SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378448906|ref|YP_005236265.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378448906|ref|YP_005236265.1|
Domain Number 1 Region: 229-279
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000282
Family AraC type transcriptional activator 0.015
Further Details:      
 
Domain Number 2 Region: 37-90
Classification Level Classification E-value
Superfamily RmlC-like cupins 0.00000116
Family TM1287-like 0.072
Further Details:      
 
Domain Number 3 Region: 176-224
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000125
Family AraC type transcriptional activator 0.097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|378448906|ref|YP_005236265.1|
Sequence length 284
Comment putative transcriptional regulator [Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S]
Sequence
MDALSRLLTLNAPQGSIDKNCPLGGDWQLPHAAGELSVIRWHTVTQGEAQLEMPTGDAMT
LTPGKVVILPQNSAHRLRQSGESPTHIVCGSLRLHTTSRYFLTALPEVLCLAPPPHSPAS
IWINATILLLQQESERHLPGADVLYSQQCATLFTLAVRDWLSQAGTAKSVLNLLLHPRLG
RVILHMLETPAHPWTVETLAQRVHMSRASFAQLFRDVSATTPLAVLTTLRLQIAAQTLSR
EVLPVMVIAESVGYASESSFHKAFVREFGCTPGEYRKRVSALGR
Download sequence
Identical sequences A0A0D6H7R6 A0A0F6AY47 A0A0F7J4K8 A0A0H3NDX5 A0A0T9VY25 A0A0W3KXA9 A0A249V1C8 A0A265B7B3 A0A2D3AM73 A0A2H9YMP9 E8X934 Q8ZR57
454169.SeHA_C0674 99287.STM0563 gi|383495363|ref|YP_005396052.1| gi|550899997|ref|YP_008669089.1| gi|378444057|ref|YP_005231689.1| gi|525816496|ref|YP_008246514.1| gi|482904851|ref|YP_007903411.1| gi|378698516|ref|YP_005180473.1| gi|525839007|ref|YP_008256197.1| gi|378983166|ref|YP_005246321.1| gi|378448906|ref|YP_005236265.1| APC24334 NP_459555.1.58477 WP_000339633.1.100010 WP_000339633.1.100234 WP_000339633.1.100258 WP_000339633.1.100376 WP_000339633.1.100424 WP_000339633.1.100436 WP_000339633.1.100484 WP_000339633.1.100488 WP_000339633.1.100597 WP_000339633.1.100730 WP_000339633.1.10076 WP_000339633.1.100781 WP_000339633.1.100793 WP_000339633.1.100869 WP_000339633.1.100871 WP_000339633.1.100882 WP_000339633.1.101007 WP_000339633.1.101020 WP_000339633.1.101074 WP_000339633.1.101078 WP_000339633.1.101180 WP_000339633.1.101259 WP_000339633.1.101284 WP_000339633.1.101291 WP_000339633.1.1013 WP_000339633.1.101320 WP_000339633.1.101353 WP_000339633.1.101386 WP_000339633.1.101404 WP_000339633.1.101420 WP_000339633.1.101589 WP_000339633.1.101707 WP_000339633.1.101734 WP_000339633.1.101878 WP_000339633.1.101953 WP_000339633.1.10220 WP_000339633.1.10231 WP_000339633.1.10266 WP_000339633.1.10429 WP_000339633.1.10439 WP_000339633.1.10566 WP_000339633.1.10678 WP_000339633.1.10753 WP_000339633.1.10992 WP_000339633.1.11000 WP_000339633.1.11024 WP_000339633.1.11031 WP_000339633.1.11098 WP_000339633.1.1110 WP_000339633.1.11156 WP_000339633.1.11168 WP_000339633.1.11190 WP_000339633.1.11295 WP_000339633.1.11455 WP_000339633.1.11458 WP_000339633.1.11518 WP_000339633.1.11532 WP_000339633.1.11543 WP_000339633.1.11588 WP_000339633.1.11677 WP_000339633.1.11687 WP_000339633.1.11735 WP_000339633.1.11763 WP_000339633.1.11772 WP_000339633.1.11834 WP_000339633.1.11897 WP_000339633.1.12017 WP_000339633.1.12025 WP_000339633.1.12114 WP_000339633.1.12351 WP_000339633.1.12370 WP_000339633.1.12546 WP_000339633.1.1264 WP_000339633.1.12728 WP_000339633.1.12879 WP_000339633.1.12936 WP_000339633.1.12995 WP_000339633.1.13027 WP_000339633.1.13106 WP_000339633.1.13130 WP_000339633.1.13207 WP_000339633.1.13334 WP_000339633.1.13414 WP_000339633.1.13488 WP_000339633.1.13509 WP_000339633.1.13661 WP_000339633.1.13669 WP_000339633.1.13741 WP_000339633.1.1387 WP_000339633.1.13908 WP_000339633.1.13932 WP_000339633.1.13968 WP_000339633.1.14001 WP_000339633.1.14151 WP_000339633.1.14239 WP_000339633.1.14320 WP_000339633.1.14379 WP_000339633.1.14406 