP_000764664.1.100484 WP_000764664.1.100488 WP_000764664.1.100597 WP_000764664.1.10076 WP_000764664.1.100781 WP_000764664.1.100793 WP_000764664.1.100869 WP_000764664.1.100871 WP_000764664.1.100882 WP_000764664.1.101007 WP_000764664.1.101020 WP_000764664.1.101074 WP_000764664.1.101078 WP_000764664.1.101180 WP_000764664.1.101259 WP_000764664.1.101284 WP_000764664.1.101291 WP_000764664.1.101353 WP_000764664.1.101386 WP_000764664.1.101404 WP_000764664.1.101420 WP_000764664.1.101589 WP_000764664.1.101707 WP_000764664.1.101734 WP_000764664.1.101878 WP_000764664.1.101953 WP_000764664.1.10220 WP_000764664.1.10266 WP_000764664.1.10429 WP_000764664.1.10439 WP_000764664.1.10678 WP_000764664.1.10753 WP_000764664.1.10992 WP_000764664.1.11024 WP_000764664.1.11031 WP_000764664.1.11098 WP_000764664.1.11168 WP_000764664.1.11190 WP_000764664.1.11295 WP_000764664.1.11455 WP_000764664.1.11458 WP_000764664.1.11518 WP_000764664.1.11532 WP_000764664.1.11543 WP_000764664.1.11763 WP_000764664.1.11772 WP_000764664.1.11897 WP_000764664.1.12114 WP_000764664.1.12351 WP_000764664.1.12370 WP_000764664.1.12546 WP_000764664.1.1264 WP_000764664.1.12728 WP_000764664.1.12879 WP_000764664.1.12936 WP_000764664.1.12995 WP_000764664.1.13027 WP_000764664.1.13106 WP_000764664.1.13130 WP_000764664.1.13414 WP_000764664.1.13488 WP_000764664.1.13509 WP_000764664.1.13669 WP_000764664.1.13741 WP_000764664.1.1387 WP_000764664.1.13908 WP_000764664.1.13932 WP_000764664.1.13968 WP_000764664.1.14001 WP_000764664.1.14151 WP_000764664.1.14239 WP_000764664.1.14320 WP_000764664.1.14379 WP_000764664.1.14406 WP_000764664.1.14410 WP_000764664.1.14466 WP_000764664.1.14524 WP_000764664.1.14554 WP_000764664.1.14725 WP_000764664.1.14852 WP_000764664.1.1489 WP_000764664.1.14932 WP_000764664.1.15055 WP_000764664.1.15124 WP_000764664.1.15223 WP_000764664.1.15226 WP_000764664.1.15316 WP_000764664.1.15369 WP_000764664.1.1540 WP_000764664.1.15508 WP_000764664.1.15784 WP_000764664.1.15830 WP_000764664.1.16062 WP_000764664.1.16063 WP_000764664.1.16103 WP_000764664.1.16226 WP_000764664.1.16233 WP_000764664.1.16284 WP_000764664.1.16328 WP_000764664.1.1635 WP_000764664.1.16468 WP_000764664.1.16614 WP_000764664.1.16650 WP_000764664.1.16686 WP_000764664.1.16691 WP_000764664.1.16732 WP_000764664.1.16735 WP_000764664.1.16786 WP_000764664.1.16858 WP_000764664.1.16896 WP_000764664.1.16916 WP_000764664.1.16965 WP_000764664.1.1700 WP_000764664.1.17307 WP_000764664.1.174 WP_000764664.1.17480 WP_000764664.1.17546 WP_000764664.1.17702 WP_000764664.1.17705 WP_000764664.1.18019 WP_000764664.1.18089 WP_000764664.1.18163 WP_000764664.1.18265 WP_000764664.1.18267 WP_000764664.1.18468 WP_000764664.1.18607 WP_000764664.1.18705 WP_000764664.1.18715 WP_000764664.1.18776 WP_000764664.1.18822 WP_000764664.1.18881 WP_000764664.1.18940 WP_000764664.1.18949 WP_000764664.1.19053 WP_000764664.1.19320 WP_000764664.1.19458 WP_000764664.1.19460 WP_000764664.1.19461 WP_000764664.1.19614 