SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378448870|ref|YP_005236229.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378448870|ref|YP_005236229.1|
Domain Number 1 Region: 17-261
Classification Level Classification E-value
Superfamily RmlC-like cupins 1.55e-68
Family YlbA-like 0.000000000879
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|378448870|ref|YP_005236229.1|
Sequence length 261
Comment hypothetical protein STM14_0616 [Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S]
Sequence
MGYLNNVTGYRDDLLANRAIVKHGNYALLTPDGLVKNIIPGFENCDVTILSTPKLGASFV
DYLVTLHQNGGNQQGFGGEGIETFLYVIAGNIEAKAEGKTFSLTQGGYLYCPPGEMMTFS
NAQTEDSQLFLYKRRYTPVEGHAPWLVSGNASQLERIHYEGMEDVILLDFLPKELGFDMN
MHILSFEPGASHGYIETHVQEHGAYILSGQGVYNLDNNWVPVKKGDYIFMGAYSLQAGYG
VGRGEAFSYIYSKDCNRDVMI
Download sequence
Identical sequences A0A0F6AY11 A0A0F7DI07 A0A0H3BRH7 A0A0H3NDV0 A0A0M2IRU0 A0A0R9N5M2 A0A0W3PNM3 A0A221YVK5 A0A2C6EJ22 A0A2H9YMT2 A0A2I6P6U2 B5EYC6 E8X8B3 Q7CR07 Q8XFX7
gi|488654830|ref|YP_007926633.1| 209261.t2335 220341.STY0574 272994.SPAB_03038 423368.SNSL254_A0579 454166.SeAg_B0572 99287.STM0526 gi|378983131|ref|YP_005246286.1| gi|528818245|ref|YP_008359448.1| gi|378448870|ref|YP_005236229.1| gi|378987928|ref|YP_005251092.1| ABAK02000001|CDS_4753801-4753016 ABAN01000007|CDS_140380-141165 ABAO01000003|CDS_87738-86953 ABEI01000007|CDS_89994-89209 ABEW01000005|CDS_300793-300008 ABFG01000003|CDS_144165-144950 AE006468|CDS_588712-587927 AE014613|CDS_2399167-2399952 AL513382|CDS_581934-581149 CP000886|CDS_2529357-2530142 CP001113|CDS_593108-592323 CP001138|CDS_571575-570790 CP001363|CDS_589406-588621 FN424405|CDS_627522-626737 gi|482904887|ref|YP_007903447.1| gi|161615269|ref|YP_001589234.1| gi|383495332|ref|YP_005396021.1| gi|525839035|ref|YP_008256232.1| gi|378698486|ref|YP_005180443.1| gi|525948102|ref|YP_008309628.1| gi|194445251|ref|YP_002039770.1| gi|378960505|ref|YP_005217991.1| gi|29142727|ref|NP_806069.1| gi|563652099|ref|YP_008860157.1| gi|379699747|ref|YP_005241475.1| NP_455118.1.84458 NP_459521.1.58477 WP_000540981.1.100007 WP_000540981.1.100008 WP_000540981.1.100031 WP_000540981.1.100036 WP_000540981.1.100079 WP_000540981.1.100115 WP_000540981.1.10013 WP_000540981.1.100165 WP_000540981.1.100196 WP_000540981.1.100284 WP_000540981.1.100313 WP_000540981.1.100314 WP_000540981.1.100321 WP_000540981.1.100354 WP_000540981.1.100376 WP_000540981.1.100413 WP_000540981.1.100421 WP_000540981.1.100436 WP_000540981.1.100446 WP_000540981.1.100450 WP_000540981.1.100484 WP_000540981.1.100488 WP_000540981.1.100502 WP_000540981.1.100521 WP_000540981.1.100592 WP_000540981.1.100597 WP_000540981.1.100610 WP_000540981.1.100707 WP_000540981.1.100711 WP_000540981.1.100721 WP_000540981.1.100732 WP_000540981.1.100733 WP_000540981.1.100739 WP_000540981.1.10074 WP_000540981.1.10076 WP_000540981.1.100764 WP_000540981.1.100781 WP_000540981.1.100790 WP_000540981.1.100799 WP_000540981.1.100865 WP_000540981.1.100869 WP_000540981.1.100870 WP_000540981.1.100871 WP_000540981.1.100882 WP_000540981.1.100932 WP_000540981.1.100941 WP_000540981.1.100944 WP_000540981.1.100953 WP_000540981.1.101007 WP_000540981.1.101011 WP_000540981.1.101020 WP_000540981.1.101042 WP_000540981.1.101078 WP_000540981.1.10108 WP_000540981.1.101091 WP_000540981.1.101123 WP_000540981.1.101226 WP_000540981.1.10124 WP_000540981.1.101271 WP_000540981.1.101291 WP_000540981.1.101312 WP_000540981.1.101322 WP_000540981.1.101374 WP_000540981.1.101386 WP_000540981.1.101404 WP_000540981.1.101420 WP_000540981.1.101519 WP_000540981.1.101616 WP_000540981.1.101707 WP_000540981.1.101734 WP_000540981.1.101740 WP_000540981.1.101741 WP_000540981.1.101744 WP_000540981.1.101759 WP_000540981.1.101839 WP_000540981.1.101841 WP_000540981.1.101878 WP_000540981.1.101890 WP_000540981.1.10191 WP_000540981.1.101941 WP_000540981.1.101949 WP_000540981.1.102050 WP_000540981.1.102087 WP_000540981.1.10237 WP_000540981.1.10266 WP_000540981.1.10310 WP_000540981.1.10338 WP_000540981.1.1038 WP_000540981.1.10394 WP_000540981.1.104 WP_000540981.1.10401 WP_000540981.1.10428 WP_000540981.1.10429 WP_000540981.1.10459 WP_000540981.1.10463 WP_000540981.1.10475 WP_000540981.1.10507 WP_000540981.1.10511 WP_000540981.1.10514 WP_000540981.1.10521 WP_000540981.1.10530 WP_000540981.1.10532 WP_000540981.1.10547 WP_000540981.1.10562 WP_000540981.1.10568 WP_000540981.1.10595 WP_000540981.1.10642 WP_000540981.1.10654 WP_000540981.1.10675 WP_000540981.1.10677 WP_000540981.1.10678 WP_000540981.1.10797 WP_000540981.1.10857 WP_000540981.1.10873 WP_000540981.1.10926 WP_000540981.1.10936 WP_000540981.1.10992 WP_000540981.1.11012 WP_000540981.1.11024 WP_000540981.1.11055 WP_000540981.1.11098 WP_000540981.1.11126 WP_000540981.1.11142 WP_000540981.1.11168 WP_000540981.1.11190 WP_000540981.1.11239 WP_000540981.1.11254 WP_000540981.1.11295 WP_000540981.1.11314 WP_000540981.1.11362 WP_000540981.1.11369 WP_000540981.1.11385 WP_000540981.1.11405 WP_000540981.1.1142 WP_000540981.1.11426 WP_000540981.1.11429 WP_000540981.1.11455 WP_000540981.1.11458 WP_000540981.1.11518 WP_000540981.1.11543 WP_000540981.1.11544 WP_000540981.1.11567 WP_000540981.1.11621 WP_000540981.1.11638 WP_000540981.1.11772 WP_000540981.1.11875 WP_000540981.1.11883 WP_000540981.1.11897 WP_000540981.1.11908 WP_000540981.1.11914 WP_000540981.1.11938 WP_000540981.1.12007 WP_000540981.1.12040 WP_000540981.1.12047 WP_000540981.1.12059 WP_000540981.1.12061 WP_000540981.1.1207 WP_000540981.1.12141 WP_000540981.1.12159 WP_000540981.1.12160 WP_000540981.1.12172 WP_000540981.1.12192 WP_000540981.1.1224 WP_000540981.1.12244 WP_000540981.1.12364 WP_000540981.1.12370 WP_000540981.1.12397 WP_000540981.1.12398 WP_000540981.1.12441 WP_000540981.1.12456 WP_000540981.1.12472 WP_000540981.1.12581 WP_000540981.1.12584 WP_000540981.1.12620 WP_000540981.1.1264 WP_000540981.1.12648 WP_000540981.1.12650 WP_000540981.1.12683 WP_000540981.1.12726 WP_000540981.1.12727 WP_000540981.1.12728 WP_000540981.1.12741 WP_000540981.1.12834 WP_000540981.1.13106 WP_000540981.1.13108 WP_000540981.1.13130 WP_000540981.1.13161 WP_000540981.1.1321 WP_000540981.1.1326 WP_000540981.1.13268 WP_000540981.1.13291 WP_000540981.1.133 WP_000540981.1.13314 WP_000540981.1.13338 WP_000540981.1.13342 WP_000540981.1.13352 WP_000540981.1.13406 WP_000540981.1.13414 WP_000540981.1.13440 WP_000540981.1.13476 WP_000540981.1.13488 WP_000540981.1.13509 WP_000540981.1.13599 WP_000540981.1.13669 WP_000540981.1.13677 WP_000540981.1.13686 WP_000540981.1.1372 WP_000540981.1.13732 WP_000540981.1.13741 WP_000540981.1.13764 WP_000540981.1.13819 WP_000540981.1.1382 WP_000540981.1.13829 WP_000540981.1.13857 WP_000540981.1.1387 WP_000540981.1.13932 WP_000540981.1.1397 WP_000540981.1.13972 WP_000540981.1.140 WP_000540981.1.1401 WP_000540981.1.14089 WP_000540981.1.14099 WP_000540981.1.14120 WP_000540981.1.14123 WP_000540981.1.14150 WP_000540981.1.14191 WP_000540981.1.14197 WP_000540981.1.14239 WP_000540981.1.14280 WP_000540981.1.14286 WP_000540981.1.14333 WP_000540981.1.14369 WP_000540981.1.14379 WP_000540981.1.14399 WP_000540981.1.14406 WP_000540981.1.14444 WP_000540981.1.14466 WP_000540981.1.14467 WP_000540981.1.14474 WP_000540981.1.14495 WP_000540981.1.14500 WP_000540981.1.14505 WP_000540981.1.14516 WP_000540981.1.14526 WP_000540981.1.14528 WP_000540981.1.14550 WP_000540981.1.14554 WP_000540981.1.14575 WP_000540981.1.14688 WP_000540981.1.14701 WP_000540981.1.14703 WP_000540981.1.14706 WP_000540981.1.14719 WP_000540981.1.1473 WP_000540981.1.14765 WP_000540981.1.14789 WP_000540981.1.14810 WP_000540981.1.14852 WP_000540981.1.14877 WP_000540981.1.1489 WP_000540981.1.14894 WP_000540981.1.14930 WP_000540981.1.14947 WP_000540981.1.14948 WP_000540981.1.14964 WP_000540981.1.15046 WP_000540981.1.15079 WP_000540981.1.15102 WP_000540981.1.15124 WP_000540981.1.15184 WP_000540981.1.15226 WP_000540981.1.15244 WP_000540981.1.15265 WP_000540981.1.15353 WP_000540981.1.15362 WP_000540981.1.15415 WP_000540981.1.15423 WP_000540981.1.15433 WP_000540981.1.15439 WP_000540981.1.15479 WP_000540981.1.15483 WP_000540981.1.15487 WP_000540981.1.15508 WP_000540981.1.15535 WP_000540981.1.15581 WP_000540981.1.15597 WP_000540981.1.15625 WP_000540981.1.15644 WP_000540981.1.15708 WP_000540981.1.15710 WP_000540981.1.15717 WP_000540981.1.15784 WP_000540981.1.158 WP_000540981.1.15830 WP_000540981.1.15881 WP_000540981.1.15905 WP_000540981.1.15909 WP_000540981.1.15912 WP_000540981.1.15970 WP_000540981.1.15978 WP_000540981.1.16000 WP_000540981.1.16032 WP_000540981.1.16046 WP_000540981.1.16051 WP_000540981.1.16052 WP_000540981.1.16058 WP_000540981.1.16062 WP_000540981.1.16063 WP_000540981.1.16103 WP_000540981.1.16150 WP_000540981.1.16155 WP_000540981.1.16158 WP_000540981.1.16166 WP_000540981.1.16172 WP_000540981.1.16226 WP_000540981.1.16244 WP_000540981.1.1626 WP_000540981.1.16264 WP_000540981.1.16328 WP_000540981.1.16331 WP_000540981.1.16344 WP_000540981.1.1635 WP_000540981.1.16452 WP_000540981.1.16461 WP_000540981.1.16462 WP_000540981.1.16465 WP_000540981.1.16522 WP_000540981.1.16588 WP_000540981.1.16614 WP_000540981.1.16656 WP_000540981.1.16658 WP_000540981.1.16666 WP_000540981.1.16673 WP_000540981.1.16686 WP_000540981.1.16691 WP_000540981.1.16732 WP_000540981.1.1674 WP_000540981.1.16767 WP_000540981.1.16781 WP_000540981.1.16786 WP_000540981.1.16819 WP_000540981.1.16826 WP_000540981.1.16846 WP_000540981.1.16879 WP_000540981.1.16893 WP_000540981.1.16896 WP_000540981.1.16905 WP_000540981.1.16916 WP_000540981.1.16941 WP_000540981.1.16948 WP_000540981.1.1700 WP_000540981.1.17031 WP_000540981.1.17049 WP_000540981.1.17058 WP_000540981.1.17078 WP_000540981.1.17098 WP_000540981.1.17188 WP_000540981.1.17202 WP_000540981.1.17219 WP_000540981.1.17285 WP_000540981.1.17302 WP_000540981.1.17308 WP_000540981.1.17368 WP_000540981.1.1737 WP_000540981.1.17390 