WP_000339633.1.14410 WP_000339633.1.14436 WP_000339633.1.14458 WP_000339633.1.14466 WP_000339633.1.14524 WP_000339633.1.14554 WP_000339633.1.14618 WP_000339633.1.14725 WP_000339633.1.14852 WP_000339633.1.14932 WP_000339633.1.15055 WP_000339633.1.15079 WP_000339633.1.15124 WP_000339633.1.15223 WP_000339633.1.15226 WP_000339633.1.15316 WP_000339633.1.15369 WP_000339633.1.1540 WP_000339633.1.15508 WP_000339633.1.15784 WP_000339633.1.15830 WP_000339633.1.15862 WP_000339633.1.15909 WP_000339633.1.15910 WP_000339633.1.15986 WP_000339633.1.16004 WP_000339633.1.16047 WP_000339633.1.16062 WP_000339633.1.16063 WP_000339633.1.16103 WP_000339633.1.16226 WP_000339633.1.16233 WP_000339633.1.16284 WP_000339633.1.16328 WP_000339633.1.1635 WP_000339633.1.16361 WP_000339633.1.16468 WP_000339633.1.16525 WP_000339633.1.16614 WP_000339633.1.16650 WP_000339633.1.16686 WP_000339633.1.16691 WP_000339633.1.167 WP_000339633.1.16732 WP_000339633.1.16735 WP_000339633.1.16786 WP_000339633.1.16858 WP_000339633.1.16873 WP_000339633.1.16896 WP_000339633.1.16903 WP_000339633.1.16916 WP_000339633.1.16965 WP_000339633.1.1700 WP_000339633.1.17093 WP_000339633.1.17307 WP_000339633.1.174 WP_000339633.1.17480 WP_000339633.1.17546 WP_000339633.1.17702 WP_000339633.1.17705 WP_000339633.1.17743 WP_000339633.1.17747 WP_000339633.1.17891 WP_000339633.1.1798 WP_000339633.1.18019 WP_000339633.1.18111 WP_000339633.1.18122 WP_000339633.1.18163 WP_000339633.1.1818 WP_000339633.1.18254 WP_000339633.1.18265 WP_000339633.1.18267 WP_000339633.1.18282 WP_000339633.1.18468 WP_000339633.1.18607 WP_000339633.1.18705 WP_000339633.1.18715 WP_000339633.1.18776 WP_000339633.1.18822 WP_000339633.1.18881 WP_000339633.1.18940 WP_000339633.1.18949 WP_000339633.1.19053 WP_000339633.1.19273 WP_000339633.1.19320 WP_000339633.1.19458 WP_000339633.1.19460 WP_000339633.1.19461 WP_000339633.1.19588 WP_000339633.1.19614 WP_000339633.1.19616 WP_000339633.1.19642 WP_000339633.1.19702 WP_000339633.1.19706 WP_000339633.1.19724 WP_000339633.1.19749 WP_000339633.1.19784 WP_000339633.1.19793 WP_000339633.1.19809 WP_000339633.1.19867 WP_000339633.1.19975 WP_000339633.1.1998 WP_000339633.1.20 WP_000339633.1.2010 WP_000339633.1.20212 WP_000339633.1.20266 WP_000339633.1.20271 WP_000339633.1.20330 WP_000339633.1.20362 WP_000339633.1.20418 WP_000339633.1.20443 WP_000339633.1.20446 WP_000339633.1.20525 WP_000339633.1.2054 WP_000339633.1.20553 WP_000339633.1.20614 WP_000339633.1.20626 WP_000339633.1.20646 WP_000339633.1.20886 WP_000339633.1.20908 WP_000339633.1.21049 WP_000339633.1.21136 WP_000339633.1.21146 WP_000339633.1.21245 WP_000339633.1.21246 WP_000339633.1.21269 WP_000339633.1.21351 WP_000339633.1.21400 WP_000339633.1.21497 WP_000339633.1.21499 WP_000339633.1.21548 WP_000339633.1.21603 WP_000339633.1.21751 WP_000339633.1.21757 WP_000339633.1.21991 WP_000339633.1.22024 WP_000339633.1.2205 WP_000339633.1.22062 WP_000339633.1.22067 WP_000339633.1.2221 WP_000339633.1.22235 WP_000339633.1.2235 WP_000339633.1.22379 WP_000339633.1.22427 WP_000339633.1.2246 WP_000339633.1.22485 WP_000339633.1.22537 WP_000339633.1.22620 WP_000339633.1.22692 WP_000339633.1.22758 WP_000339633.1.22864 WP_000339633.1.22870 WP_000339633.1.22979 WP_000339633.1.23102 WP_000339633.1.23114 WP_000339633.1.2314 WP_000339633.1.23192 WP_000339633.1.23259 WP_000339633.1.23379 WP_000339633.1.23460 WP_000339633.1.23472 WP_000339633.1.23482 WP_000339633.1.23509 WP_000339633.1.23634 WP_000339633.1.2364 WP_000339633.1.23932 WP_000339633.1.23959 WP_000339633.1.24017 WP_000339633.1.24082 WP_000339633.1.24206 WP_000339633.1.24308 WP_000339633.1.24578 WP_000339633.1.24737 WP_000339633.1.24779 WP_000339633.1.25008 WP_000339633.1.25015 WP_000339633.1.25119 WP_000339633.1.25206 WP_000339633.1.25405 