WP_000764664.1.19702 WP_000764664.1.19706 WP_000764664.1.19724 WP_000764664.1.19749 WP_000764664.1.19784 WP_000764664.1.19802 WP_000764664.1.19809 WP_000764664.1.19867 WP_000764664.1.1998 WP_000764664.1.20 WP_000764664.1.2010 WP_000764664.1.20212 WP_000764664.1.20266 WP_000764664.1.20271 WP_000764664.1.20362 WP_000764664.1.20418 WP_000764664.1.20443 WP_000764664.1.20525 WP_000764664.1.2054 WP_000764664.1.20553 WP_000764664.1.20626 WP_000764664.1.20646 WP_000764664.1.20886 WP_000764664.1.20908 WP_000764664.1.21049 WP_000764664.1.21146 WP_000764664.1.21245 WP_000764664.1.21246 WP_000764664.1.21269 WP_000764664.1.21400 WP_000764664.1.21497 WP_000764664.1.21499 WP_000764664.1.21603 WP_000764664.1.21751 WP_000764664.1.21757 WP_000764664.1.22024 WP_000764664.1.2205 WP_000764664.1.22062 WP_000764664.1.22067 WP_000764664.1.2221 WP_000764664.1.2235 WP_000764664.1.22379 WP_000764664.1.22427 WP_000764664.1.2246 WP_000764664.1.22485 WP_000764664.1.22620 WP_000764664.1.22870 WP_000764664.1.22979 WP_000764664.1.23102 WP_000764664.1.23114 WP_000764664.1.2314 WP_000764664.1.23148 WP_000764664.1.23192 WP_000764664.1.23259 WP_000764664.1.23460 WP_000764664.1.23472 WP_000764664.1.23482 WP_000764664.1.23634 WP_000764664.1.2364 WP_000764664.1.23932 WP_000764664.1.24017 WP_000764664.1.24206 WP_000764664.1.24308 WP_000764664.1.24578 WP_000764664.1.24737 WP_000764664.1.24779 WP_000764664.1.25008 WP_000764664.1.25015 WP_000764664.1.25405 WP_000764664.1.25454 WP_000764664.1.25493 WP_000764664.1.25668 WP_000764664.1.25690 WP_000764664.1.2570 WP_000764664.1.25740 WP_000764664.1.25793 WP_000764664.1.25814 WP_000764664.1.25988 WP_000764664.1.26282 WP_000764664.1.26311 WP_000764664.1.26319 WP_000764664.1.26429 WP_000764664.1.26440 WP_000764664.1.26493 WP_000764664.1.26551 WP_000764664.1.26567 WP_000764664.1.27010 WP_000764664.1.27173 WP_000764664.1.27206 WP_000764664.1.27423 WP_000764664.1.27561 WP_000764664.1.2763 WP_000764664.1.27665 WP_000764664.1.27707 WP_000764664.1.27761 WP_000764664.1.2777 WP_000764664.1.27857 WP_000764664.1.27977 WP_000764664.1.28094 WP_000764664.1.28170 WP_000764664.1.28302 WP_000764664.1.2835 WP_000764664.1.28370 WP_000764664.1.28538 WP_000764664.1.28575 WP_000764664.1.28625 WP_000764664.1.28655 WP_000764664.1.28694 WP_000764664.1.2879 WP_000764664.1.2890 WP_000764664.1.28938 WP_000764664.1.28946 WP_000764664.1.29006 WP_000764664.1.29010 WP_000764664.1.2910 WP_000764664.1.29588 WP_000764664.1.29601 WP_000764664.1.29606 WP_000764664.1.29615 WP_000764664.1.29619 WP_000764664.1.29704 WP_000764664.1.29969 WP_000764664.1.30006 WP_000764664.1.30027 WP_000764664.1.30180 WP_000764664.1.30469 WP_000764664.1.30505 WP_000764664.1.30507 WP_000764664.1.30535 WP_000764664.1.30547 WP_000764664.1.30794 WP_000764664.1.30833 WP_000764664.1.30835 WP_000764664.1.30972 WP_000764664.1.31 WP_000764664.1.3113 WP_000764664.1.31185 WP_000764664.1.3119 WP_000764664.1.31190 WP_000764664.1.31195 