WP_000540981.1.17405 WP_000540981.1.17406 WP_000540981.1.17447 WP_000540981.1.17480 WP_000540981.1.1749 WP_000540981.1.17513 WP_000540981.1.17543 WP_000540981.1.17546 WP_000540981.1.17563 WP_000540981.1.17578 WP_000540981.1.17622 WP_000540981.1.17659 WP_000540981.1.17667 WP_000540981.1.17686 WP_000540981.1.17693 WP_000540981.1.17840 WP_000540981.1.17865 WP_000540981.1.17949 WP_000540981.1.17956 WP_000540981.1.17991 WP_000540981.1.18005 WP_000540981.1.1801 WP_000540981.1.18021 WP_000540981.1.1807 WP_000540981.1.18099 WP_000540981.1.18111 WP_000540981.1.18124 WP_000540981.1.18144 WP_000540981.1.18173 WP_000540981.1.18267 WP_000540981.1.18270 WP_000540981.1.18280 WP_000540981.1.18281 WP_000540981.1.18328 WP_000540981.1.18358 WP_000540981.1.18370 WP_000540981.1.18406 WP_000540981.1.18445 WP_000540981.1.18468 WP_000540981.1.18474 WP_000540981.1.18513 WP_000540981.1.18610 WP_000540981.1.18678 WP_000540981.1.18692 WP_000540981.1.18705 WP_000540981.1.18722 WP_000540981.1.18766 WP_000540981.1.18776 WP_000540981.1.1880 WP_000540981.1.18822 WP_000540981.1.1885 WP_000540981.1.18860 WP_000540981.1.18881 WP_000540981.1.18919 WP_000540981.1.18922 WP_000540981.1.18940 WP_000540981.1.18949 WP_000540981.1.18959 WP_000540981.1.1897 WP_000540981.1.19001 WP_000540981.1.19006 WP_000540981.1.19044 WP_000540981.1.19053 WP_000540981.1.19055 WP_000540981.1.19084 WP_000540981.1.19187 WP_000540981.1.19228 WP_000540981.1.19288 WP_000540981.1.19291 WP_000540981.1.19300 WP_000540981.1.19320 WP_000540981.1.19422 WP_000540981.1.19454 WP_000540981.1.19456 WP_000540981.1.19460 WP_000540981.1.19469 WP_000540981.1.19496 WP_000540981.1.19535 WP_000540981.1.19538 WP_000540981.1.19589 WP_000540981.1.19663 WP_000540981.1.19686 WP_000540981.1.19702 WP_000540981.1.19706 WP_000540981.1.19731 WP_000540981.1.19749 WP_000540981.1.19794 WP_000540981.1.19809 WP_000540981.1.19823 WP_000540981.1.19867 WP_000540981.1.1992 WP_000540981.1.1998 WP_000540981.1.19999 WP_000540981.1.20 WP_000540981.1.20023 WP_000540981.1.20034 WP_000540981.1.20081 WP_000540981.1.2010 WP_000540981.1.20212 WP_000540981.1.20254 WP_000540981.1.20255 WP_000540981.1.20296 WP_000540981.1.20339 WP_000540981.1.20362 WP_000540981.1.20391 WP_000540981.1.20418 WP_000540981.1.20419 WP_000540981.1.20425 WP_000540981.1.20465 WP_000540981.1.20492 WP_000540981.1.20503 WP_000540981.1.20525 WP_000540981.1.2053 WP_000540981.1.20573 WP_000540981.1.20635 WP_000540981.1.20695 WP_000540981.1.20700 WP_000540981.1.20718 WP_000540981.1.20721 WP_000540981.1.2073 WP_000540981.1.20740 WP_000540981.1.20795 WP_000540981.1.20828 WP_000540981.1.2087 WP_000540981.1.20883 WP_000540981.1.20886 WP_000540981.1.20894 WP_000540981.1.20908 WP_000540981.1.20947 WP_000540981.1.20953 WP_000540981.1.2101 WP_000540981.1.21010 WP_000540981.1.21049 WP_000540981.1.2106 WP_000540981.1.21062 WP_000540981.1.21075 WP_000540981.1.21086 WP_000540981.1.21144 WP_000540981.1.21146 WP_000540981.1.21162 WP_000540981.1.21165 WP_000540981.1.21184 WP_000540981.1.21185 WP_000540981.1.21246 WP_000540981.1.21286 WP_000540981.1.21366 WP_000540981.1.21399 WP_000540981.1.21443 WP_000540981.1.21492 WP_000540981.1.21603 WP_000540981.1.2166 WP_000540981.1.21674 WP_000540981.1.21750 WP_000540981.1.21751 WP_000540981.1.21757 WP_000540981.1.21792 WP_000540981.1.21825 WP_000540981.1.21910 WP_000540981.1.21946 WP_000540981.1.21966 WP_000540981.1.22030 WP_000540981.1.2205 WP_000540981.1.22064 WP_000540981.1.22118 WP_000540981.1.22126 WP_000540981.1.2216 WP_000540981.1.22205 WP_000540981.1.22208 WP_000540981.1.2221 WP_000540981.1.2224 WP_000540981.1.22240 WP_000540981.1.2227 WP_000540981.1.22315 WP_000540981.1.2235 WP_000540981.1.22373 WP_000540981.1.22427 WP_000540981.1.22453 WP_000540981.1.2246 WP_000540981.1.22476 WP_000540981.1.22514 WP_000540981.1.22565 WP_000540981.1.22575 WP_000540981.1.22604 WP_000540981.1.22614 WP_000540981.1.22620 WP_000540981.1.22623 WP_000540981.1.22652 WP_000540981.1.22683 WP_000540981.1.2284 WP_000540981.1.22870 WP_000540981.1.22895 WP_000540981.1.22926 WP_000540981.1.22943 WP_000540981.1.22967 WP_000540981.1.22979 WP_000540981.1.23010 WP_000540981.1.23040 WP_000540981.1.23058 WP_000540981.1.23080 WP_000540981.1.23102 WP_000540981.1.23155 WP_000540981.1.23175 WP_000540981.1.23218 WP_000540981.1.23258 WP_000540981.1.23259 WP_000540981.1.2331 WP_000540981.1.23311 WP_000540981.1.2332 WP_000540981.1.23340 WP_000540981.1.23343 WP_000540981.1.2336 WP_000540981.1.23365 WP_000540981.1.23412 WP_000540981.1.23426 WP_000540981.1.23466 WP_000540981.1.23472 WP_000540981.1.23482 WP_000540981.1.23485 WP_000540981.1.23492 WP_000540981.1.23500 WP_000540981.1.23513 WP_000540981.1.23515 WP_000540981.1.23548 WP_000540981.1.23587 WP_000540981.1.23604 WP_000540981.1.23621 WP_000540981.1.23629 WP_000540981.1.23643 WP_000540981.1.23675 WP_000540981.1.23679 WP_000540981.1.23685 WP_000540981.1.237 WP_000540981.1.23720 WP_000540981.1.23728 WP_000540981.1.23736 WP_000540981.1.2375 WP_000540981.1.23783 WP_000540981.1.23786 WP_000540981.1.23787 WP_000540981.1.2380 WP_000540981.1.23801 WP_000540981.1.23819 WP_000540981.1.23932 WP_000540981.1.24017 WP_000540981.1.24028 WP_000540981.1.24061 WP_000540981.1.24083 WP_000540981.1.24117 WP_000540981.1.24125 WP_000540981.1.24138 WP_000540981.1.2415 WP_000540981.1.24153 WP_000540981.1.24158 WP_000540981.1.24206 WP_000540981.1.24291 WP_000540981.1.24322 WP_000540981.1.24325 WP_000540981.1.24355 WP_000540981.1.24375 WP_000540981.1.24400 WP_000540981.1.24420 WP_000540981.1.24619 WP_000540981.1.24643 WP_000540981.1.24686 WP_000540981.1.24688 WP_000540981.1.24696 WP_000540981.1.24716 WP_000540981.1.24723 WP_000540981.1.24737 WP_000540981.1.24779 WP_000540981.1.2481 WP_000540981.1.24832 WP_000540981.1.24837 WP_000540981.1.24839 WP_000540981.1.24873 WP_000540981.1.24964 WP_000540981.1.25015 WP_000540981.1.25017 WP_000540981.1.25032 WP_000540981.1.25041 WP_000540981.1.25053 WP_000540981.1.25064 WP_000540981.1.25140 WP_000540981.1.25185 WP_000540981.1.25196 WP_000540981.1.25205 WP_000540981.1.25210 WP_000540981.1.25219 WP_000540981.1.25304 WP_000540981.1.25374 WP_000540981.1.25454 WP_000540981.1.25475 WP_000540981.1.25490 WP_000540981.1.25493 WP_000540981.1.25498 WP_000540981.1.25508 WP_000540981.1.25512 WP_000540981.1.25514 WP_000540981.1.25546 WP_000540981.1.25603 WP_000540981.1.2562 WP_000540981.1.25666 WP_000540981.1.25668 WP_000540981.1.25740 WP_000540981.1.25807 WP_000540981.1.25809 WP_000540981.1.25821 WP_000540981.1.25833 WP_000540981.1.25835 WP_000540981.1.25911 WP_000540981.1.25932 WP_000540981.1.25944 WP_000540981.1.25962 WP_000540981.1.25963 WP_000540981.1.25988 WP_000540981.1.26001 WP_000540981.1.26027 WP_000540981.1.26030 WP_000540981.1.26093 WP_000540981.1.26107 WP_000540981.1.26129 WP_000540981.1.2615 WP_000540981.1.26217 WP_000540981.1.26224 WP_000540981.1.26230 WP_000540981.1.26232 WP_000540981.1.26269 WP_000540981.1.26272 WP_000540981.1.26282 WP_000540981.1.26286 WP_000540981.1.26288 WP_000540981.1.26319 WP_000540981.1.2634 WP_000540981.1.26363 WP_000540981.1.26394 WP_000540981.1.26426 WP_000540981.1.26440 WP_000540981.1.26491 WP_000540981.1.2654 WP_000540981.1.26551 WP_000540981.1.26554 WP_000540981.1.26582 WP_000540981.1.2660 WP_000540981.1.26636 WP_000540981.1.26646 WP_000540981.1.26689 WP_000540981.1.26709 WP_000540981.1.2679 WP_000540981.1.26883 WP_000540981.1.26892 WP_000540981.1.26908 WP_000540981.1.2692 WP_000540981.1.26928 WP_000540981.1.26980 WP_000540981.1.270 WP_000540981.1.27008 WP_000540981.1.27010 WP_000540981.1.27027 WP_000540981.1.27070 WP_000540981.1.27077 WP_000540981.1.27086 WP_000540981.1.27087 WP_000540981.1.27111 WP_000540981.1.27115 WP_000540981.1.2713 WP_000540981.1.2717 WP_000540981.1.27173 WP_000540981.1.272 WP_000540981.1.27206 WP_000540981.1.27228 WP_000540981.1.2723 WP_000540981.1.27255 WP_000540981.1.27279 WP_000540981.1.27282 WP_000540981.1.27285 WP_000540981.1.27309 WP_000540981.1.27329 WP_000540981.1.27361 WP_000540981.1.27419 WP_000540981.1.27423 WP_000540981.1.27522 WP_000540981.1.27523 WP_000540981.1.27535 WP_000540981.1.27556 WP_000540981.1.27561 WP_000540981.1.27565 WP_000540981.1.27595 WP_000540981.1.27598 WP_000540981.1.2763 WP_000540981.1.27665 WP_000540981.1.27706 WP_000540981.1.27707 WP_000540981.1.27761 WP_000540981.1.2777 WP_000540981.1.27775 WP_000540981.1.27785 WP_000540981.1.27857 WP_000540981.1.27900 WP_000540981.1.27928 WP_000540981.1.27945 WP_000540981.1.27977 WP_000540981.1.28002 WP_000540981.1.28004 WP_000540981.1.28073 WP_000540981.1.2809 WP_000540981.1.28094 WP_000540981.1.28155 WP_000540981.1.28170 WP_000540981.1.28198 WP_000540981.1.28229 WP_000540981.1.2829 WP_000540981.1.28301 WP_000540981.1.28302 WP_000540981.1.28370 WP_000540981.1.28384 WP_000540981.1.28386 WP_000540981.1.28395 WP_000540981.1.284 WP_000540981.1.2845 WP_000540981.1.28479 WP_000540981.1.28538 WP_000540981.1.28612 WP_000540981.1.28625 WP_000540981.1.28627 WP_000540981.1.28673 WP_000540981.1.28692 WP_000540981.1.287 WP_000540981.1.2873 WP_000540981.1.28811 WP_000540981.1.28917 WP_000540981.1.28938 WP_000540981.1.28962 WP_000540981.1.28977 WP_000540981.1.29006 WP_000540981.1.29010 WP_000540981.1.29023 WP_000540981.1.29042 WP_000540981.1.2905 WP_000540981.1.2907 WP_000540981.1.29081 WP_000540981.1.29089 WP_000540981.1.29153 WP_000540981.1.29190 WP_000540981.1.29203 WP_000540981.1.29237 WP_000540981.1.29248 WP_000540981.1.29288 WP_000540981.1.29389 WP_000540981.1.29439 WP_000540981.1.2946 WP_000540981.1.29563 WP_000540981.1.29588 WP_000540981.1.29601 WP_000540981.1.29619 WP_000540981.1.29704 WP_000540981.1.29727 WP_000540981.1.29732 WP_000540981.1.29743 WP_000540981.1.29782 WP_000540981.1.29833 WP_000540981.1.29851 WP_000540981.1.29865 WP_000540981.1.29886 WP_000540981.1.29919 WP_000540981.1.29924 WP_000540981.1.2994 WP_000540981.1.29964 