WP_000339633.1.25454 WP_000339633.1.25493 WP_000339633.1.25668 WP_000339633.1.25690 WP_000339633.1.2570 WP_000339633.1.25740 WP_000339633.1.25793 WP_000339633.1.25814 WP_000339633.1.25988 WP_000339633.1.26282 WP_000339633.1.26311 WP_000339633.1.26319 WP_000339633.1.26429 WP_000339633.1.26440 WP_000339633.1.26493 WP_000339633.1.26551 WP_000339633.1.26567 WP_000339633.1.26741 WP_000339633.1.26919 WP_000339633.1.27010 WP_000339633.1.27084 WP_000339633.1.27206 WP_000339633.1.27223 WP_000339633.1.27423 WP_000339633.1.27544 WP_000339633.1.27561 WP_000339633.1.2763 WP_000339633.1.27665 WP_000339633.1.27707 WP_000339633.1.27761 WP_000339633.1.2777 WP_000339633.1.27857 WP_000339633.1.27977 WP_000339633.1.28032 WP_000339633.1.28094 WP_000339633.1.28126 WP_000339633.1.28170 WP_000339633.1.28302 WP_000339633.1.2835 WP_000339633.1.28370 WP_000339633.1.28538 WP_000339633.1.28575 WP_000339633.1.28625 WP_000339633.1.28655 WP_000339633.1.28694 WP_000339633.1.2879 WP_000339633.1.2890 WP_000339633.1.28938 WP_000339633.1.28946 WP_000339633.1.29006 WP_000339633.1.29010 WP_000339633.1.2910 WP_000339633.1.29113 WP_000339633.1.29509 WP_000339633.1.29588 WP_000339633.1.29601 WP_000339633.1.29606 WP_000339633.1.29615 WP_000339633.1.29619 WP_000339633.1.29704 WP_000339633.1.29827 WP_000339633.1.29969 WP_000339633.1.29990 WP_000339633.1.30006 WP_000339633.1.30022 WP_000339633.1.30027 WP_000339633.1.30180 WP_000339633.1.30202 WP_000339633.1.30469 WP_000339633.1.30505 WP_000339633.1.30507 WP_000339633.1.30535 WP_000339633.1.30547 WP_000339633.1.30794 WP_000339633.1.30833 WP_000339633.1.30835 WP_000339633.1.30972 WP_000339633.1.31 WP_000339633.1.31092 WP_000339633.1.31122 WP_000339633.1.3113 WP_000339633.1.31185 WP_000339633.1.3119 WP_000339633.1.31190 WP_000339633.1.31195 WP_000339633.1.31196 WP_000339633.1.31219 WP_000339633.1.31281 WP_000339633.1.31362 WP_000339633.1.31451 WP_000339633.1.31504 WP_000339633.1.31515 WP_000339633.1.31578 WP_000339633.1.31658 WP_000339633.1.31940 WP_000339633.1.31967 WP_000339633.1.31972 WP_000339633.1.32192 WP_000339633.1.32206 WP_000339633.1.32260 WP_000339633.1.32438 WP_000339633.1.32515 WP_000339633.1.32527 WP_000339633.1.32660 WP_000339633.1.32702 WP_000339633.1.32714 WP_000339633.1.32786 WP_000339633.1.32804 WP_000339633.1.32860 WP_000339633.1.32907 WP_000339633.1.33030 WP_000339633.1.33127 WP_000339633.1.33143 WP_000339633.1.33248 WP_000339633.1.33261 WP_000339633.1.333 WP_000339633.1.33553 WP_000339633.1.33580 WP_000339633.1.33592 WP_000339633.1.33825 WP_000339633.1.33894 WP_000339633.1.3394 WP_000339633.1.34043 WP_000339633.1.34075 WP_000339633.1.34257 WP_000339633.1.34279 WP_000339633.1.34319 WP_000339633.1.34417 WP_000339633.1.34453 WP_000339633.1.34610 WP_000339633.1.34856 WP_000339633.1.34975 WP_000339633.1.34977 WP_000339633.1.35045 WP_000339633.1.35129 WP_000339633.1.35184 WP_000339633.1.35193 WP_000339633.1.35404 WP_000339633.1.35408 WP_000339633.1.35425 WP_000339633.1.35429 WP_000339633.1.35446 WP_000339633.1.35463 WP_000339633.1.35503 WP_000339633.1.35509 WP_000339633.1.35590 WP_000339633.1.35892 WP_000339633.1.35940 WP_000339633.1.36003 WP_000339633.1.3601 WP_000339633.1.36017 WP_000339633.1.36547 WP_000339633.1.36609 WP_000339633.1.36690 WP_000339633.1.3670 WP_000339633.1.36705 WP_000339633.1.36918 WP_000339633.1.36931 WP_000339633.1.37063 WP_000339633.1.37073 WP_000339633.1.37111 WP_000339633.1.37112 WP_000339633.1.37256 WP_000339633.1.37293 WP_000339633.1.37370 WP_000339633.1.37376 WP_000339633.1.3744 WP_000339633.1.37498 WP_000339633.1.37504 WP_000339633.1.37618 WP_000339633.1.37687 WP_000339633.1.37968 WP_000339633.1.37978 WP_000339633.1.38125 WP_000339633.1.38145 WP_000339633.1.383 WP_000339633.1.3848 WP_000339633.1.38569 