WP_000764664.1.31196 WP_000764664.1.31281 WP_000764664.1.31362 WP_000764664.1.31504 WP_000764664.1.31515 WP_000764664.1.31578 WP_000764664.1.31658 WP_000764664.1.31940 WP_000764664.1.31967 WP_000764664.1.31972 WP_000764664.1.32192 WP_000764664.1.32206 WP_000764664.1.32438 WP_000764664.1.32515 WP_000764664.1.32660 WP_000764664.1.32702 WP_000764664.1.32714 WP_000764664.1.32786 WP_000764664.1.32804 WP_000764664.1.32907 WP_000764664.1.32961 WP_000764664.1.33030 WP_000764664.1.33127 WP_000764664.1.33143 WP_000764664.1.33248 WP_000764664.1.33261 WP_000764664.1.333 WP_000764664.1.33492 WP_000764664.1.33553 WP_000764664.1.33592 WP_000764664.1.33894 WP_000764664.1.34043 WP_000764664.1.34075 WP_000764664.1.34257 WP_000764664.1.34279 WP_000764664.1.34319 WP_000764664.1.34453 WP_000764664.1.34610 WP_000764664.1.34856 WP_000764664.1.34975 WP_000764664.1.35045 WP_000764664.1.35129 WP_000764664.1.35184 WP_000764664.1.35404 WP_000764664.1.35408 WP_000764664.1.35425 WP_000764664.1.35446 WP_000764664.1.35463 WP_000764664.1.35503 WP_000764664.1.35509 WP_000764664.1.35590 WP_000764664.1.35777 WP_000764664.1.35940 WP_000764664.1.36003 WP_000764664.1.3601 WP_000764664.1.36542 WP_000764664.1.36609 WP_000764664.1.36690 WP_000764664.1.3670 WP_000764664.1.36705 WP_000764664.1.36918 WP_000764664.1.36931 WP_000764664.1.37073 WP_000764664.1.37111 WP_000764664.1.37112 WP_000764664.1.37256 WP_000764664.1.37293 WP_000764664.1.37320 WP_000764664.1.37370 WP_000764664.1.37376 WP_000764664.1.3744 WP_000764664.1.37498 WP_000764664.1.37504 WP_000764664.1.37618 WP_000764664.1.37968 WP_000764664.1.37978 WP_000764664.1.38125 WP_000764664.1.38145 WP_000764664.1.383 WP_000764664.1.3848 WP_000764664.1.38613 WP_000764664.1.38673 WP_000764664.1.38693 WP_000764664.1.38740 WP_000764664.1.38773 WP_000764664.1.38882 WP_000764664.1.38913 WP_000764664.1.39003 WP_000764664.1.39082 WP_000764664.1.39136 WP_000764664.1.39197 WP_000764664.1.39229 WP_000764664.1.39405 WP_000764664.1.39420 WP_000764664.1.39449 WP_000764664.1.39512 WP_000764664.1.39629 WP_000764664.1.39763 WP_000764664.1.39862 WP_000764664.1.39921 WP_000764664.1.39923 WP_000764664.1.40017 WP_000764664.1.40072 WP_000764664.1.40073 WP_000764664.1.4011 WP_000764664.1.40208 WP_000764664.1.40240 WP_000764664.1.40257 WP_000764664.1.40292 WP_000764664.1.40305 WP_000764664.1.40311 WP_000764664.1.40380 WP_000764664.1.40395 WP_000764664.1.40465 WP_000764664.1.40710 WP_000764664.1.4075 WP_000764664.1.4087 WP_000764664.1.40877 WP_000764664.1.41017 WP_000764664.1.41086 WP_000764664.1.41091 WP_000764664.1.41226 WP_000764664.1.41279 WP_000764664.1.41516 WP_000764664.1.41554 WP_000764664.1.41572 WP_000764664.1.41591 WP_000764664.1.41662 WP_000764664.1.41708 WP_000764664.1.41761 WP_000764664.1.41882 WP_000764664.1.41979 WP_000764664.1.41985 WP_000764664.1.42104 WP_000764664.1.42238 WP_000764664.1.42320 WP_000764664.1.42342 WP_000764664.1.42422 WP_000764664.1.4276 WP_000764664.1.42864 WP_000764664.1.4288 