WP_000540981.1.29969 WP_000540981.1.29983 WP_000540981.1.30006 WP_000540981.1.30009 WP_000540981.1.30013 WP_000540981.1.3002 WP_000540981.1.30027 WP_000540981.1.30034 WP_000540981.1.30049 WP_000540981.1.30058 WP_000540981.1.30086 WP_000540981.1.3017 WP_000540981.1.30170 WP_000540981.1.30172 WP_000540981.1.30185 WP_000540981.1.30238 WP_000540981.1.30246 WP_000540981.1.30331 WP_000540981.1.30354 WP_000540981.1.30356 WP_000540981.1.30357 WP_000540981.1.30362 WP_000540981.1.3042 WP_000540981.1.30421 WP_000540981.1.30425 WP_000540981.1.30440 WP_000540981.1.30448 WP_000540981.1.30469 WP_000540981.1.30489 WP_000540981.1.30505 WP_000540981.1.30517 WP_000540981.1.30535 WP_000540981.1.30542 WP_000540981.1.30544 WP_000540981.1.30556 WP_000540981.1.30572 WP_000540981.1.30573 WP_000540981.1.30585 WP_000540981.1.30602 WP_000540981.1.30618 WP_000540981.1.30664 WP_000540981.1.30688 WP_000540981.1.30696 WP_000540981.1.3080 WP_000540981.1.30806 WP_000540981.1.30823 WP_000540981.1.30909 WP_000540981.1.30951 WP_000540981.1.30967 WP_000540981.1.30972 WP_000540981.1.31011 WP_000540981.1.31046 WP_000540981.1.31066 WP_000540981.1.31078 WP_000540981.1.31086 WP_000540981.1.31107 WP_000540981.1.31111 WP_000540981.1.31139 WP_000540981.1.31145 WP_000540981.1.31155 WP_000540981.1.31182 WP_000540981.1.31185 WP_000540981.1.3119 WP_000540981.1.31195 WP_000540981.1.31198 WP_000540981.1.31205 WP_000540981.1.3121 WP_000540981.1.31210 WP_000540981.1.31223 WP_000540981.1.3124 WP_000540981.1.31281 WP_000540981.1.31303 WP_000540981.1.3131 WP_000540981.1.31352 WP_000540981.1.31362 WP_000540981.1.31389 WP_000540981.1.31413 WP_000540981.1.31446 WP_000540981.1.31476 WP_000540981.1.31504 WP_000540981.1.31515 WP_000540981.1.31533 WP_000540981.1.31578 WP_000540981.1.31720 WP_000540981.1.31725 WP_000540981.1.31762 WP_000540981.1.31782 WP_000540981.1.31799 WP_000540981.1.31836 WP_000540981.1.31951 WP_000540981.1.31972 WP_000540981.1.32041 WP_000540981.1.32042 WP_000540981.1.32056 WP_000540981.1.3207 WP_000540981.1.32170 WP_000540981.1.32189 WP_000540981.1.32202 WP_000540981.1.32263 WP_000540981.1.32277 WP_000540981.1.32293 WP_000540981.1.32299 WP_000540981.1.32368 WP_000540981.1.32422 WP_000540981.1.32425 WP_000540981.1.32438 WP_000540981.1.32458 WP_000540981.1.32460 WP_000540981.1.32515 WP_000540981.1.32529 WP_000540981.1.32545 WP_000540981.1.32563 WP_000540981.1.32578 WP_000540981.1.32617 WP_000540981.1.32660 WP_000540981.1.3270 WP_000540981.1.32702 WP_000540981.1.32714 WP_000540981.1.32725 WP_000540981.1.32747 WP_000540981.1.32750 WP_000540981.1.3278 WP_000540981.1.32786 WP_000540981.1.32804 WP_000540981.1.32838 WP_000540981.1.32848 WP_000540981.1.32868 WP_000540981.1.3290 WP_000540981.1.32900 WP_000540981.1.32907 WP_000540981.1.32930 WP_000540981.1.32940 WP_000540981.1.32941 WP_000540981.1.3296 WP_000540981.1.32966 WP_000540981.1.32985 WP_000540981.1.33037 WP_000540981.1.3305 WP_000540981.1.33051 WP_000540981.1.33065 WP_000540981.1.33078 WP_000540981.1.33122 WP_000540981.1.3315 WP_000540981.1.33208 WP_000540981.1.33214 WP_000540981.1.33247 WP_000540981.1.33248 WP_000540981.1.33261 WP_000540981.1.33280 WP_000540981.1.33283 WP_000540981.1.33313 WP_000540981.1.33339 WP_000540981.1.33382 WP_000540981.1.33392 WP_000540981.1.33490 WP_000540981.1.33499 WP_000540981.1.33501 WP_000540981.1.33529 WP_000540981.1.33553 WP_000540981.1.33609 WP_000540981.1.33689 WP_000540981.1.33693 WP_000540981.1.3370 WP_000540981.1.33730 WP_000540981.1.33741 WP_000540981.1.33825 WP_000540981.1.33840 WP_000540981.1.33894 WP_000540981.1.3392 WP_000540981.1.33926 WP_000540981.1.33957 WP_000540981.1.33969 WP_000540981.1.34001 WP_000540981.1.34043 WP_000540981.1.34059 WP_000540981.1.34084 WP_000540981.1.34107 WP_000540981.1.34118 WP_000540981.1.34211 WP_000540981.1.34214 WP_000540981.1.34234 WP_000540981.1.34259 WP_000540981.1.34279 WP_000540981.1.34284 WP_000540981.1.34319 WP_000540981.1.34330 WP_000540981.1.34376 WP_000540981.1.34382 WP_000540981.1.3445 WP_000540981.1.34453 WP_000540981.1.34484 WP_000540981.1.34517 WP_000540981.1.34530 WP_000540981.1.34610 WP_000540981.1.34665 WP_000540981.1.34667 WP_000540981.1.34694 WP_000540981.1.34703 WP_000540981.1.34707 WP_000540981.1.34751 WP_000540981.1.34801 WP_000540981.1.34824 WP_000540981.1.34834 WP_000540981.1.34856 WP_000540981.1.34881 WP_000540981.1.34932 WP_000540981.1.34962 WP_000540981.1.34975 WP_000540981.1.35001 WP_000540981.1.35040 WP_000540981.1.35045 WP_000540981.1.35074 WP_000540981.1.35175 WP_000540981.1.35184 WP_000540981.1.35240 WP_000540981.1.35274 WP_000540981.1.35408 WP_000540981.1.3541 WP_000540981.1.35425 WP_000540981.1.35446 WP_000540981.1.35460 WP_000540981.1.35463 WP_000540981.1.35494 WP_000540981.1.35503 WP_000540981.1.35532 WP_000540981.1.35560 WP_000540981.1.3557 WP_000540981.1.35628 WP_000540981.1.35648 WP_000540981.1.3566 WP_000540981.1.3570 WP_000540981.1.35712 WP_000540981.1.35713 WP_000540981.1.35736 WP_000540981.1.35791 WP_000540981.1.35795 WP_000540981.1.35835 WP_000540981.1.35870 WP_000540981.1.35916 WP_000540981.1.35938 WP_000540981.1.35966 WP_000540981.1.36000 WP_000540981.1.36034 WP_000540981.1.36036 WP_000540981.1.36069 WP_000540981.1.36157 WP_000540981.1.36229 WP_000540981.1.36232 WP_000540981.1.36291 WP_000540981.1.36298 WP_000540981.1.36308 WP_000540981.1.36323 WP_000540981.1.36343 WP_000540981.1.36460 WP_000540981.1.3649 WP_000540981.1.36495 WP_000540981.1.36512 WP_000540981.1.36526 WP_000540981.1.36579 WP_000540981.1.36609 WP_000540981.1.36617 WP_000540981.1.36618 WP_000540981.1.36643 WP_000540981.1.36663 WP_000540981.1.36690 WP_000540981.1.3670 WP_000540981.1.36701 WP_000540981.1.36725 WP_000540981.1.36779 WP_000540981.1.36798 WP_000540981.1.36802 WP_000540981.1.36821 WP_000540981.1.36839 WP_000540981.1.36853 WP_000540981.1.36885 WP_000540981.1.36918 WP_000540981.1.36950 WP_000540981.1.37013 WP_000540981.1.37014 WP_000540981.1.37021 WP_000540981.1.37063 WP_000540981.1.37073 WP_000540981.1.37111 WP_000540981.1.37112 WP_000540981.1.37133 WP_000540981.1.37147 WP_000540981.1.37158 WP_000540981.1.37176 WP_000540981.1.37199 WP_000540981.1.37200 WP_000540981.1.37256 WP_000540981.1.37258 WP_000540981.1.3728 WP_000540981.1.37303 WP_000540981.1.3734 WP_000540981.1.37376 WP_000540981.1.37504 WP_000540981.1.3751 WP_000540981.1.37513 WP_000540981.1.37558 WP_000540981.1.3756 WP_000540981.1.37584 WP_000540981.1.37590 WP_000540981.1.37593 WP_000540981.1.37600 WP_000540981.1.37613 WP_000540981.1.37659 WP_000540981.1.37662 WP_000540981.1.37666 WP_000540981.1.37675 WP_000540981.1.37691 WP_000540981.1.37761 WP_000540981.1.37775 WP_000540981.1.37777 WP_000540981.1.378 WP_000540981.1.37848 WP_000540981.1.379 WP_000540981.1.37911 WP_000540981.1.37941 WP_000540981.1.37965 WP_000540981.1.37978 WP_000540981.1.37985 WP_000540981.1.38001 WP_000540981.1.38055 WP_000540981.1.38061 WP_000540981.1.38064 WP_000540981.1.38108 WP_000540981.1.38113 WP_000540981.1.38125 WP_000540981.1.38145 WP_000540981.1.3816 WP_000540981.1.38199 WP_000540981.1.38207 WP_000540981.1.38261 WP_000540981.1.38266 WP_000540981.1.3828 WP_000540981.1.383 WP_000540981.1.38310 WP_000540981.1.38322 WP_000540981.1.3834 WP_000540981.1.38341 WP_000540981.1.38349 WP_000540981.1.38351 WP_000540981.1.3838 WP_000540981.1.38381 WP_000540981.1.38393 WP_000540981.1.38408 WP_000540981.1.38440 WP_000540981.1.3848 WP_000540981.1.38486 WP_000540981.1.38512 WP_000540981.1.38515 WP_000540981.1.38595 WP_000540981.1.3860 WP_000540981.1.38613 WP_000540981.1.38622 WP_000540981.1.38642 WP_000540981.1.38734 WP_000540981.1.38773 WP_000540981.1.38830 WP_000540981.1.38877 WP_000540981.1.38882 WP_000540981.1.38913 WP_000540981.1.38983 WP_000540981.1.38995 WP_000540981.1.38996 WP_000540981.1.39003 WP_000540981.1.39056 WP_000540981.1.3907 WP_000540981.1.39105 WP_000540981.1.39113 WP_000540981.1.39128 WP_000540981.1.3914 WP_000540981.1.39147 WP_000540981.1.39161 WP_000540981.1.39197 WP_000540981.1.39210 WP_000540981.1.39235 WP_000540981.1.39275 WP_000540981.1.3931 WP_000540981.1.39385 WP_000540981.1.39420 WP_000540981.1.39435 WP_000540981.1.39449 WP_000540981.1.39466 WP_000540981.1.39471 WP_000540981.1.39502 WP_000540981.1.39503 WP_000540981.1.39530 WP_000540981.1.39576 WP_000540981.1.39619 WP_000540981.1.39620 WP_000540981.1.39624 WP_000540981.1.39659 WP_000540981.1.39667 WP_000540981.1.39722 WP_000540981.1.39723 WP_000540981.1.39775 WP_000540981.1.39808 WP_000540981.1.39879 WP_000540981.1.39890 WP_000540981.1.39921 WP_000540981.1.39923 WP_000540981.1.39941 WP_000540981.1.39945 WP_000540981.1.39947 WP_000540981.1.40025 WP_000540981.1.40095 WP_000540981.1.40097 WP_000540981.1.401 WP_000540981.1.4011 WP_000540981.1.40155 WP_000540981.1.40160 WP_000540981.1.40167 WP_000540981.1.40171 WP_000540981.1.40257 WP_000540981.1.40279 WP_000540981.1.40292 WP_000540981.1.40305 WP_000540981.1.40311 WP_000540981.1.40361 WP_000540981.1.40380 WP_000540981.1.4042 WP_000540981.1.40465 WP_000540981.1.40467 WP_000540981.1.40496 WP_000540981.1.40508 WP_000540981.1.40517 WP_000540981.1.40648 WP_000540981.1.40698 WP_000540981.1.40722 WP_000540981.1.4075 WP_000540981.1.40750 WP_000540981.1.40763 WP_000540981.1.40788 WP_000540981.1.40854 WP_000540981.1.4087 WP_000540981.1.4089 WP_000540981.1.40910 WP_000540981.1.40924 WP_000540981.1.40932 WP_000540981.1.40946 WP_000540981.1.40979 WP_000540981.1.41004 WP_000540981.1.41017 WP_000540981.1.4106 WP_000540981.1.41070 WP_000540981.1.41074 WP_000540981.1.41075 WP_000540981.1.4109 WP_000540981.1.41097 WP_000540981.1.41132 WP_000540981.1.41176 WP_000540981.1.41225 WP_000540981.1.41226 WP_000540981.1.41251 WP_000540981.1.41258 WP_000540981.1.41265 WP_000540981.1.41305 WP_000540981.1.41308 WP_000540981.1.41321 WP_000540981.1.41333 WP_000540981.1.41335 WP_000540981.1.4136 WP_000540981.1.41375 WP_000540981.1.41415 WP_000540981.1.41459 