WP_000339633.1.38613 WP_000339633.1.38673 WP_000339633.1.3869 WP_000339633.1.38693 WP_000339633.1.38773 WP_000339633.1.38781 WP_000339633.1.38882 WP_000339633.1.38913 WP_000339633.1.39003 WP_000339633.1.39136 WP_000339633.1.39197 WP_000339633.1.39229 WP_000339633.1.39265 WP_000339633.1.39405 WP_000339633.1.39420 WP_000339633.1.39449 WP_000339633.1.39512 WP_000339633.1.39556 WP_000339633.1.39584 WP_000339633.1.39629 WP_000339633.1.39724 WP_000339633.1.39763 WP_000339633.1.39862 WP_000339633.1.39921 WP_000339633.1.39923 WP_000339633.1.40017 WP_000339633.1.40072 WP_000339633.1.40073 WP_000339633.1.4011 WP_000339633.1.40208 WP_000339633.1.40240 WP_000339633.1.40257 WP_000339633.1.40292 WP_000339633.1.40305 WP_000339633.1.40311 WP_000339633.1.40341 WP_000339633.1.40380 WP_000339633.1.40395 WP_000339633.1.40465 WP_000339633.1.40508 WP_000339633.1.40710 WP_000339633.1.4075 WP_000339633.1.4087 WP_000339633.1.40877 WP_000339633.1.40996 WP_000339633.1.41017 WP_000339633.1.41018 WP_000339633.1.41086 WP_000339633.1.41091 WP_000339633.1.41226 WP_000339633.1.41279 WP_000339633.1.41516 WP_000339633.1.41554 WP_000339633.1.41572 WP_000339633.1.41591 WP_000339633.1.41662 WP_000339633.1.41708 WP_000339633.1.41761 WP_000339633.1.41859 WP_000339633.1.41882 WP_000339633.1.41979 WP_000339633.1.41985 WP_000339633.1.42104 WP_000339633.1.42156 WP_000339633.1.4222 WP_000339633.1.42243 WP_000339633.1.42320 WP_000339633.1.42342 WP_000339633.1.42422 WP_000339633.1.42444 WP_000339633.1.42676 WP_000339633.1.4276 WP_000339633.1.42864 WP_000339633.1.4288 WP_000339633.1.43018 WP_000339633.1.43041 WP_000339633.1.43077 WP_000339633.1.43244 WP_000339633.1.43312 WP_000339633.1.43334 WP_000339633.1.43339 WP_000339633.1.43351 WP_000339633.1.43371 WP_000339633.1.43437 WP_000339633.1.43522 WP_000339633.1.43613 WP_000339633.1.43668 WP_000339633.1.43778 WP_000339633.1.43886 WP_000339633.1.43951 WP_000339633.1.44005 WP_000339633.1.44043 WP_000339633.1.44099 WP_000339633.1.44121 WP_000339633.1.44291 WP_000339633.1.44300 WP_000339633.1.44310 WP_000339633.1.44433 WP_000339633.1.44479 WP_000339633.1.44640 WP_000339633.1.4467 WP_000339633.1.44747 WP_000339633.1.4485 WP_000339633.1.44877 WP_000339633.1.44927 WP_000339633.1.44933 WP_000339633.1.44971 WP_000339633.1.45067 WP_000339633.1.45074 WP_000339633.1.45079 WP_000339633.1.45098 WP_000339633.1.45145 WP_000339633.1.45177 WP_000339633.1.45184 WP_000339633.1.45259 WP_000339633.1.45344 WP_000339633.1.45349 WP_000339633.1.45365 WP_000339633.1.45434 WP_000339633.1.45550 WP_000339633.1.45582 WP_000339633.1.45585 WP_000339633.1.45622 WP_000339633.1.45660 WP_000339633.1.45690 WP_000339633.1.45797 WP_000339633.1.458 WP_000339633.1.45848 WP_000339633.1.46011 WP_000339633.1.46069 WP_000339633.1.46112 WP_000339633.1.46173 WP_000339633.1.46174 WP_000339633.1.46187 WP_000339633.1.46278 WP_000339633.1.46303 WP_000339633.1.46434 WP_000339633.1.46595 WP_000339633.1.46675 WP_000339633.1.46930 WP_000339633.1.47008 WP_000339633.1.47057 WP_000339633.1.47214 WP_000339633.1.47429 WP_000339633.1.47448 WP_000339633.1.4747 WP_000339633.1.47472 WP_000339633.1.47478 WP_000339633.1.47579 WP_000339633.1.47621 WP_000339633.1.47799 WP_000339633.1.47928 WP_000339633.1.48242 WP_000339633.1.48253 WP_000339633.1.483 WP_000339633.1.48367 WP_000339633.1.48377 WP_000339633.1.4853 WP_000339633.1.48788 WP_000339633.1.4885 WP_000339633.1.48894 WP_000339633.1.48919 WP_000339633.1.49084 WP_000339633.1.49113 WP_000339633.1.49155 WP_000339633.1.49204 WP_000339633.1.49239 WP_000339633.1.49256 WP_000339633.1.49290 WP_000339633.1.49340 WP_000339633.1.49366 WP_000339633.1.49490 WP_000339633.1.49515 WP_000339633.1.49572 WP_000339633.1.49686 WP_000339633.1.4979 WP_000339633.1.49803 WP_000339633.1.49805 WP_000339633.1.49929 