WP_000764664.1.43018 WP_000764664.1.43041 WP_000764664.1.43244 WP_000764664.1.43312 WP_000764664.1.43334 WP_000764664.1.43437 WP_000764664.1.43522 WP_000764664.1.43613 WP_000764664.1.43668 WP_000764664.1.43886 WP_000764664.1.44043 WP_000764664.1.44099 WP_000764664.1.44121 WP_000764664.1.44291 WP_000764664.1.44310 WP_000764664.1.44386 WP_000764664.1.44479 WP_000764664.1.44593 WP_000764664.1.44640 WP_000764664.1.4467 WP_000764664.1.44702 WP_000764664.1.44747 WP_000764664.1.4485 WP_000764664.1.44877 WP_000764664.1.44927 WP_000764664.1.45027 WP_000764664.1.45067 WP_000764664.1.45074 WP_000764664.1.45079 WP_000764664.1.45098 WP_000764664.1.45177 WP_000764664.1.45184 WP_000764664.1.45259 WP_000764664.1.45349 WP_000764664.1.45365 WP_000764664.1.45550 WP_000764664.1.45585 WP_000764664.1.45660 WP_000764664.1.45690 WP_000764664.1.458 WP_000764664.1.46011 WP_000764664.1.46069 WP_000764664.1.46112 WP_000764664.1.46173 WP_000764664.1.46174 WP_000764664.1.46187 WP_000764664.1.46303 WP_000764664.1.46595 WP_000764664.1.46675 WP_000764664.1.47057 WP_000764664.1.47214 WP_000764664.1.47429 WP_000764664.1.47448 WP_000764664.1.4747 WP_000764664.1.47472 WP_000764664.1.47478 WP_000764664.1.47621 WP_000764664.1.47799 WP_000764664.1.48242 WP_000764664.1.48253 WP_000764664.1.483 WP_000764664.1.48367 WP_000764664.1.48377 WP_000764664.1.4853 WP_000764664.1.48788 WP_000764664.1.4885 WP_000764664.1.48894 WP_000764664.1.48919 WP_000764664.1.49084 WP_000764664.1.49155 WP_000764664.1.49204 WP_000764664.1.49239 WP_000764664.1.49256 WP_000764664.1.49290 WP_000764664.1.49340 WP_000764664.1.49366 WP_000764664.1.49490 WP_000764664.1.49515 WP_000764664.1.49572 WP_000764664.1.4979 WP_000764664.1.49803 WP_000764664.1.49805 WP_000764664.1.49929 WP_000764664.1.50080 WP_000764664.1.50161 WP_000764664.1.50211 WP_000764664.1.50376 WP_000764664.1.50389 WP_000764664.1.50676 WP_000764664.1.50800 WP_000764664.1.50804 WP_000764664.1.50808 WP_000764664.1.5088 WP_000764664.1.50908 WP_000764664.1.50941 WP_000764664.1.51014 WP_000764664.1.51022 WP_000764664.1.51179 WP_000764664.1.51182 WP_000764664.1.51186 WP_000764664.1.51487 WP_000764664.1.51488 WP_000764664.1.51634 WP_000764664.1.51649 WP_000764664.1.51686 WP_000764664.1.51756 WP_000764664.1.51911 WP_000764664.1.51932 WP_000764664.1.51989 WP_000764664.1.52121 WP_000764664.1.52346 WP_000764664.1.52353 WP_000764664.1.52361 WP_000764664.1.52653 WP_000764664.1.52656 WP_000764664.1.52743 WP_000764664.1.52857 WP_000764664.1.52898 WP_000764664.1.52915 WP_000764664.1.53190 WP_000764664.1.53406 WP_000764664.1.53466 WP_000764664.1.53529 WP_000764664.1.53543 WP_000764664.1.53675 WP_000764664.1.53757 WP_000764664.1.53812 WP_000764664.1.54033 WP_000764664.1.54075 WP_000764664.1.54196 WP_000764664.1.54209 WP_000764664.1.54271 WP_000764664.1.54274 WP_000764664.1.54319 WP_000764664.1.54364 WP_000764664.1.54400 WP_000764664.1.54644 WP_000764664.1.54662 WP_000764664.1.54722 WP_000764664.1.54749 