WP_000540981.1.41498 WP_000540981.1.41516 WP_000540981.1.41519 WP_000540981.1.41524 WP_000540981.1.41554 WP_000540981.1.41572 WP_000540981.1.41591 WP_000540981.1.41593 WP_000540981.1.41628 WP_000540981.1.41631 WP_000540981.1.41658 WP_000540981.1.41659 WP_000540981.1.41662 WP_000540981.1.41708 WP_000540981.1.41716 WP_000540981.1.41746 WP_000540981.1.41824 WP_000540981.1.41825 WP_000540981.1.41836 WP_000540981.1.4184 WP_000540981.1.41894 WP_000540981.1.41904 WP_000540981.1.41919 WP_000540981.1.41929 WP_000540981.1.4194 WP_000540981.1.41979 WP_000540981.1.41985 WP_000540981.1.42069 WP_000540981.1.42081 WP_000540981.1.42090 WP_000540981.1.42104 WP_000540981.1.42109 WP_000540981.1.42187 WP_000540981.1.42200 WP_000540981.1.42219 WP_000540981.1.42244 WP_000540981.1.42248 WP_000540981.1.42257 WP_000540981.1.42261 WP_000540981.1.42262 WP_000540981.1.42342 WP_000540981.1.42349 WP_000540981.1.42364 WP_000540981.1.42371 WP_000540981.1.42379 WP_000540981.1.4239 WP_000540981.1.42391 WP_000540981.1.42399 WP_000540981.1.42433 WP_000540981.1.42453 WP_000540981.1.42539 WP_000540981.1.42603 WP_000540981.1.42605 WP_000540981.1.42650 WP_000540981.1.42655 WP_000540981.1.4267 WP_000540981.1.42701 WP_000540981.1.42707 WP_000540981.1.4276 WP_000540981.1.42767 WP_000540981.1.42794 WP_000540981.1.42797 WP_000540981.1.42805 WP_000540981.1.42815 WP_000540981.1.42829 WP_000540981.1.42859 WP_000540981.1.42864 WP_000540981.1.4288 WP_000540981.1.42887 WP_000540981.1.4289 WP_000540981.1.42923 WP_000540981.1.42957 WP_000540981.1.4298 WP_000540981.1.43008 WP_000540981.1.43016 WP_000540981.1.43019 WP_000540981.1.43065 WP_000540981.1.43069 WP_000540981.1.43070 WP_000540981.1.43128 WP_000540981.1.43141 WP_000540981.1.43157 WP_000540981.1.43160 WP_000540981.1.43161 WP_000540981.1.43190 WP_000540981.1.43198 WP_000540981.1.43244 WP_000540981.1.4326 WP_000540981.1.43290 WP_000540981.1.43292 WP_000540981.1.43307 WP_000540981.1.43312 WP_000540981.1.43334 WP_000540981.1.43438 WP_000540981.1.43476 WP_000540981.1.43513 WP_000540981.1.43520 WP_000540981.1.43522 WP_000540981.1.43528 WP_000540981.1.43613 WP_000540981.1.43633 WP_000540981.1.43637 WP_000540981.1.43651 WP_000540981.1.43676 WP_000540981.1.43710 WP_000540981.1.43782 WP_000540981.1.43801 WP_000540981.1.43812 WP_000540981.1.43828 WP_000540981.1.43839 WP_000540981.1.43875 WP_000540981.1.43878 WP_000540981.1.43888 WP_000540981.1.43919 WP_000540981.1.43974 WP_000540981.1.44005 WP_000540981.1.4404 WP_000540981.1.44049 WP_000540981.1.4405 WP_000540981.1.44099 WP_000540981.1.44101 WP_000540981.1.44132 WP_000540981.1.44160 WP_000540981.1.44180 WP_000540981.1.44196 WP_000540981.1.44248 WP_000540981.1.44250 WP_000540981.1.44262 WP_000540981.1.44268 WP_000540981.1.4427 WP_000540981.1.44296 WP_000540981.1.44343 WP_000540981.1.44351 WP_000540981.1.44359 WP_000540981.1.44360 WP_000540981.1.44386 WP_000540981.1.4440 WP_000540981.1.44416 WP_000540981.1.44431 WP_000540981.1.44437 WP_000540981.1.44438 WP_000540981.1.44440 WP_000540981.1.44443 WP_000540981.1.44453 WP_000540981.1.44546 WP_000540981.1.44633 WP_000540981.1.44636 WP_000540981.1.44640 WP_000540981.1.4467 WP_000540981.1.44678 WP_000540981.1.4468 WP_000540981.1.44747 WP_000540981.1.44762 WP_000540981.1.44781 WP_000540981.1.44791 WP_000540981.1.44815 WP_000540981.1.44828 WP_000540981.1.44833 WP_000540981.1.44879 WP_000540981.1.44887 WP_000540981.1.44917 WP_000540981.1.44927 WP_000540981.1.44950 WP_000540981.1.44998 WP_000540981.1.4501 WP_000540981.1.45067 WP_000540981.1.45074 WP_000540981.1.45093 WP_000540981.1.45098 WP_000540981.1.45123 WP_000540981.1.45134 WP_000540981.1.45136 WP_000540981.1.45138 WP_000540981.1.45184 WP_000540981.1.45229 WP_000540981.1.45241 WP_000540981.1.45351 WP_000540981.1.45435 WP_000540981.1.45468 WP_000540981.1.45523 WP_000540981.1.45550 WP_000540981.1.45585 WP_000540981.1.45596 WP_000540981.1.45648 WP_000540981.1.458 WP_000540981.1.45829 WP_000540981.1.45871 WP_000540981.1.46011 WP_000540981.1.46028 WP_000540981.1.46030 WP_000540981.1.46077 WP_000540981.1.46091 WP_000540981.1.46112 WP_000540981.1.46124 WP_000540981.1.46169 WP_000540981.1.46173 WP_000540981.1.46187 WP_000540981.1.46225 WP_000540981.1.46232 WP_000540981.1.46241 WP_000540981.1.46250 WP_000540981.1.46286 WP_000540981.1.46303 WP_000540981.1.46307 WP_000540981.1.46322 WP_000540981.1.46355 WP_000540981.1.46358 WP_000540981.1.464 WP_000540981.1.46406 WP_000540981.1.46444 WP_000540981.1.46461 WP_000540981.1.46504 WP_000540981.1.46505 WP_000540981.1.46551 WP_000540981.1.46574 WP_000540981.1.46637 WP_000540981.1.46666 WP_000540981.1.46675 WP_000540981.1.46701 WP_000540981.1.4671 WP_000540981.1.46730 WP_000540981.1.46732 WP_000540981.1.46781 WP_000540981.1.46816 WP_000540981.1.46842 WP_000540981.1.4690 WP_000540981.1.46920 WP_000540981.1.46945 WP_000540981.1.46961 WP_000540981.1.47036 WP_000540981.1.47037 WP_000540981.1.47042 WP_000540981.1.47059 WP_000540981.1.47085 WP_000540981.1.47123 WP_000540981.1.47215 WP_000540981.1.47245 WP_000540981.1.47429 WP_000540981.1.47448 WP_000540981.1.47460 WP_000540981.1.47472 WP_000540981.1.47478 WP_000540981.1.47523 WP_000540981.1.47531 WP_000540981.1.47532 WP_000540981.1.47605 WP_000540981.1.47614 WP_000540981.1.47621 WP_000540981.1.47630 WP_000540981.1.47649 WP_000540981.1.4769 WP_000540981.1.47714 WP_000540981.1.4774 WP_000540981.1.4775 WP_000540981.1.47756 WP_000540981.1.47767 WP_000540981.1.4781 WP_000540981.1.47814 WP_000540981.1.47849 WP_000540981.1.47886 WP_000540981.1.47898 WP_000540981.1.47928 WP_000540981.1.48019 WP_000540981.1.48100 WP_000540981.1.48114 WP_000540981.1.48139 WP_000540981.1.48190 WP_000540981.1.48209 WP_000540981.1.48215 WP_000540981.1.48242 WP_000540981.1.48244 WP_000540981.1.48253 WP_000540981.1.48292 WP_000540981.1.483 WP_000540981.1.48324 WP_000540981.1.48399 WP_000540981.1.48426 WP_000540981.1.48430 WP_000540981.1.48436 WP_000540981.1.48493 WP_000540981.1.48570 WP_000540981.1.48586 WP_000540981.1.4859 WP_000540981.1.48591 WP_000540981.1.48610 WP_000540981.1.48631 WP_000540981.1.48663 WP_000540981.1.48690 WP_000540981.1.48734 WP_000540981.1.48751 WP_000540981.1.48756 WP_000540981.1.48778 WP_000540981.1.48788 WP_000540981.1.48849 WP_000540981.1.4885 WP_000540981.1.48876 WP_000540981.1.48886 WP_000540981.1.48896 WP_000540981.1.48918 WP_000540981.1.48931 WP_000540981.1.48955 WP_000540981.1.48963 WP_000540981.1.48973 WP_000540981.1.48985 WP_000540981.1.49004 WP_000540981.1.49102 WP_000540981.1.49106 WP_000540981.1.49117 WP_000540981.1.49121 WP_000540981.1.4914 WP_000540981.1.49140 WP_000540981.1.49153 WP_000540981.1.49155 WP_000540981.1.49166 WP_000540981.1.49204 WP_000540981.1.49214 WP_000540981.1.49226 WP_000540981.1.49276 WP_000540981.1.49304 WP_000540981.1.49340 WP_000540981.1.49355 WP_000540981.1.49429 WP_000540981.1.49450 WP_000540981.1.49472 WP_000540981.1.495 WP_000540981.1.49515 WP_000540981.1.49545 WP_000540981.1.49595 WP_000540981.1.49630 WP_000540981.1.49703 WP_000540981.1.49769 WP_000540981.1.49780 WP_000540981.1.49805 WP_000540981.1.49846 WP_000540981.1.4991 WP_000540981.1.49931 WP_000540981.1.49947 WP_000540981.1.49959 WP_000540981.1.49997 WP_000540981.1.50 WP_000540981.1.50003 WP_000540981.1.50007 WP_000540981.1.50014 WP_000540981.1.50030 WP_000540981.1.50043 WP_000540981.1.50080 WP_000540981.1.5009 WP_000540981.1.50103 WP_000540981.1.50158 WP_000540981.1.50211 WP_000540981.1.50247 WP_000540981.1.50308 WP_000540981.1.50309 WP_000540981.1.50376 WP_000540981.1.50387 WP_000540981.1.50389 WP_000540981.1.50406 WP_000540981.1.50468 WP_000540981.1.50469 WP_000540981.1.5051 WP_000540981.1.50563 WP_000540981.1.50566 WP_000540981.1.50570 WP_000540981.1.50626 WP_000540981.1.50771 WP_000540981.1.50875 WP_000540981.1.50885 WP_000540981.1.509 WP_000540981.1.50908 WP_000540981.1.50929 WP_000540981.1.50970 WP_000540981.1.51014 WP_000540981.1.51022 WP_000540981.1.51036 WP_000540981.1.51040 WP_000540981.1.51048 WP_000540981.1.51100 WP_000540981.1.51117 WP_000540981.1.51134 WP_000540981.1.51139 WP_000540981.1.5114 WP_000540981.1.51162 WP_000540981.1.51179 WP_000540981.1.51182 WP_000540981.1.51227 WP_000540981.1.5125 WP_000540981.1.5127 WP_000540981.1.51285 WP_000540981.1.51305 WP_000540981.1.51308 WP_000540981.1.51315 WP_000540981.1.5136 WP_000540981.1.5138 WP_000540981.1.51394 WP_000540981.1.51414 WP_000540981.1.51474 WP_000540981.1.51488 WP_000540981.1.51506 WP_000540981.1.51514 WP_000540981.1.51519 WP_000540981.1.51555 WP_000540981.1.51598 WP_000540981.1.51611 WP_000540981.1.51613 WP_000540981.1.51644 WP_000540981.1.51649 WP_000540981.1.51704 WP_000540981.1.51724 WP_000540981.1.51734 WP_000540981.1.51756 WP_000540981.1.51838 WP_000540981.1.51863 WP_000540981.1.51888 WP_000540981.1.51910 WP_000540981.1.51935 WP_000540981.1.52047 WP_000540981.1.52057 WP_000540981.1.52114 WP_000540981.1.52123 WP_000540981.1.52129 WP_000540981.1.52156 WP_000540981.1.52191 WP_000540981.1.52202 WP_000540981.1.52209 WP_000540981.1.52339 WP_000540981.1.52346 WP_000540981.1.52361 WP_000540981.1.52438 WP_000540981.1.52446 WP_000540981.1.52469 WP_000540981.1.52528 WP_000540981.1.52571 WP_000540981.1.526 WP_000540981.1.52637 WP_000540981.1.52647 WP_000540981.1.52656 WP_000540981.1.52738 WP_000540981.1.52742 WP_000540981.1.52773 WP_000540981.1.52795 WP_000540981.1.52807 WP_000540981.1.52851 WP_000540981.1.52887 WP_000540981.1.52898 WP_000540981.1.52915 WP_000540981.1.53016 WP_000540981.1.53092 WP_000540981.1.53141 WP_000540981.1.53151 WP_000540981.1.53154 WP_000540981.1.53159 WP_000540981.1.53190 WP_000540981.1.53203 WP_000540981.1.53210 WP_000540981.1.53233 WP_000540981.1.53307 WP_000540981.1.53315 WP_000540981.1.53316 WP_000540981.1.53321 WP_000540981.1.5333 WP_000540981.1.53368 WP_000540981.1.53375 WP_000540981.1.53406 WP_000540981.1.53450 WP_000540981.1.53466 WP_000540981.1.5349 WP_000540981.1.53534 