WP_000339633.1.50080 WP_000339633.1.50161 WP_000339633.1.50211 WP_000339633.1.50376 WP_000339633.1.50389 WP_000339633.1.50404 WP_000339633.1.50676 WP_000339633.1.50774 WP_000339633.1.50804 WP_000339633.1.50808 WP_000339633.1.5088 WP_000339633.1.50908 WP_000339633.1.50941 WP_000339633.1.50999 WP_000339633.1.51014 WP_000339633.1.51022 WP_000339633.1.51066 WP_000339633.1.51179 WP_000339633.1.51182 WP_000339633.1.51186 WP_000339633.1.51224 WP_000339633.1.51487 WP_000339633.1.51488 WP_000339633.1.51634 WP_000339633.1.51649 WP_000339633.1.51686 WP_000339633.1.51756 WP_000339633.1.51831 WP_000339633.1.51911 WP_000339633.1.51932 WP_000339633.1.51989 WP_000339633.1.52121 WP_000339633.1.52148 WP_000339633.1.52170 WP_000339633.1.52336 WP_000339633.1.52346 WP_000339633.1.52353 WP_000339633.1.52361 WP_000339633.1.52653 WP_000339633.1.52656 WP_000339633.1.52692 WP_000339633.1.52743 WP_000339633.1.52857 WP_000339633.1.52866 WP_000339633.1.52898 WP_000339633.1.52915 WP_000339633.1.52949 WP_000339633.1.52985 WP_000339633.1.53190 WP_000339633.1.53272 WP_000339633.1.53406 WP_000339633.1.53436 WP_000339633.1.53466 WP_000339633.1.53529 WP_000339633.1.53543 WP_000339633.1.53757 WP_000339633.1.53812 WP_000339633.1.53905 WP_000339633.1.54033 WP_000339633.1.54075 WP_000339633.1.54196 WP_000339633.1.542 WP_000339633.1.54209 WP_000339633.1.54271 WP_000339633.1.54273 WP_000339633.1.54274 WP_000339633.1.54319 WP_000339633.1.54364 WP_000339633.1.54400 WP_000339633.1.54526 WP_000339633.1.54644 WP_000339633.1.54662 WP_000339633.1.54722 WP_000339633.1.54749 WP_000339633.1.54764 WP_000339633.1.55008 WP_000339633.1.55152 WP_000339633.1.55156 WP_000339633.1.55285 WP_000339633.1.55325 WP_000339633.1.55430 WP_000339633.1.55475 WP_000339633.1.5560 WP_000339633.1.55647 WP_000339633.1.55743 WP_000339633.1.55768 WP_000339633.1.55782 WP_000339633.1.55796 WP_000339633.1.55973 WP_000339633.1.55993 WP_000339633.1.56002 WP_000339633.1.56012 WP_000339633.1.56105 WP_000339633.1.56238 WP_000339633.1.56244 WP_000339633.1.56286 WP_000339633.1.56304 WP_000339633.1.56414 WP_000339633.1.56438 WP_000339633.1.56559 WP_000339633.1.56560 WP_000339633.1.56597 WP_000339633.1.56601 WP_000339633.1.56614 WP_000339633.1.56660 WP_000339633.1.56671 WP_000339633.1.56682 WP_000339633.1.56875 WP_000339633.1.56877 WP_000339633.1.57168 WP_000339633.1.57187 WP_000339633.1.57232 WP_000339633.1.57356 WP_000339633.1.57377 WP_000339633.1.57433 WP_000339633.1.57515 WP_000339633.1.57529 WP_000339633.1.57576 WP_000339633.1.57601 WP_000339633.1.57607 WP_000339633.1.57763 WP_000339633.1.57862 WP_000339633.1.57890 WP_000339633.1.57891 WP_000339633.1.57978 WP_000339633.1.5801 WP_000339633.1.58041 WP_000339633.1.58358 WP_000339633.1.58407 WP_000339633.1.58418 WP_000339633.1.5854 WP_000339633.1.58548 WP_000339633.1.5858 WP_000339633.1.58662 WP_000339633.1.58669 WP_000339633.1.58745 WP_000339633.1.58803 WP_000339633.1.5886 WP_000339633.1.59094 WP_000339633.1.59224 WP_000339633.1.59321 WP_000339633.1.59375 WP_000339633.1.59420 WP_000339633.1.59458 WP_000339633.1.59490 WP_000339633.1.59508 WP_000339633.1.5953 WP_000339633.1.59684 WP_000339633.1.59694 WP_000339633.1.59771 WP_000339633.1.5979 WP_000339633.1.59953 WP_000339633.1.60008 WP_000339633.1.60021 WP_000339633.1.60052 WP_000339633.1.60069 WP_000339633.1.60140 WP_000339633.1.60155 WP_000339633.1.60285 WP_000339633.1.60379 WP_000339633.1.60464 WP_000339633.1.60545 WP_000339633.1.60561 WP_000339633.1.60772 WP_000339633.1.60874 WP_000339633.1.60941 WP_000339633.1.61078 WP_000339633.1.6114 WP_000339633.1.61232 WP_000339633.1.6129 WP_000339633.1.61296 WP_000339633.1.61345 WP_000339633.1.61417 WP_000339633.1.61574 WP_000339633.1.61609 WP_000339633.1.61712 WP_000339633.1.61714 WP_000339633.1.61730 