WP_000764664.1.54764 WP_000764664.1.55008 WP_000764664.1.55152 WP_000764664.1.55156 WP_000764664.1.55285 WP_000764664.1.55475 WP_000764664.1.55647 WP_000764664.1.55743 WP_000764664.1.55768 WP_000764664.1.55782 WP_000764664.1.55796 WP_000764664.1.56002 WP_000764664.1.56012 WP_000764664.1.56059 WP_000764664.1.56105 WP_000764664.1.56238 WP_000764664.1.56286 WP_000764664.1.56304 WP_000764664.1.56414 WP_000764664.1.56438 WP_000764664.1.56512 WP_000764664.1.56560 WP_000764664.1.56601 WP_000764664.1.56614 WP_000764664.1.56671 WP_000764664.1.56682 WP_000764664.1.56875 WP_000764664.1.56877 WP_000764664.1.57168 WP_000764664.1.57187 WP_000764664.1.57377 WP_000764664.1.57418 WP_000764664.1.57433 WP_000764664.1.57515 WP_000764664.1.57529 WP_000764664.1.57576 WP_000764664.1.57601 WP_000764664.1.57607 WP_000764664.1.57763 WP_000764664.1.57862 WP_000764664.1.57890 WP_000764664.1.57891 WP_000764664.1.57978 WP_000764664.1.5801 WP_000764664.1.58041 WP_000764664.1.58418 WP_000764664.1.58548 WP_000764664.1.5858 WP_000764664.1.58662 WP_000764664.1.58669 WP_000764664.1.58745 WP_000764664.1.58803 WP_000764664.1.5886 WP_000764664.1.59094 WP_000764664.1.59224 WP_000764664.1.59321 WP_000764664.1.59375 WP_000764664.1.59458 WP_000764664.1.59490 WP_000764664.1.59508 WP_000764664.1.59684 WP_000764664.1.59694 WP_000764664.1.59771 WP_000764664.1.5979 WP_000764664.1.59953 WP_000764664.1.60008 WP_000764664.1.60021 WP_000764664.1.60069 WP_000764664.1.60140 WP_000764664.1.60155 WP_000764664.1.60285 WP_000764664.1.60379 WP_000764664.1.60464 WP_000764664.1.60874 WP_000764664.1.60941 WP_000764664.1.61078 WP_000764664.1.6114 WP_000764664.1.61232 WP_000764664.1.6129 WP_000764664.1.61296 WP_000764664.1.61345 WP_000764664.1.61417 WP_000764664.1.61574 WP_000764664.1.61712 WP_000764664.1.61714 WP_000764664.1.61730 WP_000764664.1.61857 WP_000764664.1.61918 WP_000764664.1.61952 WP_000764664.1.62007 WP_000764664.1.62025 WP_000764664.1.62204 WP_000764664.1.62304 WP_000764664.1.62364 WP_000764664.1.62374 WP_000764664.1.62403 WP_000764664.1.6253 WP_000764664.1.62853 WP_000764664.1.62903 WP_000764664.1.62910 WP_000764664.1.62955 WP_000764664.1.63181 WP_000764664.1.63203 WP_000764664.1.63256 WP_000764664.1.63290 WP_000764664.1.63382 WP_000764664.1.63432 WP_000764664.1.63461 WP_000764664.1.63479 WP_000764664.1.63577 WP_000764664.1.63664 WP_000764664.1.63718 WP_000764664.1.6375 WP_000764664.1.63757 WP_000764664.1.63834 WP_000764664.1.64046 WP_000764664.1.6423 WP_000764664.1.64244 WP_000764664.1.64403 WP_000764664.1.64649 WP_000764664.1.64702 WP_000764664.1.64757 WP_000764664.1.64781 WP_000764664.1.64831 WP_000764664.1.6489 WP_000764664.1.64919 WP_000764664.1.65018 WP_000764664.1.65028 WP_000764664.1.65171 WP_000764664.1.65248 WP_000764664.1.6535 WP_000764664.1.65474 WP_000764664.1.65633 WP_000764664.1.6565 WP_000764664.1.65696 WP_000764664.1.6575 WP_000764664.1.65782 WP_000764664.1.66272 WP_000764664.1.6630 WP_000764664.1.66314 