WP_000540981.1.53555 WP_000540981.1.53559 WP_000540981.1.5356 WP_000540981.1.53571 WP_000540981.1.5358 WP_000540981.1.53692 WP_000540981.1.53694 WP_000540981.1.5374 WP_000540981.1.53750 WP_000540981.1.53790 WP_000540981.1.53800 WP_000540981.1.53814 WP_000540981.1.53815 WP_000540981.1.53839 WP_000540981.1.53892 WP_000540981.1.53898 WP_000540981.1.53902 WP_000540981.1.5392 WP_000540981.1.53935 WP_000540981.1.53958 WP_000540981.1.53981 WP_000540981.1.53984 WP_000540981.1.54033 WP_000540981.1.54061 WP_000540981.1.54075 WP_000540981.1.54082 WP_000540981.1.54085 WP_000540981.1.54132 WP_000540981.1.5415 WP_000540981.1.54170 WP_000540981.1.54175 WP_000540981.1.54196 WP_000540981.1.54203 WP_000540981.1.54209 WP_000540981.1.54259 WP_000540981.1.54271 WP_000540981.1.54274 WP_000540981.1.5430 WP_000540981.1.54324 WP_000540981.1.54371 WP_000540981.1.54400 WP_000540981.1.54431 WP_000540981.1.54442 WP_000540981.1.54482 WP_000540981.1.54569 WP_000540981.1.54589 WP_000540981.1.54644 WP_000540981.1.54667 WP_000540981.1.54678 WP_000540981.1.54681 WP_000540981.1.54694 WP_000540981.1.54748 WP_000540981.1.54749 WP_000540981.1.5481 WP_000540981.1.54865 WP_000540981.1.54935 WP_000540981.1.54979 WP_000540981.1.55010 WP_000540981.1.55034 WP_000540981.1.55156 WP_000540981.1.55163 WP_000540981.1.55165 WP_000540981.1.55166 WP_000540981.1.5517 WP_000540981.1.55215 WP_000540981.1.55223 WP_000540981.1.55224 WP_000540981.1.55290 WP_000540981.1.55310 WP_000540981.1.55317 WP_000540981.1.55379 WP_000540981.1.5539 WP_000540981.1.55418 WP_000540981.1.55468 WP_000540981.1.55506 WP_000540981.1.5552 WP_000540981.1.55528 WP_000540981.1.55545 WP_000540981.1.55604 WP_000540981.1.55623 WP_000540981.1.55639 WP_000540981.1.55672 WP_000540981.1.55699 WP_000540981.1.55725 WP_000540981.1.55743 WP_000540981.1.55768 WP_000540981.1.55780 WP_000540981.1.55782 WP_000540981.1.55796 WP_000540981.1.55803 WP_000540981.1.55967 WP_000540981.1.55995 WP_000540981.1.56004 WP_000540981.1.56012 WP_000540981.1.56097 WP_000540981.1.56105 WP_000540981.1.56144 WP_000540981.1.56172 WP_000540981.1.5621 WP_000540981.1.56226 WP_000540981.1.56238 WP_000540981.1.56247 WP_000540981.1.56286 WP_000540981.1.56303 WP_000540981.1.56311 WP_000540981.1.5633 WP_000540981.1.56370 WP_000540981.1.56385 WP_000540981.1.56393 WP_000540981.1.56396 WP_000540981.1.56414 WP_000540981.1.56419 WP_000540981.1.56423 WP_000540981.1.56438 WP_000540981.1.56514 WP_000540981.1.56535 WP_000540981.1.56585 WP_000540981.1.56601 WP_000540981.1.56651 WP_000540981.1.56671 WP_000540981.1.56682 WP_000540981.1.56724 WP_000540981.1.56824 WP_000540981.1.56825 WP_000540981.1.56853 WP_000540981.1.56875 WP_000540981.1.56887 WP_000540981.1.56889 WP_000540981.1.56893 WP_000540981.1.56905 WP_000540981.1.56981 WP_000540981.1.57076 WP_000540981.1.57101 WP_000540981.1.57137 WP_000540981.1.57147 WP_000540981.1.57149 WP_000540981.1.57179 WP_000540981.1.57186 WP_000540981.1.57307 WP_000540981.1.57342 WP_000540981.1.57344 WP_000540981.1.57357 WP_000540981.1.57418 WP_000540981.1.57433 WP_000540981.1.57494 WP_000540981.1.57515 WP_000540981.1.57521 WP_000540981.1.57529 WP_000540981.1.57607 WP_000540981.1.57684 WP_000540981.1.57699 WP_000540981.1.57709 WP_000540981.1.57763 WP_000540981.1.57785 WP_000540981.1.57800 WP_000540981.1.57862 WP_000540981.1.57873 WP_000540981.1.57890 WP_000540981.1.57891 WP_000540981.1.57965 WP_000540981.1.57972 WP_000540981.1.57978 WP_000540981.1.58008 WP_000540981.1.5801 WP_000540981.1.58040 WP_000540981.1.58044 WP_000540981.1.58081 WP_000540981.1.5809 WP_000540981.1.58131 WP_000540981.1.58132 WP_000540981.1.58144 WP_000540981.1.58153 WP_000540981.1.58173 WP_000540981.1.58191 WP_000540981.1.58194 WP_000540981.1.58239 WP_000540981.1.58249 WP_000540981.1.58252 WP_000540981.1.58261 WP_000540981.1.58274 WP_000540981.1.58282 WP_000540981.1.58301 WP_000540981.1.58324 WP_000540981.1.58326 WP_000540981.1.5836 WP_000540981.1.58416 WP_000540981.1.58418 WP_000540981.1.5846 WP_000540981.1.58485 WP_000540981.1.58537 WP_000540981.1.58564 WP_000540981.1.58568 WP_000540981.1.58583 WP_000540981.1.58652 WP_000540981.1.58663 WP_000540981.1.58724 WP_000540981.1.58744 WP_000540981.1.58745 WP_000540981.1.5875 WP_000540981.1.58796 WP_000540981.1.58803 WP_000540981.1.58807 WP_000540981.1.58847 WP_000540981.1.5886 WP_000540981.1.58883 WP_000540981.1.58898 WP_000540981.1.58949 WP_000540981.1.58963 WP_000540981.1.58970 WP_000540981.1.58974 WP_000540981.1.59006 WP_000540981.1.59020 WP_000540981.1.59043 WP_000540981.1.59056 WP_000540981.1.59061 WP_000540981.1.59064 WP_000540981.1.59136 WP_000540981.1.59224 WP_000540981.1.59282 WP_000540981.1.5929 WP_000540981.1.59294 WP_000540981.1.59299 WP_000540981.1.59313 WP_000540981.1.59336 WP_000540981.1.59375 WP_000540981.1.59381 WP_000540981.1.59412 WP_000540981.1.59458 WP_000540981.1.5949 WP_000540981.1.59501 WP_000540981.1.59508 WP_000540981.1.59510 WP_000540981.1.59641 WP_000540981.1.59648 WP_000540981.1.5969 WP_000540981.1.59751 WP_000540981.1.59771 WP_000540981.1.5979 WP_000540981.1.59827 WP_000540981.1.59829 WP_000540981.1.59830 WP_000540981.1.59847 WP_000540981.1.59863 WP_000540981.1.59928 WP_000540981.1.5993 WP_000540981.1.59953 WP_000540981.1.59969 WP_000540981.1.59979 WP_000540981.1.59994 WP_000540981.1.60015 WP_000540981.1.60021 WP_000540981.1.60045 WP_000540981.1.60052 WP_000540981.1.60069 WP_000540981.1.60076 WP_000540981.1.60114 WP_000540981.1.60140 WP_000540981.1.60154 WP_000540981.1.60155 WP_000540981.1.60168 WP_000540981.1.60192 WP_000540981.1.60199 WP_000540981.1.60212 WP_000540981.1.60226 WP_000540981.1.60253 WP_000540981.1.60285 WP_000540981.1.60322 WP_000540981.1.60324 WP_000540981.1.60356 WP_000540981.1.60370 WP_000540981.1.6038 WP_000540981.1.60380 WP_000540981.1.6041 WP_000540981.1.60424 WP_000540981.1.60481 WP_000540981.1.605 WP_000540981.1.60503 WP_000540981.1.6058 WP_000540981.1.60584 WP_000540981.1.6060 WP_000540981.1.60622 WP_000540981.1.60661 WP_000540981.1.60676 WP_000540981.1.60708 WP_000540981.1.60725 WP_000540981.1.60746 WP_000540981.1.60760 WP_000540981.1.60783 WP_000540981.1.60792 WP_000540981.1.60807 WP_000540981.1.60838 WP_000540981.1.6086 WP_000540981.1.60863 WP_000540981.1.60874 WP_000540981.1.60882 WP_000540981.1.60889 WP_000540981.1.60919 WP_000540981.1.60941 WP_000540981.1.60950 WP_000540981.1.60976 WP_000540981.1.6104 WP_000540981.1.61044 WP_000540981.1.61076 WP_000540981.1.61078 WP_000540981.1.61123 WP_000540981.1.6114 WP_000540981.1.61147 WP_000540981.1.61168 WP_000540981.1.61210 WP_000540981.1.61232 WP_000540981.1.61233 WP_000540981.1.61296 WP_000540981.1.61345 WP_000540981.1.61357 WP_000540981.1.61511 WP_000540981.1.61519 WP_000540981.1.61539 WP_000540981.1.61542 WP_000540981.1.61553 WP_000540981.1.61574 WP_000540981.1.61582 WP_000540981.1.6164 WP_000540981.1.61649 WP_000540981.1.61652 WP_000540981.1.61662 WP_000540981.1.61697 WP_000540981.1.61714 WP_000540981.1.61732 WP_000540981.1.61743 WP_000540981.1.61809 WP_000540981.1.61857 WP_000540981.1.61877 WP_000540981.1.61918 WP_000540981.1.61920 WP_000540981.1.61922 WP_000540981.1.61952 WP_000540981.1.61968 WP_000540981.1.62025 WP_000540981.1.62076 WP_000540981.1.6210 WP_000540981.1.62120 WP_000540981.1.62122 WP_000540981.1.62124 WP_000540981.1.62144 WP_000540981.1.62199 WP_000540981.1.62204 WP_000540981.1.62219 WP_000540981.1.62223 WP_000540981.1.62241 WP_000540981.1.62302 WP_000540981.1.62314 WP_000540981.1.62323 WP_000540981.1.62333 WP_000540981.1.62338 WP_000540981.1.62380 WP_000540981.1.62404 WP_000540981.1.62411 WP_000540981.1.62436 WP_000540981.1.62475 WP_000540981.1.62486 WP_000540981.1.62522 WP_000540981.1.62536 WP_000540981.1.62640 WP_000540981.1.62686 WP_000540981.1.62693 WP_000540981.1.62751 WP_000540981.1.62798 WP_000540981.1.62825 WP_000540981.1.62853 WP_000540981.1.62910 WP_000540981.1.62913 WP_000540981.1.62932 WP_000540981.1.62955 WP_000540981.1.62960 WP_000540981.1.62976 WP_000540981.1.63016 WP_000540981.1.63025 WP_000540981.1.63043 WP_000540981.1.63069 WP_000540981.1.63087 WP_000540981.1.63118 WP_000540981.1.63135 WP_000540981.1.63155 WP_000540981.1.63169 WP_000540981.1.63181 WP_000540981.1.63234 WP_000540981.1.63243 WP_000540981.1.63250 WP_000540981.1.63256 WP_000540981.1.63290 WP_000540981.1.63297 WP_000540981.1.63448 WP_000540981.1.63455 WP_000540981.1.63461 WP_000540981.1.63479 WP_000540981.1.63514 WP_000540981.1.63532 WP_000540981.1.63568 WP_000540981.1.6357 WP_000540981.1.63577 WP_000540981.1.63583 WP_000540981.1.63592 WP_000540981.1.63663 WP_000540981.1.63664 WP_000540981.1.63690 WP_000540981.1.63731 WP_000540981.1.63736 WP_000540981.1.6375 WP_000540981.1.63757 WP_000540981.1.63816 WP_000540981.1.63824 WP_000540981.1.63831 WP_000540981.1.63860 WP_000540981.1.63866 WP_000540981.1.63876 WP_000540981.1.6389 WP_000540981.1.63901 WP_000540981.1.63912 WP_000540981.1.63934 WP_000540981.1.63955 WP_000540981.1.63958 WP_000540981.1.63963 WP_000540981.1.63977 WP_000540981.1.63992 WP_000540981.1.64007 WP_000540981.1.64032 WP_000540981.1.64072 WP_000540981.1.64087 WP_000540981.1.6415 WP_000540981.1.64208 WP_000540981.1.64217 WP_000540981.1.6423 WP_000540981.1.64242 WP_000540981.1.64244 WP_000540981.1.64266 WP_000540981.1.64293 WP_000540981.1.64332 WP_000540981.1.6437 WP_000540981.1.64374 WP_000540981.1.64376 WP_000540981.1.644 WP_000540981.1.64403 WP_000540981.1.64471 WP_000540981.1.64501 WP_000540981.1.6451 WP_000540981.1.64538 WP_000540981.1.64569 WP_000540981.1.64632 WP_000540981.1.64645 WP_000540981.1.64648 WP_000540981.1.64654 WP_000540981.1.64662 WP_000540981.1.64663 WP_000540981.1.64674 WP_000540981.1.64702 WP_000540981.1.64709 WP_000540981.1.64710 WP_000540981.1.64744 WP_000540981.1.64757 WP_000540981.1.64763 WP_000540981.1.64817 WP_000540981.1.64847 WP_000540981.1.6487 WP_000540981.1.6489 WP_000540981.1.64891 WP_000540981.1.64974 WP_000540981.1.65016 