WP_000339633.1.61857 WP_000339633.1.61918 WP_000339633.1.61952 WP_000339633.1.62007 WP_000339633.1.62020 WP_000339633.1.62025 WP_000339633.1.6209 WP_000339633.1.62204 WP_000339633.1.62257 WP_000339633.1.62304 WP_000339633.1.62364 WP_000339633.1.62374 WP_000339633.1.62403 WP_000339633.1.6253 WP_000339633.1.62570 WP_000339633.1.62853 WP_000339633.1.62903 WP_000339633.1.62910 WP_000339633.1.62955 WP_000339633.1.63063 WP_000339633.1.63181 WP_000339633.1.63256 WP_000339633.1.63290 WP_000339633.1.63382 WP_000339633.1.63432 WP_000339633.1.63461 WP_000339633.1.63479 WP_000339633.1.63577 WP_000339633.1.63664 WP_000339633.1.63718 WP_000339633.1.6375 WP_000339633.1.63757 WP_000339633.1.63797 WP_000339633.1.63834 WP_000339633.1.64018 WP_000339633.1.64046 WP_000339633.1.6423 WP_000339633.1.64244 WP_000339633.1.64387 WP_000339633.1.64403 WP_000339633.1.64649 WP_000339633.1.64702 WP_000339633.1.64757 WP_000339633.1.64781 WP_000339633.1.64831 WP_000339633.1.6489 WP_000339633.1.64894 WP_000339633.1.65018 WP_000339633.1.65028 WP_000339633.1.65171 WP_000339633.1.65248 WP_000339633.1.65269 WP_000339633.1.6535 WP_000339633.1.65474 WP_000339633.1.65572 WP_000339633.1.65633 WP_000339633.1.6565 WP_000339633.1.65696 WP_000339633.1.6575 WP_000339633.1.65782 WP_000339633.1.65940 WP_000339633.1.65956 WP_000339633.1.66049 WP_000339633.1.6630 WP_000339633.1.66314 WP_000339633.1.66330 WP_000339633.1.66358 WP_000339633.1.66362 WP_000339633.1.6638 WP_000339633.1.6640 WP_000339633.1.66600 WP_000339633.1.66678 WP_000339633.1.66698 WP_000339633.1.6680 WP_000339633.1.66834 WP_000339633.1.66901 WP_000339633.1.66962 WP_000339633.1.67037 WP_000339633.1.67045 WP_000339633.1.67100 WP_000339633.1.67181 WP_000339633.1.67235 WP_000339633.1.67268 WP_000339633.1.67347 WP_000339633.1.6739 WP_000339633.1.67465 WP_000339633.1.67552 WP_000339633.1.67682 WP_000339633.1.67829 WP_000339633.1.67887 WP_000339633.1.68073 WP_000339633.1.68201 WP_000339633.1.68206 WP_000339633.1.6827 WP_000339633.1.68275 WP_000339633.1.68401 WP_000339633.1.68477 WP_000339633.1.6849 WP_000339633.1.68547 WP_000339633.1.68589 WP_000339633.1.68655 WP_000339633.1.68656 WP_000339633.1.68778 WP_000339633.1.68787 WP_000339633.1.68894 WP_000339633.1.68928 WP_000339633.1.68975 WP_000339633.1.69001 WP_000339633.1.69006 WP_000339633.1.6904 WP_000339633.1.6913 WP_000339633.1.69146 WP_000339633.1.69151 WP_000339633.1.69255 WP_000339633.1.69359 WP_000339633.1.69397 WP_000339633.1.6954 WP_000339633.1.69564 WP_000339633.1.69644 WP_000339633.1.69704 WP_000339633.1.69754 WP_000339633.1.69758 WP_000339633.1.7021 WP_000339633.1.70241 WP_000339633.1.70269 WP_000339633.1.70289 WP_000339633.1.70447 WP_000339633.1.70485 WP_000339633.1.70643 WP_000339633.1.70683 WP_000339633.1.70883 WP_000339633.1.70922 WP_000339633.1.70948 WP_000339633.1.70959 WP_000339633.1.71023 WP_000339633.1.71116 WP_000339633.1.71146 WP_000339633.1.71165 WP_000339633.1.71188 WP_000339633.1.71202 WP_000339633.1.71243 WP_000339633.1.71306 WP_000339633.1.71337 WP_000339633.1.71363 WP_000339633.1.71378 WP_000339633.1.71401 WP_000339633.1.71481 WP_000339633.1.71636 WP_000339633.1.71691 WP_000339633.1.71702 WP_000339633.1.71750 WP_000339633.1.71798 WP_000339633.1.71845 WP_000339633.1.71881 WP_000339633.1.71908 WP_000339633.1.71952 WP_000339633.1.71973 WP_000339633.1.72105 WP_000339633.1.72203 WP_000339633.1.72372 WP_000339633.1.72376 WP_000339633.1.72403 WP_000339633.1.72594 WP_000339633.1.72728 WP_000339633.1.72871 WP_000339633.1.72975 WP_000339633.1.73062 WP_000339633.1.73125 WP_000339633.1.7315 WP_000339633.1.73200 WP_000339633.1.7334 WP_000339633.1.73377 WP_000339633.1.73461 WP_000339633.1.73481 WP_000339633.1.7356 WP_000339633.1.73561 WP_000339633.1.73581 WP_000339633.1.73617 WP_000339633.1.73667 