WP_000764664.1.66358 WP_000764664.1.66362 WP_000764664.1.6638 WP_000764664.1.6640 WP_000764664.1.66698 WP_000764664.1.6680 WP_000764664.1.66834 WP_000764664.1.66901 WP_000764664.1.66962 WP_000764664.1.67037 WP_000764664.1.67045 WP_000764664.1.67181 WP_000764664.1.67268 WP_000764664.1.67347 WP_000764664.1.67465 WP_000764664.1.67552 WP_000764664.1.67682 WP_000764664.1.67829 WP_000764664.1.67887 WP_000764664.1.68073 WP_000764664.1.68201 WP_000764664.1.68206 WP_000764664.1.6827 WP_000764664.1.68275 WP_000764664.1.6849 WP_000764664.1.68547 WP_000764664.1.68589 WP_000764664.1.68655 WP_000764664.1.68656 WP_000764664.1.68778 WP_000764664.1.68787 WP_000764664.1.68894 WP_000764664.1.68928 WP_000764664.1.68975 WP_000764664.1.69006 WP_000764664.1.6913 WP_000764664.1.69146 WP_000764664.1.69255 WP_000764664.1.69397 WP_000764664.1.69564 WP_000764664.1.69644 WP_000764664.1.69704 WP_000764664.1.7021 WP_000764664.1.70241 WP_000764664.1.70269 WP_000764664.1.70289 WP_000764664.1.70447 WP_000764664.1.70485 WP_000764664.1.70643 WP_000764664.1.70683 WP_000764664.1.70883 WP_000764664.1.70922 WP_000764664.1.70948 WP_000764664.1.71116 WP_000764664.1.71146 WP_000764664.1.71165 WP_000764664.1.71188 WP_000764664.1.71202 WP_000764664.1.71243 WP_000764664.1.71306 WP_000764664.1.71337 WP_000764664.1.71378 WP_000764664.1.71401 WP_000764664.1.71702 WP_000764664.1.71750 WP_000764664.1.71845 WP_000764664.1.71881 WP_000764664.1.71908 WP_000764664.1.71952 WP_000764664.1.71973 WP_000764664.1.72105 WP_000764664.1.72203 WP_000764664.1.72376 WP_000764664.1.72594 WP_000764664.1.72871 WP_000764664.1.72892 WP_000764664.1.72975 WP_000764664.1.7315 WP_000764664.1.73200 WP_000764664.1.7334 WP_000764664.1.73377 WP_000764664.1.73481 WP_000764664.1.7356 WP_000764664.1.73581 WP_000764664.1.73617 WP_000764664.1.73753 WP_000764664.1.73758 WP_000764664.1.73794 WP_000764664.1.7386 WP_000764664.1.7387 WP_000764664.1.73924 WP_000764664.1.74029 WP_000764664.1.74181 WP_000764664.1.74191 WP_000764664.1.7433 WP_000764664.1.74379 WP_000764664.1.74410 WP_000764664.1.74418 WP_000764664.1.74466 WP_000764664.1.74529 WP_000764664.1.74545 WP_000764664.1.74745 WP_000764664.1.75129 WP_000764664.1.75187 WP_000764664.1.75288 WP_000764664.1.75334 WP_000764664.1.75362 WP_000764664.1.75385 WP_000764664.1.75392 WP_000764664.1.75760 WP_000764664.1.75764 WP_000764664.1.75837 WP_000764664.1.75874 WP_000764664.1.75945 WP_000764664.1.76020 WP_000764664.1.76252 WP_000764664.1.76445 WP_000764664.1.7660 WP_000764664.1.76673 WP_000764664.1.76706 WP_000764664.1.76721 WP_000764664.1.76756 WP_000764664.1.76760 WP_000764664.1.76875 WP_000764664.1.76880 WP_000764664.1.76899 WP_000764664.1.77038 WP_000764664.1.77047 WP_000764664.1.77080 WP_000764664.1.7712 WP_000764664.1.77180 WP_000764664.1.77244 WP_000764664.1.77292 WP_000764664.1.77349 WP_000764664.1.77514 WP_000764664.1.77529 WP_000764664.1.77549 WP_000764664.1.77692 WP_000764664.1.7782 WP_000764664.1.77851 