WP_000540981.1.65018 WP_000540981.1.65027 WP_000540981.1.65054 WP_000540981.1.65075 WP_000540981.1.6514 WP_000540981.1.65168 WP_000540981.1.65172 WP_000540981.1.65191 WP_000540981.1.65200 WP_000540981.1.65211 WP_000540981.1.65218 WP_000540981.1.65226 WP_000540981.1.65238 WP_000540981.1.65249 WP_000540981.1.65266 WP_000540981.1.65348 WP_000540981.1.6535 WP_000540981.1.65395 WP_000540981.1.65437 WP_000540981.1.65459 WP_000540981.1.65463 WP_000540981.1.65487 WP_000540981.1.6549 WP_000540981.1.65499 WP_000540981.1.65508 WP_000540981.1.6554 WP_000540981.1.6565 WP_000540981.1.65650 WP_000540981.1.65697 WP_000540981.1.65699 WP_000540981.1.6572 WP_000540981.1.65737 WP_000540981.1.6575 WP_000540981.1.65755 WP_000540981.1.65782 WP_000540981.1.65812 WP_000540981.1.65838 WP_000540981.1.65846 WP_000540981.1.65863 WP_000540981.1.65985 WP_000540981.1.66021 WP_000540981.1.66031 WP_000540981.1.66052 WP_000540981.1.66064 WP_000540981.1.66109 WP_000540981.1.66129 WP_000540981.1.66145 WP_000540981.1.66167 WP_000540981.1.66183 WP_000540981.1.6620 WP_000540981.1.66216 WP_000540981.1.66234 WP_000540981.1.66235 WP_000540981.1.66273 WP_000540981.1.6630 WP_000540981.1.66324 WP_000540981.1.6634 WP_000540981.1.66358 WP_000540981.1.66361 WP_000540981.1.66362 WP_000540981.1.66365 WP_000540981.1.66368 WP_000540981.1.6640 WP_000540981.1.66480 WP_000540981.1.66492 WP_000540981.1.66506 WP_000540981.1.66534 WP_000540981.1.66600 WP_000540981.1.66630 WP_000540981.1.66665 WP_000540981.1.66681 WP_000540981.1.66684 WP_000540981.1.66755 WP_000540981.1.66759 WP_000540981.1.6680 WP_000540981.1.66807 WP_000540981.1.66825 WP_000540981.1.66860 WP_000540981.1.66901 WP_000540981.1.66953 WP_000540981.1.66955 WP_000540981.1.66962 WP_000540981.1.66981 WP_000540981.1.67024 WP_000540981.1.67037 WP_000540981.1.67042 WP_000540981.1.67045 WP_000540981.1.67101 WP_000540981.1.67143 WP_000540981.1.67184 WP_000540981.1.67201 WP_000540981.1.67211 WP_000540981.1.67237 WP_000540981.1.67268 WP_000540981.1.67288 WP_000540981.1.67336 WP_000540981.1.67339 WP_000540981.1.67347 WP_000540981.1.67374 WP_000540981.1.67387 WP_000540981.1.67394 WP_000540981.1.67397 WP_000540981.1.67403 WP_000540981.1.67430 WP_000540981.1.67442 WP_000540981.1.67465 WP_000540981.1.67539 WP_000540981.1.67552 WP_000540981.1.67556 WP_000540981.1.67576 WP_000540981.1.67604 WP_000540981.1.67617 WP_000540981.1.67619 WP_000540981.1.67625 WP_000540981.1.67627 WP_000540981.1.67633 WP_000540981.1.67641 WP_000540981.1.67657 WP_000540981.1.67673 WP_000540981.1.67682 WP_000540981.1.67700 WP_000540981.1.67707 WP_000540981.1.67718 WP_000540981.1.67729 WP_000540981.1.67774 WP_000540981.1.67814 WP_000540981.1.67820 WP_000540981.1.67829 WP_000540981.1.6785 WP_000540981.1.67887 WP_000540981.1.67924 WP_000540981.1.67954 WP_000540981.1.67969 WP_000540981.1.68 WP_000540981.1.68036 WP_000540981.1.68043 WP_000540981.1.68073 WP_000540981.1.68105 WP_000540981.1.68113 WP_000540981.1.68131 WP_000540981.1.68147 WP_000540981.1.68182 WP_000540981.1.6819 WP_000540981.1.68275 WP_000540981.1.68285 WP_000540981.1.6833 WP_000540981.1.68359 WP_000540981.1.68420 WP_000540981.1.6849 WP_000540981.1.685 WP_000540981.1.68514 WP_000540981.1.68532 WP_000540981.1.68564 WP_000540981.1.6857 WP_000540981.1.68656 WP_000540981.1.68658 WP_000540981.1.68688 WP_000540981.1.6869 WP_000540981.1.68742 WP_000540981.1.68770 WP_000540981.1.68809 WP_000540981.1.68816 WP_000540981.1.68818 WP_000540981.1.6882 WP_000540981.1.68894 WP_000540981.1.68914 WP_000540981.1.68966 WP_000540981.1.68999 WP_000540981.1.69006 WP_000540981.1.69029 WP_000540981.1.69053 WP_000540981.1.6907 WP_000540981.1.69146 WP_000540981.1.69170 WP_000540981.1.69210 WP_000540981.1.69255 WP_000540981.1.69270 WP_000540981.1.69282 WP_000540981.1.69288 WP_000540981.1.69296 WP_000540981.1.69320 WP_000540981.1.69376 WP_000540981.1.69396 WP_000540981.1.69397 WP_000540981.1.69466 WP_000540981.1.69554 WP_000540981.1.69564 WP_000540981.1.69611 WP_000540981.1.69636 WP_000540981.1.69642 WP_000540981.1.69656 WP_000540981.1.69657 WP_000540981.1.69690 WP_000540981.1.69696 WP_000540981.1.69704 WP_000540981.1.69710 WP_000540981.1.69754 WP_000540981.1.69760 WP_000540981.1.69785 WP_000540981.1.69787 WP_000540981.1.69790 WP_000540981.1.69807 WP_000540981.1.69923 WP_000540981.1.69948 WP_000540981.1.69953 WP_000540981.1.69977 WP_000540981.1.70003 WP_000540981.1.70010 WP_000540981.1.70028 WP_000540981.1.70047 WP_000540981.1.70049 WP_000540981.1.70058 WP_000540981.1.70061 WP_000540981.1.7014 WP_000540981.1.70169 WP_000540981.1.70205 WP_000540981.1.7021 WP_000540981.1.70240 WP_000540981.1.70248 WP_000540981.1.70249 WP_000540981.1.70261 WP_000540981.1.70289 WP_000540981.1.70314 WP_000540981.1.70321 WP_000540981.1.70326 WP_000540981.1.70327 WP_000540981.1.7033 WP_000540981.1.70427 WP_000540981.1.70433 WP_000540981.1.70447 WP_000540981.1.70485 WP_000540981.1.70491 WP_000540981.1.70523 WP_000540981.1.70545 WP_000540981.1.70547 WP_000540981.1.70623 WP_000540981.1.70644 WP_000540981.1.70679 WP_000540981.1.70683 WP_000540981.1.70708 WP_000540981.1.70717 WP_000540981.1.70731 WP_000540981.1.70733 WP_000540981.1.70761 WP_000540981.1.70772 WP_000540981.1.70797 WP_000540981.1.70845 WP_000540981.1.70846 WP_000540981.1.70883 WP_000540981.1.70899 WP_000540981.1.70914 WP_000540981.1.70922 WP_000540981.1.70981 WP_000540981.1.70995 WP_000540981.1.71039 WP_000540981.1.71057 WP_000540981.1.71081 WP_000540981.1.7110 WP_000540981.1.71116 WP_000540981.1.71117 WP_000540981.1.71146 WP_000540981.1.71165 WP_000540981.1.71186 WP_000540981.1.71188 WP_000540981.1.71202 WP_000540981.1.71243 WP_000540981.1.71248 WP_000540981.1.71268 WP_000540981.1.71337 WP_000540981.1.714 WP_000540981.1.71446 WP_000540981.1.71452 WP_000540981.1.71455 WP_000540981.1.71456 WP_000540981.1.71481 WP_000540981.1.71487 WP_000540981.1.71500 WP_000540981.1.71523 WP_000540981.1.71542 WP_000540981.1.71566 WP_000540981.1.71640 WP_000540981.1.71651 WP_000540981.1.71653 WP_000540981.1.71702 WP_000540981.1.71716 WP_000540981.1.7174 WP_000540981.1.71756 WP_000540981.1.71845 WP_000540981.1.71872 WP_000540981.1.71881 WP_000540981.1.71923 WP_000540981.1.71929 WP_000540981.1.71950 WP_000540981.1.71954 WP_000540981.1.71985 WP_000540981.1.72003 WP_000540981.1.72065 WP_000540981.1.72073 WP_000540981.1.72105 WP_000540981.1.72119 WP_000540981.1.72203 WP_000540981.1.72226 WP_000540981.1.72234 WP_000540981.1.72243 WP_000540981.1.72269 WP_000540981.1.72283 WP_000540981.1.72307 WP_000540981.1.72350 WP_000540981.1.72376 WP_000540981.1.72382 WP_000540981.1.72383 WP_000540981.1.7243 WP_000540981.1.72461 WP_000540981.1.72527 WP_000540981.1.7255 WP_000540981.1.72629 WP_000540981.1.72631 WP_000540981.1.72638 WP_000540981.1.72667 WP_000540981.1.72674 WP_000540981.1.72689 WP_000540981.1.72724 WP_000540981.1.72789 WP_000540981.1.72793 WP_000540981.1.72827 WP_000540981.1.72828 WP_000540981.1.72850 WP_000540981.1.72871 WP_000540981.1.72872 WP_000540981.1.72896 WP_000540981.1.72897 WP_000540981.1.72944 WP_000540981.1.72969 WP_000540981.1.72987 WP_000540981.1.73052 WP_000540981.1.7311 WP_000540981.1.73114 WP_000540981.1.73144 WP_000540981.1.7315 WP_000540981.1.73177 WP_000540981.1.73180 WP_000540981.1.73200 WP_000540981.1.73258 WP_000540981.1.73270 WP_000540981.1.73285 WP_000540981.1.7332 WP_000540981.1.73328 WP_000540981.1.7333 WP_000540981.1.7334 WP_000540981.1.73352 WP_000540981.1.73377 WP_000540981.1.73389 WP_000540981.1.73425 WP_000540981.1.73481 WP_000540981.1.73488 WP_000540981.1.73504 WP_000540981.1.7353 WP_000540981.1.73544 WP_000540981.1.73581 WP_000540981.1.73598 WP_000540981.1.7361 WP_000540981.1.73648 WP_000540981.1.7374 WP_000540981.1.73753 WP_000540981.1.73768 WP_000540981.1.73794 WP_000540981.1.73804 WP_000540981.1.73831 WP_000540981.1.73849 WP_000540981.1.7387 WP_000540981.1.73924 WP_000540981.1.73948 WP_000540981.1.73999 WP_000540981.1.74024 WP_000540981.1.74028 WP_000540981.1.74029 WP_000540981.1.74030 WP_000540981.1.74038 WP_000540981.1.74043 WP_000540981.1.74058 WP_000540981.1.74070 WP_000540981.1.74077 WP_000540981.1.74089 WP_000540981.1.74117 WP_000540981.1.74135 WP_000540981.1.74191 WP_000540981.1.74214 WP_000540981.1.74285 WP_000540981.1.7430 WP_000540981.1.74317 WP_000540981.1.7433 WP_000540981.1.74379 WP_000540981.1.74410 WP_000540981.1.74414 WP_000540981.1.74415 WP_000540981.1.74422 WP_000540981.1.7444 WP_000540981.1.74454 WP_000540981.1.74466 WP_000540981.1.74481 WP_000540981.1.74529 WP_000540981.1.74616 WP_000540981.1.74621 WP_000540981.1.74647 WP_000540981.1.74677 WP_000540981.1.74699 WP_000540981.1.74745 WP_000540981.1.74831 WP_000540981.1.74884 WP_000540981.1.74894 WP_000540981.1.74929 WP_000540981.1.74939 WP_000540981.1.74946 WP_000540981.1.74973 WP_000540981.1.74992 WP_000540981.1.74996 WP_000540981.1.7507 WP_000540981.1.75089 WP_000540981.1.75116 WP_000540981.1.75129 WP_000540981.1.75187 WP_000540981.1.75237 WP_000540981.1.75273 WP_000540981.1.75288 WP_000540981.1.75296 WP_000540981.1.75301 WP_000540981.1.75362 WP_000540981.1.75392 WP_000540981.1.75402 WP_000540981.1.75413 WP_000540981.1.75433 WP_000540981.1.75532 WP_000540981.1.75565 WP_000540981.1.75593 WP_000540981.1.75610 WP_000540981.1.75633 WP_000540981.1.75718 WP_000540981.1.75740 WP_000540981.1.75745 WP_000540981.1.75764 WP_000540981.1.75793 WP_000540981.1.75828 WP_000540981.1.75837 WP_000540981.1.75844 WP_000540981.1.75886 WP_000540981.1.75898 WP_000540981.1.75932 WP_000540981.1.75945 WP_000540981.1.75957 WP_000540981.1.76 WP_000540981.1.76055 WP_000540981.1.76081 WP_000540981.1.76097 WP_000540981.1.76116 WP_000540981.1.76164 WP_000540981.1.76208 WP_000540981.1.76252 WP_000540981.1.76256 WP_000540981.1.76301 WP_000540981.1.76339 WP_000540981.1.76364 WP_000540981.1.76366 WP_000540981.1.76417 WP_000540981.1.76434 WP_000540981.1.7646 WP_000540981.1.76510 WP_000540981.1.76558 