WP_000339633.1.73753 WP_000339633.1.73758 WP_000339633.1.73794 WP_000339633.1.73847 WP_000339633.1.7387 WP_000339633.1.73924 WP_000339633.1.73926 WP_000339633.1.74029 WP_000339633.1.74181 WP_000339633.1.74191 WP_000339633.1.7433 WP_000339633.1.74379 WP_000339633.1.74410 WP_000339633.1.74466 WP_000339633.1.745 WP_000339633.1.74529 WP_000339633.1.74545 WP_000339633.1.74745 WP_000339633.1.7491 WP_000339633.1.75129 WP_000339633.1.75187 WP_000339633.1.75288 WP_000339633.1.75334 WP_000339633.1.75362 WP_000339633.1.75385 WP_000339633.1.75392 WP_000339633.1.75760 WP_000339633.1.75764 WP_000339633.1.75828 WP_000339633.1.75837 WP_000339633.1.75874 WP_000339633.1.75945 WP_000339633.1.76020 WP_000339633.1.76252 WP_000339633.1.76327 WP_000339633.1.76445 WP_000339633.1.7660 WP_000339633.1.76673 WP_000339633.1.76706 WP_000339633.1.76721 WP_000339633.1.76756 WP_000339633.1.76760 WP_000339633.1.76875 WP_000339633.1.76880 WP_000339633.1.76899 WP_000339633.1.77038 WP_000339633.1.77047 WP_000339633.1.77080 WP_000339633.1.7712 WP_000339633.1.77177 WP_000339633.1.77180 WP_000339633.1.77244 WP_000339633.1.77267 WP_000339633.1.77292 WP_000339633.1.77349 WP_000339633.1.77514 WP_000339633.1.77529 WP_000339633.1.77549 WP_000339633.1.77692 WP_000339633.1.77710 WP_000339633.1.7782 WP_000339633.1.77851 WP_000339633.1.77898 WP_000339633.1.77918 WP_000339633.1.77960 WP_000339633.1.78076 WP_000339633.1.78096 WP_000339633.1.78100 WP_000339633.1.78110 WP_000339633.1.78120 WP_000339633.1.78372 WP_000339633.1.78383 WP_000339633.1.78407 WP_000339633.1.7861 WP_000339633.1.78618 WP_000339633.1.78673 WP_000339633.1.78735 WP_000339633.1.78802 WP_000339633.1.78830 WP_000339633.1.78838 WP_000339633.1.78871 WP_000339633.1.78874 WP_000339633.1.78918 WP_000339633.1.78930 WP_000339633.1.79151 WP_000339633.1.79167 WP_000339633.1.79335 WP_000339633.1.79462 WP_000339633.1.79472 WP_000339633.1.79490 WP_000339633.1.79495 WP_000339633.1.79529 WP_000339633.1.79570 WP_000339633.1.7964 WP_000339633.1.79659 WP_000339633.1.79668 WP_000339633.1.79708 WP_000339633.1.79734 WP_000339633.1.79845 WP_000339633.1.80077 WP_000339633.1.80137 WP_000339633.1.80182 WP_000339633.1.80296 WP_000339633.1.80366 WP_000339633.1.80741 WP_000339633.1.80780 WP_000339633.1.80831 WP_000339633.1.80850 WP_000339633.1.80881 WP_000339633.1.8096 WP_000339633.1.81037 WP_000339633.1.81069 WP_000339633.1.81149 WP_000339633.1.81175 WP_000339633.1.8119 WP_000339633.1.81305 WP_000339633.1.81320 WP_000339633.1.81328 WP_000339633.1.81354 WP_000339633.1.81410 WP_000339633.1.81425 WP_000339633.1.81528 WP_000339633.1.81735 WP_000339633.1.81750 WP_000339633.1.81760 WP_000339633.1.81785 WP_000339633.1.81902 WP_000339633.1.81974 WP_000339633.1.82232 WP_000339633.1.82337 WP_000339633.1.82464 WP_000339633.1.82479 WP_000339633.1.82503 WP_000339633.1.82515 WP_000339633.1.82584 WP_000339633.1.82676 WP_000339633.1.82761 WP_000339633.1.8282 WP_000339633.1.82944 WP_000339633.1.82956 WP_000339633.1.83092 WP_000339633.1.83163 WP_000339633.1.83305 WP_000339633.1.83365 WP_000339633.1.83413 WP_000339633.1.83491 WP_000339633.1.83523 WP_000339633.1.8354 WP_000339633.1.83651 WP_000339633.1.83721 WP_000339633.1.83760 WP_000339633.1.83995 WP_000339633.1.84103 WP_000339633.1.84283 WP_000339633.1.84291 WP_000339633.1.84392 WP_000339633.1.84397 WP_000339633.1.8441 WP_000339633.1.84532 WP_000339633.1.84659 WP_000339633.1.84693 WP_000339633.1.84899 WP_000339633.1.8497 WP_000339633.1.85040 WP_000339633.1.85134 WP_000339633.1.85178 WP_000339633.1.85180 WP_000339633.1.85190 WP_000339633.1.8545 WP_000339633.1.85481 WP_000339633.1.85483 WP_000339633.1.85541 WP_000339633.1.8556 WP_000339633.1.85568 WP_000339633.1.85615 WP_000339633.1.85617 WP_000339633.1.85663 WP_000339633.1.85671 WP_000339633.1.85672 