WP_000764664.1.77898 WP_000764664.1.77918 WP_000764664.1.77960 WP_000764664.1.78033 WP_000764664.1.78076 WP_000764664.1.78096 WP_000764664.1.78100 WP_000764664.1.78110 WP_000764664.1.78120 WP_000764664.1.78383 WP_000764664.1.78407 WP_000764664.1.7861 WP_000764664.1.78618 WP_000764664.1.78673 WP_000764664.1.78735 WP_000764664.1.78802 WP_000764664.1.78830 WP_000764664.1.78835 WP_000764664.1.78871 WP_000764664.1.78874 WP_000764664.1.78918 WP_000764664.1.78930 WP_000764664.1.79151 WP_000764664.1.79167 WP_000764664.1.79335 WP_000764664.1.79462 WP_000764664.1.79472 WP_000764664.1.79490 WP_000764664.1.79495 WP_000764664.1.79529 WP_000764664.1.79570 WP_000764664.1.7964 WP_000764664.1.79645 WP_000764664.1.79659 WP_000764664.1.79668 WP_000764664.1.79708 WP_000764664.1.79845 WP_000764664.1.80077 WP_000764664.1.80137 WP_000764664.1.80182 WP_000764664.1.80296 WP_000764664.1.80366 WP_000764664.1.80780 WP_000764664.1.80831 WP_000764664.1.80850 WP_000764664.1.80881 WP_000764664.1.80939 WP_000764664.1.8096 WP_000764664.1.80973 WP_000764664.1.81037 WP_000764664.1.81069 WP_000764664.1.81149 WP_000764664.1.81175 WP_000764664.1.8119 WP_000764664.1.81193 WP_000764664.1.81354 WP_000764664.1.81425 WP_000764664.1.81750 WP_000764664.1.81785 WP_000764664.1.81902 WP_000764664.1.81974 WP_000764664.1.81977 WP_000764664.1.82337 WP_000764664.1.82479 WP_000764664.1.82503 WP_000764664.1.82515 WP_000764664.1.82676 WP_000764664.1.82761 WP_000764664.1.8282 WP_000764664.1.82944 WP_000764664.1.82956 WP_000764664.1.83092 WP_000764664.1.83163 WP_000764664.1.83305 WP_000764664.1.83413 WP_000764664.1.83491 WP_000764664.1.83523 WP_000764664.1.8354 WP_000764664.1.83721 WP_000764664.1.83760 WP_000764664.1.83995 WP_000764664.1.84103 WP_000764664.1.84283 WP_000764664.1.84392 WP_000764664.1.8441 WP_000764664.1.84532 WP_000764664.1.84554 WP_000764664.1.84659 WP_000764664.1.84899 WP_000764664.1.8497 WP_000764664.1.85040 WP_000764664.1.85134 WP_000764664.1.85178 WP_000764664.1.85180 WP_000764664.1.85190 WP_000764664.1.8533 WP_000764664.1.8545 WP_000764664.1.85481 WP_000764664.1.85483 WP_000764664.1.85541 WP_000764664.1.8556 WP_000764664.1.85615 WP_000764664.1.85617 WP_000764664.1.85663 WP_000764664.1.85671 WP_000764664.1.85672 WP_000764664.1.85777 WP_000764664.1.85886 WP_000764664.1.85900 WP_000764664.1.85904 WP_000764664.1.85976 WP_000764664.1.86306 WP_000764664.1.86356 WP_000764664.1.86450 WP_000764664.1.86469 WP_000764664.1.86580 WP_000764664.1.86588 WP_000764664.1.86661 WP_000764664.1.8672 WP_000764664.1.8678 WP_000764664.1.86810 WP_000764664.1.8684 WP_000764664.1.86895 WP_000764664.1.86906 WP_000764664.1.87095 WP_000764664.1.8736 WP_000764664.1.87460 WP_000764664.1.87552 WP_000764664.1.87779 WP_000764664.1.87945 WP_000764664.1.88019 WP_000764664.1.88073 WP_000764664.1.8809 WP_000764664.1.88291 WP_000764664.1.88293 WP_000764664.1.8837 WP_000764664.1.88393 WP_000764664.1.88651 WP_000764664.1.88703 WP_000764664.1.88792 WP_000764664.1.88902 