WP_000540981.1.76572 WP_000540981.1.7660 WP_000540981.1.76641 WP_000540981.1.76651 WP_000540981.1.76653 WP_000540981.1.76673 WP_000540981.1.76706 WP_000540981.1.76724 WP_000540981.1.76738 WP_000540981.1.76756 WP_000540981.1.76788 WP_000540981.1.76799 WP_000540981.1.76806 WP_000540981.1.7684 WP_000540981.1.76854 WP_000540981.1.76866 WP_000540981.1.76880 WP_000540981.1.76916 WP_000540981.1.76932 WP_000540981.1.76973 WP_000540981.1.76988 WP_000540981.1.77016 WP_000540981.1.77017 WP_000540981.1.77047 WP_000540981.1.77080 WP_000540981.1.77087 WP_000540981.1.77090 WP_000540981.1.77111 WP_000540981.1.7712 WP_000540981.1.77193 WP_000540981.1.77241 WP_000540981.1.77271 WP_000540981.1.77299 WP_000540981.1.77349 WP_000540981.1.77384 WP_000540981.1.77431 WP_000540981.1.77440 WP_000540981.1.77501 WP_000540981.1.77512 WP_000540981.1.77513 WP_000540981.1.77529 WP_000540981.1.77543 WP_000540981.1.77555 WP_000540981.1.77563 WP_000540981.1.77629 WP_000540981.1.77692 WP_000540981.1.77702 WP_000540981.1.77713 WP_000540981.1.7772 WP_000540981.1.7782 WP_000540981.1.77825 WP_000540981.1.77837 WP_000540981.1.77851 WP_000540981.1.77871 WP_000540981.1.77898 WP_000540981.1.77900 WP_000540981.1.77918 WP_000540981.1.77923 WP_000540981.1.77960 WP_000540981.1.77971 WP_000540981.1.77975 WP_000540981.1.77987 WP_000540981.1.78 WP_000540981.1.78033 WP_000540981.1.78035 WP_000540981.1.78048 WP_000540981.1.78107 WP_000540981.1.78110 WP_000540981.1.78120 WP_000540981.1.7814 WP_000540981.1.78166 WP_000540981.1.78170 WP_000540981.1.78192 WP_000540981.1.78195 WP_000540981.1.78201 WP_000540981.1.78245 WP_000540981.1.78259 WP_000540981.1.78291 WP_000540981.1.78309 WP_000540981.1.78320 WP_000540981.1.78382 WP_000540981.1.78388 WP_000540981.1.78407 WP_000540981.1.78410 WP_000540981.1.78602 WP_000540981.1.7861 WP_000540981.1.78618 WP_000540981.1.7862 WP_000540981.1.78626 WP_000540981.1.78661 WP_000540981.1.78673 WP_000540981.1.78674 WP_000540981.1.78676 WP_000540981.1.78715 WP_000540981.1.78735 WP_000540981.1.78761 WP_000540981.1.78835 WP_000540981.1.78862 WP_000540981.1.78871 WP_000540981.1.78874 WP_000540981.1.78881 WP_000540981.1.789 WP_000540981.1.7891 WP_000540981.1.78993 WP_000540981.1.79012 WP_000540981.1.79032 WP_000540981.1.79069 WP_000540981.1.79074 WP_000540981.1.79081 WP_000540981.1.79098 WP_000540981.1.79151 WP_000540981.1.79155 WP_000540981.1.79164 WP_000540981.1.79167 WP_000540981.1.79204 WP_000540981.1.79280 WP_000540981.1.79297 WP_000540981.1.79302 WP_000540981.1.79335 WP_000540981.1.79397 WP_000540981.1.794 WP_000540981.1.79456 WP_000540981.1.79472 WP_000540981.1.79490 WP_000540981.1.79495 WP_000540981.1.79532 WP_000540981.1.79547 WP_000540981.1.79570 WP_000540981.1.79654 WP_000540981.1.79659 WP_000540981.1.7970 WP_000540981.1.79708 WP_000540981.1.7972 WP_000540981.1.79722 WP_000540981.1.79738 WP_000540981.1.79772 WP_000540981.1.79832 WP_000540981.1.79845 WP_000540981.1.79880 WP_000540981.1.79916 WP_000540981.1.7994 WP_000540981.1.79945 WP_000540981.1.79951 WP_000540981.1.79966 WP_000540981.1.79974 WP_000540981.1.79996 WP_000540981.1.80065 WP_000540981.1.80077 WP_000540981.1.80103 WP_000540981.1.80137 WP_000540981.1.80182 WP_000540981.1.80236 WP_000540981.1.80273 WP_000540981.1.80282 WP_000540981.1.80354 WP_000540981.1.80368 WP_000540981.1.80386 WP_000540981.1.80441 WP_000540981.1.80448 WP_000540981.1.80462 WP_000540981.1.80473 WP_000540981.1.8049 WP_000540981.1.80492 WP_000540981.1.80529 WP_000540981.1.80569 WP_000540981.1.80586 WP_000540981.1.80638 WP_000540981.1.80664 WP_000540981.1.80667 WP_000540981.1.80674 WP_000540981.1.80696 WP_000540981.1.80750 WP_000540981.1.80757 WP_000540981.1.80780 WP_000540981.1.80819 WP_000540981.1.80831 WP_000540981.1.80850 WP_000540981.1.80927 WP_000540981.1.80939 WP_000540981.1.80984 WP_000540981.1.81037 WP_000540981.1.81067 WP_000540981.1.81131 WP_000540981.1.81187 WP_000540981.1.81193 WP_000540981.1.81231 WP_000540981.1.81262 WP_000540981.1.81268 WP_000540981.1.81269 WP_000540981.1.81271 WP_000540981.1.8131 WP_000540981.1.81321 WP_000540981.1.81333 WP_000540981.1.81342 WP_000540981.1.81364 WP_000540981.1.81404 WP_000540981.1.81409 WP_000540981.1.81494 WP_000540981.1.81548 WP_000540981.1.81557 WP_000540981.1.81667 WP_000540981.1.81676 WP_000540981.1.8168 WP_000540981.1.81681 WP_000540981.1.8170 WP_000540981.1.81736 WP_000540981.1.81743 WP_000540981.1.81746 WP_000540981.1.81750 WP_000540981.1.81760 WP_000540981.1.81763 WP_000540981.1.81785 WP_000540981.1.81855 WP_000540981.1.81902 WP_000540981.1.81921 WP_000540981.1.81931 WP_000540981.1.81936 WP_000540981.1.81941 WP_000540981.1.81949 WP_000540981.1.81974 WP_000540981.1.82070 WP_000540981.1.82076 WP_000540981.1.82099 WP_000540981.1.82156 WP_000540981.1.8218 WP_000540981.1.82201 WP_000540981.1.82214 WP_000540981.1.82225 WP_000540981.1.82258 WP_000540981.1.82337 WP_000540981.1.8236 WP_000540981.1.82369 WP_000540981.1.82395 WP_000540981.1.8240 WP_000540981.1.82408 WP_000540981.1.82416 WP_000540981.1.8242 WP_000540981.1.82456 WP_000540981.1.82465 WP_000540981.1.82473 WP_000540981.1.82479 WP_000540981.1.82515 WP_000540981.1.82553 WP_000540981.1.82584 WP_000540981.1.82636 WP_000540981.1.82646 WP_000540981.1.82670 WP_000540981.1.82676 WP_000540981.1.82731 WP_000540981.1.82761 WP_000540981.1.82812 WP_000540981.1.8282 WP_000540981.1.82841 WP_000540981.1.82850 WP_000540981.1.82872 WP_000540981.1.82895 WP_000540981.1.82908 WP_000540981.1.82937 WP_000540981.1.8294 WP_000540981.1.82944 WP_000540981.1.82956 WP_000540981.1.82959 WP_000540981.1.82964 WP_000540981.1.82992 WP_000540981.1.83007 WP_000540981.1.8304 WP_000540981.1.83061 WP_000540981.1.83092 WP_000540981.1.83119 WP_000540981.1.83128 WP_000540981.1.83163 WP_000540981.1.83180 WP_000540981.1.83221 WP_000540981.1.83229 WP_000540981.1.83235 WP_000540981.1.83252 WP_000540981.1.83258 WP_000540981.1.83290 WP_000540981.1.83305 WP_000540981.1.83333 WP_000540981.1.83413 WP_000540981.1.83523 WP_000540981.1.8354 WP_000540981.1.83650 WP_000540981.1.83651 WP_000540981.1.83657 WP_000540981.1.83677 WP_000540981.1.83721 WP_000540981.1.83739 WP_000540981.1.8375 WP_000540981.1.83759 WP_000540981.1.83854 WP_000540981.1.83897 WP_000540981.1.83923 WP_000540981.1.83960 WP_000540981.1.83979 WP_000540981.1.83994 WP_000540981.1.84 WP_000540981.1.8406 WP_000540981.1.84076 WP_000540981.1.84077 WP_000540981.1.84103 WP_000540981.1.84110 WP_000540981.1.84127 WP_000540981.1.84150 WP_000540981.1.84209 WP_000540981.1.84230 WP_000540981.1.84252 WP_000540981.1.8431 WP_000540981.1.84345 WP_000540981.1.84355 WP_000540981.1.84369 WP_000540981.1.84373 WP_000540981.1.84392 WP_000540981.1.84401 WP_000540981.1.84435 WP_000540981.1.84459 WP_000540981.1.84554 WP_000540981.1.84567 WP_000540981.1.84631 WP_000540981.1.84644 WP_000540981.1.84659 WP_000540981.1.84683 WP_000540981.1.84727 WP_000540981.1.84744 WP_000540981.1.84773 WP_000540981.1.84945 WP_000540981.1.84967 WP_000540981.1.85004 WP_000540981.1.8502 WP_000540981.1.85039 WP_000540981.1.85040 WP_000540981.1.85094 WP_000540981.1.85120 WP_000540981.1.85134 WP_000540981.1.85153 WP_000540981.1.85178 WP_000540981.1.85180 WP_000540981.1.85190 WP_000540981.1.85217 WP_000540981.1.85273 WP_000540981.1.8533 WP_000540981.1.85338 WP_000540981.1.85339 WP_000540981.1.8537 WP_000540981.1.85408 WP_000540981.1.85433 WP_000540981.1.8545 WP_000540981.1.85456 WP_000540981.1.85481 WP_000540981.1.85483 WP_000540981.1.85511 WP_000540981.1.85512 WP_000540981.1.8552 WP_000540981.1.85541 WP_000540981.1.8557 WP_000540981.1.85606 WP_000540981.1.85615 WP_000540981.1.85617 WP_000540981.1.85635 WP_000540981.1.85646 WP_000540981.1.85665 WP_000540981.1.85669 WP_000540981.1.85672 WP_000540981.1.85688 WP_000540981.1.85703 WP_000540981.1.85728 WP_000540981.1.85746 WP_000540981.1.85777 WP_000540981.1.85780 WP_000540981.1.85811 WP_000540981.1.859 WP_000540981.1.85900 WP_000540981.1.85917 WP_000540981.1.8594 WP_000540981.1.85976 WP_000540981.1.85977 WP_000540981.1.860 WP_000540981.1.8605 WP_000540981.1.86084 WP_000540981.1.8610 WP_000540981.1.8614 WP_000540981.1.86156 WP_000540981.1.86224 WP_000540981.1.86284 WP_000540981.1.86285 WP_000540981.1.86323 WP_000540981.1.86335 WP_000540981.1.86342 WP_000540981.1.8640 WP_000540981.1.8642 WP_000540981.1.86426 WP_000540981.1.86453 WP_000540981.1.86489 WP_000540981.1.86530 WP_000540981.1.86580 WP_000540981.1.86593 WP_000540981.1.86601 WP_000540981.1.86656 WP_000540981.1.86663 WP_000540981.1.86699 WP_000540981.1.8672 WP_000540981.1.86744 WP_000540981.1.86770 WP_000540981.1.8678 WP_000540981.1.86794 WP_000540981.1.86800 WP_000540981.1.86810 WP_000540981.1.86811 WP_000540981.1.86815 WP_000540981.1.8684 WP_000540981.1.86895 WP_000540981.1.86902 WP_000540981.1.86906 WP_000540981.1.8691 WP_000540981.1.86945 WP_000540981.1.86982 WP_000540981.1.86989 WP_000540981.1.87023 WP_000540981.1.87034 WP_000540981.1.87041 WP_000540981.1.87051 WP_000540981.1.87095 WP_000540981.1.87136 WP_000540981.1.87143 WP_000540981.1.87148 WP_000540981.1.87155 WP_000540981.1.87258 WP_000540981.1.87282 WP_000540981.1.87283 WP_000540981.1.87346 WP_000540981.1.87365 WP_000540981.1.87370 WP_000540981.1.87420 WP_000540981.1.87460 WP_000540981.1.87493 WP_000540981.1.87528 WP_000540981.1.87552 WP_000540981.1.87560 WP_000540981.1.87584 WP_000540981.1.8760 WP_000540981.1.87600 WP_000540981.1.87609 WP_000540981.1.87612 WP_000540981.1.87615 WP_000540981.1.87653 WP_000540981.1.87659 WP_000540981.1.8767 WP_000540981.1.87698 WP_000540981.1.87706 WP_000540981.1.87739 WP_000540981.1.87741 WP_000540981.1.87742 WP_000540981.1.87779 WP_000540981.1.87852 WP_000540981.1.87875 WP_000540981.1.87945 WP_000540981.1.87949 WP_000540981.1.87999 WP_000540981.1.88019 WP_000540981.1.88025 WP_000540981.1.8805 WP_000540981.1.8806 WP_000540981.1.88073 WP_000540981.1.881 WP_000540981.1.88145 WP_000540981.1.88199 WP_000540981.1.88214 WP_000540981.1.88264 WP_000540981.1.88299 WP_000540981.1.88303 WP_000540981.1.88313 WP_000540981.1.88359 WP_000540981.1.8837 WP_000540981.1.88393 WP_000540981.1.88407 WP_000540981.1.88414 WP_000540981.1.88444 WP_000540981.1.88446 WP_000540981.1.88458 WP_000540981.1.8849 WP_000540981.1.88501 WP_000540981.1.88538 WP_000540981.1.88547 WP_000540981.1.886 WP_000540981.1.88609 WP_000540981.1.88620 WP_000540981.1.88624 WP_000540981.1.88647 WP_000540981.1.88648 WP_000540981.1.88683 WP_000540981.1.88692 WP_000540981.1.88707 WP_000540981.1.88727 WP_000540981.1.88772 WP_000540981.1.88792 WP_000540981.1.88850 WP_000540981.1.8889 WP_000540981.1.88892 WP_000540981.1.88894 WP_000540981.1.88967 WP_000540981.1.88970 WP_000540981.1.88981 WP_000540981.1.89008 WP_000540981.1.89174 WP_000540981.1.89182 WP_000540981.1.89291 WP_000540981.1.89298 WP_000540981.1.89304 WP_000540981.1.89308 WP_000540981.1.89314 WP_000540981.1.89328 WP_000540981.1.89332 WP_000540981.1.89343 WP_000540981.1.89395 WP_000540981.1.8940 WP_000540981.1.89449 WP_000540981.1.89452 WP_000540981.1.8947 WP_000540981.1.89503 WP_000540981.1.89512 WP_000540981.1.89570 WP_000540981.1.89591 WP_000540981.1.89604 WP_000540981.1.89612 WP_000540981.1.89622 WP_000540981.1.89647 WP_000540981.1.89659 WP_000540981.1.89668 WP_000540981.1.89706 WP_000540981.1.89713 WP_000540981.1.89733 WP_000540981.1.89777 WP_000540981.1.89789 WP_000540981.1.89796 WP_000540981.1.89804 WP_000540981.1.89815 WP_000540981.1.89845 WP_000540981.1.89870 WP_000540981.1.89888 WP_000540981.1.89902 WP_000540981.1.89911 WP_000540981.1.8995 WP_000540981.1.89952 WP_000540981.1.89965 WP_000540981.1.90007 WP_000540981.1.90097 WP_000540981.1.9011 WP_000540981.1.90196 WP_000540981.1.90252 WP_000540981.1.90274 WP_000540981.1.90280 WP_000540981.1.90330 WP_000540981.1.90338 WP_000540981.1.90365 WP_000540981.1.90417 WP_000540981.1.90428 WP_000540981.1.90440 WP_000540981.1.90458 WP_000540981.1.90472 WP_000540981.1.90489 WP_000540981.1.90513 WP_000540981.1.90557 WP_000540981.1.90582 WP_000540981.1.90585 WP_000540981.1.90620 WP_000540981.1.9064 WP_000540981.1.90713 WP_000540981.1.90734 WP_000540981.1.90792 WP_000540981.1.90794 WP_000540981.1.90796 WP_000540981.1.90811 WP_000540981.1.90814 WP_000540981.1.90866 WP_000540981.1.90876 WP_000540981.1.9091 WP_000540981.1.9093 WP_000540981.1.90984 WP_000540981.1.91003 WP_000540981.1.91067 WP_000540981.1.91069 WP_000540981.1.91156 WP_000540981.1.91189 WP_000540981.1.91205 WP_000540981.1.91239 WP_000540981.1.91291 WP_000540981.1.91313 WP_000540981.1.9135 WP_000540981.1.91453 WP_000540981.1.91470 WP_000540981.1.91506 WP_000540981.1.91524 WP_000540981.1.91557 WP_000540981.1.91564 WP_000540981.1.91579 WP_000540981.1.91597 WP_000540981.1.91628 WP_000540981.1.91655 WP_000540981.1.91715 WP_000540981.1.91864 WP_000540981.1.9187 WP_000540981.1.91870 WP_000540981.1.91903 WP_000540981.1.92018 WP_000540981.1.92047 WP_000540981.1.92087 WP_000540981.1.92098 WP_000540981.1.92099 WP_000540981.1.92108 WP_000540981.1.92122 WP_000540981.1.92156 WP_000540981.1.92172 WP_000540981.1.92183 WP_000540981.1.92208 WP_000540981.1.92240 WP_000540981.1.92243 WP_000540981.1.92268 WP_000540981.1.92327 WP_000540981.1.92394 WP_000540981.1.92408 WP_000540981.1.92439 WP_000540981.1.92443 WP_000540981.1.92470 WP_000540981.1.92477 WP_000540981.1.92482 WP_000540981.1.92545 WP_000540981.1.92562 WP_000540981.1.92570 WP_000540981.1.92588 WP_000540981.1.926 WP_000540981.1.92633 WP_000540981.1.92649 WP_000540981.1.92669 WP_000540981.1.92671 WP_000540981.1.92676 WP_000540981.1.92705 WP_000540981.1.9271 WP_000540981.1.92729 WP_000540981.1.92734 WP_000540981.1.92738 WP_000540981.1.92810 WP_000540981.1.92823 WP_000540981.1.92827 WP_000540981.1.92832 WP_000540981.1.92975 WP_000540981.1.92987 WP_000540981.1.93007 WP_000540981.1.93022 WP_000540981.1.93086 WP_000540981.1.93101 WP_000540981.1.93105 WP_000540981.1.93111 WP_000540981.1.93121 WP_000540981.1.93136 WP_000540981.1.93155 WP_000540981.1.93168 WP_000540981.1.93221 WP_000540981.1.93223 WP_000540981.1.93239 WP_000540981.1.93302 WP_000540981.1.93322 WP_000540981.1.9336 WP_000540981.1.93365 WP_000540981.1.93387 WP_000540981.1.93469 WP_000540981.1.93511 WP_000540981.1.93512 WP_000540981.1.93596 WP_000540981.1.93604 WP_000540981.1.93635 WP_000540981.1.93650 WP_000540981.1.93656 WP_000540981.1.93657 WP_000540981.1.93705 WP_000540981.1.9374 WP_000540981.1.93741 WP_000540981.1.9375 WP_000540981.1.93754 WP_000540981.1.93761 WP_000540981.1.93780 WP_000540981.1.93803 WP_000540981.1.93828 WP_000540981.1.93837 WP_000540981.1.93842 WP_000540981.1.93843 WP_000540981.1.93875 WP_000540981.1.93909 WP_000540981.1.93919 WP_000540981.1.93938 WP_000540981.1.93984 WP_000540981.1.9399 WP_000540981.1.94017 WP_000540981.1.94070 WP_000540981.1.94072 WP_000540981.1.94079 WP_000540981.1.94107 WP_000540981.1.94142 WP_000540981.1.94162 WP_000540981.1.94215 WP_000540981.1.94303 WP_000540981.1.9432 WP_000540981.1.94352 WP_000540981.1.94365 WP_000540981.1.94383 WP_000540981.1.94390 WP_000540981.1.94415 WP_000540981.1.94458 WP_000540981.1.94492 WP_000540981.1.94510 WP_000540981.1.94527 WP_000540981.1.94565 WP_000540981.1.94573 WP_000540981.1.94579 WP_000540981.1.94584 WP_000540981.1.94586 WP_000540981.1.94593 WP_000540981.1.94622 WP_000540981.1.94650 WP_000540981.1.94659 WP_000540981.1.94662 WP_000540981.1.94700 WP_000540981.1.94717 WP_000540981.1.94745 WP_000540981.1.94782 WP_000540981.1.94796 WP_000540981.1.94798 WP_000540981.1.9481 WP_000540981.1.94815 WP_000540981.1.94820 WP_000540981.1.94849 WP_000540981.1.94850 WP_000540981.1.94851 WP_000540981.1.94864 WP_000540981.1.94952 WP_000540981.1.94959 WP_000540981.1.95006 WP_000540981.1.95051 WP_000540981.1.95055 WP_000540981.1.95076 WP_000540981.1.95094 WP_000540981.1.95099 WP_000540981.1.95121 WP_000540981.1.9516 WP_000540981.1.95165 WP_000540981.1.95239 WP_000540981.1.95246 WP_000540981.1.95249 WP_000540981.1.9525 WP_000540981.1.95255 WP_000540981.1.95265 WP_000540981.1.95289 WP_000540981.1.95338 WP_000540981.1.95412 WP_000540981.1.95546 WP_000540981.1.95547 WP_000540981.1.95579 WP_000540981.1.95590 WP_000540981.1.95623 WP_000540981.1.95625 WP_000540981.1.95630 WP_000540981.1.95675 WP_000540981.1.95703 WP_000540981.1.95716 WP_000540981.1.95729 WP_000540981.1.9574 WP_000540981.1.95776 WP_000540981.1.95805 WP_000540981.1.95840 WP_000540981.1.95884 WP_000540981.1.95890 WP_000540981.1.95906 WP_000540981.1.96025 WP_000540981.1.96042 WP_000540981.1.96044 WP_000540981.1.96054 WP_000540981.1.9609 WP_000540981.1.96094 WP_000540981.1.96127 WP_000540981.1.96139 WP_000540981.1.96141 WP_000540981.1.96144 WP_000540981.1.96172 WP_000540981.1.96188 WP_000540981.1.96203 WP_000540981.1.96211 WP_000540981.1.96212 WP_000540981.1.96260 WP_000540981.1.96319 WP_000540981.1.9633 WP_000540981.1.96335 WP_000540981.1.96343 WP_000540981.1.96359 WP_000540981.1.96500 WP_000540981.1.96539 WP_000540981.1.96552 WP_000540981.1.96563 WP_000540981.1.96610 WP_000540981.1.96625 WP_000540981.1.96635 WP_000540981.1.9664 WP_000540981.1.96640 WP_000540981.1.96642 WP_000540981.1.96675 WP_000540981.1.9670 WP_000540981.1.96732 WP_000540981.1.96750 WP_000540981.1.96792 WP_000540981.1.96798 WP_000540981.1.96801 WP_000540981.1.96803 WP_000540981.1.96925 WP_000540981.1.96938 WP_000540981.1.96946 WP_000540981.1.96957 WP_000540981.1.96978 WP_000540981.1.97015 WP_000540981.1.97026 WP_000540981.1.97028 WP_000540981.1.97043 WP_000540981.1.97079 WP_000540981.1.97109 WP_000540981.1.97145 WP_000540981.1.97154 WP_000540981.1.97184 WP_000540981.1.97185 WP_000540981.1.97190 WP_000540981.1.97260 WP_000540981.1.97287 WP_000540981.1.97291 WP_000540981.1.97369 WP_000540981.1.97422 WP_000540981.1.97441 WP_000540981.1.97497 WP_000540981.1.97505 WP_000540981.1.97594 WP_000540981.1.97597 WP_000540981.1.97599 WP_000540981.1.97606 WP_000540981.1.97615 WP_000540981.1.97628 WP_000540981.1.97640 WP_000540981.1.97646 WP_000540981.1.97690 WP_000540981.1.97693 WP_000540981.1.97726 WP_000540981.1.97727 WP_000540981.1.97732 WP_000540981.1.97736 WP_000540981.1.97768 WP_000540981.1.97819 WP_000540981.1.97840 WP_000540981.1.97938 WP_000540981.1.97986 WP_000540981.1.98006 WP_000540981.1.98019 WP_000540981.1.98036 WP_000540981.1.98080 WP_000540981.1.98086 WP_000540981.1.98110 WP_000540981.1.98124 WP_000540981.1.98146 WP_000540981.1.98158 WP_000540981.1.98219 WP_000540981.1.98263 WP_000540981.1.98418 WP_000540981.1.98438 WP_000540981.1.98448 WP_000540981.1.98457 WP_000540981.1.98495 WP_000540981.1.9850 WP_000540981.1.98513 WP_000540981.1.98551 WP_000540981.1.98577 WP_000540981.1.98607 WP_000540981.1.9863 WP_000540981.1.98634 WP_000540981.1.98676 WP_000540981.1.98677 WP_000540981.1.98731 WP_000540981.1.98760 WP_000540981.1.98762 WP_000540981.1.9877 WP_000540981.1.98801 WP_000540981.1.98818 WP_000540981.1.98899 WP_000540981.1.98947 WP_000540981.1.9898 WP_000540981.1.99040 WP_000540981.1.99072 WP_000540981.1.99098 WP_000540981.1.99107 WP_000540981.1.99163 WP_000540981.1.99219 WP_000540981.1.99255 WP_000540981.1.99267 WP_000540981.1.99278 WP_000540981.1.99327 WP_000540981.1.99335 WP_000540981.1.99350 WP_000540981.1.99360 WP_000540981.1.99363 WP_000540981.1.99369 WP_000540981.1.99388 WP_000540981.1.99397 WP_000540981.1.99463 WP_000540981.1.99483 WP_000540981.1.99546 WP_000540981.1.99561 WP_000540981.1.99579 WP_000540981.1.99595 WP_000540981.1.99671 WP_000540981.1.99676 WP_000540981.1.99712 WP_000540981.1.99725 WP_000540981.1.99747 WP_000540981.1.99764 WP_000540981.1.99813 WP_000540981.1.99837 WP_000540981.1.99841 WP_000540981.1.99996 gi|378444026|ref|YP_005231658.1| gi|197249789|ref|YP_002145509.1| APC22979 gi|16759501|ref|NP_455118.1| gi|526219409|ref|YP_008264778.1| gi|16763906|ref|NP_459521.1| gi|549723236|ref|YP_008643426.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]