WP_000764664.1.8891 WP_000764664.1.89008 WP_000764664.1.89116 WP_000764664.1.89138 WP_000764664.1.89304 WP_000764664.1.89512 WP_000764664.1.89527 WP_000764664.1.89570 WP_000764664.1.89604 WP_000764664.1.89622 WP_000764664.1.89659 WP_000764664.1.89902 WP_000764664.1.8996 WP_000764664.1.90097 WP_000764664.1.90252 WP_000764664.1.90417 WP_000764664.1.90453 WP_000764664.1.90458 WP_000764664.1.90557 WP_000764664.1.90585 WP_000764664.1.90641 WP_000764664.1.90734 WP_000764664.1.91003 WP_000764664.1.91069 WP_000764664.1.91278 WP_000764664.1.91512 WP_000764664.1.91564 WP_000764664.1.91580 WP_000764664.1.91628 WP_000764664.1.91655 WP_000764664.1.91724 WP_000764664.1.91732 WP_000764664.1.91788 WP_000764664.1.91914 WP_000764664.1.92013 WP_000764664.1.92093 WP_000764664.1.92108 WP_000764664.1.92183 WP_000764664.1.92208 WP_000764664.1.92268 WP_000764664.1.92310 WP_000764664.1.92443 WP_000764664.1.92482 WP_000764664.1.92531 WP_000764664.1.92669 WP_000764664.1.92671 WP_000764664.1.92738 WP_000764664.1.93086 WP_000764664.1.93101 WP_000764664.1.93136 WP_000764664.1.93155 WP_000764664.1.93365 WP_000764664.1.93543 WP_000764664.1.93650 WP_000764664.1.93656 WP_000764664.1.93662 WP_000764664.1.937 WP_000764664.1.93705 WP_000764664.1.93804 WP_000764664.1.9389 WP_000764664.1.93994 WP_000764664.1.94072 WP_000764664.1.94162 WP_000764664.1.94168 WP_000764664.1.94198 WP_000764664.1.9432 WP_000764664.1.94354 WP_000764664.1.94380 WP_000764664.1.94458 WP_000764664.1.94565 WP_000764664.1.94584 WP_000764664.1.94674 WP_000764664.1.94796 WP_000764664.1.94959 WP_000764664.1.95051 WP_000764664.1.95085 WP_000764664.1.95121 WP_000764664.1.95282 WP_000764664.1.95320 WP_000764664.1.95546 WP_000764664.1.95630 WP_000764664.1.95911 WP_000764664.1.96139 WP_000764664.1.96317 WP_000764664.1.96343 WP_000764664.1.9644 WP_000764664.1.96469 WP_000764664.1.96500 WP_000764664.1.96555 WP_000764664.1.96563 WP_000764664.1.96732 WP_000764664.1.96771 WP_000764664.1.97015 WP_000764664.1.97145 WP_000764664.1.97190 WP_000764664.1.97318 WP_000764664.1.97369 WP_000764664.1.97594 WP_000764664.1.97597 WP_000764664.1.97613 WP_000764664.1.97620 WP_000764664.1.97626 WP_000764664.1.97727 WP_000764664.1.97732 WP_000764664.1.97736 WP_000764664.1.9775 WP_000764664.1.97846 WP_000764664.1.98006 WP_000764664.1.98019 WP_000764664.1.98022 WP_000764664.1.98110 WP_000764664.1.98146 WP_000764664.1.98219 WP_000764664.1.9841 WP_000764664.1.98495 WP_000764664.1.98531 WP_000764664.1.98577 WP_000764664.1.98676 WP_000764664.1.98677 WP_000764664.1.98760 WP_000764664.1.98843 WP_000764664.1.9898 WP_000764664.1.99098 WP_000764664.1.99184 WP_000764664.1.99267 WP_000764664.1.99276 WP_000764664.1.99646 WP_000764664.1.99657 WP_000764664.1.99660 WP_000764664.1.99712 WP_000764664.1.99813 WP_000764664.1.99858 WP_000764664.1.99889 WP_000764664.1.99958 gi|378698476|ref|YP_005180433.1| gi|379699736|ref|YP_005241464.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]