WP_000339633.1.85777 WP_000339633.1.85855 WP_000339633.1.85886 WP_000339633.1.85900 WP_000339633.1.85904 WP_000339633.1.85976 WP_000339633.1.86043 WP_000339633.1.86173 WP_000339633.1.86306 WP_000339633.1.86356 WP_000339633.1.86450 WP_000339633.1.86469 WP_000339633.1.86580 WP_000339633.1.86588 WP_000339633.1.86661 WP_000339633.1.8671 WP_000339633.1.8672 WP_000339633.1.8678 WP_000339633.1.86810 WP_000339633.1.8684 WP_000339633.1.86895 WP_000339633.1.86906 WP_000339633.1.87095 WP_000339633.1.87323 WP_000339633.1.8736 WP_000339633.1.87460 WP_000339633.1.87552 WP_000339633.1.87695 WP_000339633.1.87779 WP_000339633.1.87899 WP_000339633.1.8792 WP_000339633.1.87945 WP_000339633.1.88019 WP_000339633.1.88073 WP_000339633.1.8809 WP_000339633.1.88291 WP_000339633.1.88293 WP_000339633.1.8837 WP_000339633.1.88393 WP_000339633.1.88703 WP_000339633.1.88792 WP_000339633.1.88902 WP_000339633.1.8891 WP_000339633.1.88957 WP_000339633.1.88980 WP_000339633.1.88981 WP_000339633.1.89008 WP_000339633.1.89114 WP_000339633.1.89116 WP_000339633.1.89119 WP_000339633.1.89138 WP_000339633.1.89304 WP_000339633.1.89512 WP_000339633.1.89527 WP_000339633.1.89570 WP_000339633.1.89604 WP_000339633.1.89622 WP_000339633.1.89657 WP_000339633.1.89659 WP_000339633.1.89765 WP_000339633.1.89817 WP_000339633.1.89902 WP_000339633.1.8996 WP_000339633.1.90097 WP_000339633.1.90252 WP_000339633.1.90417 WP_000339633.1.90453 WP_000339633.1.90458 WP_000339633.1.90557 WP_000339633.1.90585 WP_000339633.1.90641 WP_000339633.1.90734 WP_000339633.1.91003 WP_000339633.1.91056 WP_000339633.1.91069 WP_000339633.1.91179 WP_000339633.1.91278 WP_000339633.1.9131 WP_000339633.1.91512 WP_000339633.1.91524 WP_000339633.1.91564 WP_000339633.1.91621 WP_000339633.1.91628 WP_000339633.1.91655 WP_000339633.1.91724 WP_000339633.1.91732 WP_000339633.1.91788 WP_000339633.1.92013 WP_000339633.1.92060 WP_000339633.1.92093 WP_000339633.1.92108 WP_000339633.1.92165 WP_000339633.1.92171 WP_000339633.1.92183 WP_000339633.1.92208 WP_000339633.1.92268 WP_000339633.1.92310 WP_000339633.1.92318 WP_000339633.1.92443 WP_000339633.1.92482 WP_000339633.1.92531 WP_000339633.1.92669 WP_000339633.1.92671 WP_000339633.1.92738 WP_000339633.1.92893 WP_000339633.1.93059 WP_000339633.1.93086 WP_000339633.1.93101 WP_000339633.1.93136 WP_000339633.1.93155 WP_000339633.1.93275 WP_000339633.1.93339 WP_000339633.1.93365 WP_000339633.1.93376 WP_000339633.1.93543 WP_000339633.1.93650 WP_000339633.1.93656 WP_000339633.1.93662 WP_000339633.1.937 WP_000339633.1.93705 WP_000339633.1.93804 WP_000339633.1.9389 WP_000339633.1.93937 WP_000339633.1.93994 WP_000339633.1.94072 WP_000339633.1.94162 WP_000339633.1.94168 WP_000339633.1.94198 WP_000339633.1.9432 WP_000339633.1.94354 WP_000339633.1.94380 WP_000339633.1.94565 WP_000339633.1.94584 WP_000339633.1.94655 WP_000339633.1.94674 WP_000339633.1.94796 WP_000339633.1.94959 WP_000339633.1.95051 WP_000339633.1.95085 WP_000339633.1.95121 WP_000339633.1.95248 WP_000339633.1.95277 WP_000339633.1.95282 WP_000339633.1.95388 WP_000339633.1.95546 WP_000339633.1.95630 WP_000339633.1.95670 WP_000339633.1.95691 WP_000339633.1.95911 WP_000339633.1.95939 WP_000339633.1.96004 WP_000339633.1.96139 WP_000339633.1.96162 WP_000339633.1.96317 WP_000339633.1.96343 WP_000339633.1.9644 WP_000339633.1.96469 WP_000339633.1.96497 WP_000339633.1.96500 WP_000339633.1.96555 WP_000339633.1.96563 WP_000339633.1.96732 WP_000339633.1.9674 WP_000339633.1.96771 WP_000339633.1.97015 WP_000339633.1.97047 WP_000339633.1.97143 WP_000339633.1.97145 WP_000339633.1.97190 WP_000339633.1.97297 WP_000339633.1.97318 WP_000339633.1.97369 WP_000339633.1.97477 WP_000339633.1.97487 WP_000339633.1.97594 WP_000339633.1.97597 WP_000339633.1.97613 WP_000339633.1.97620 WP_000339633.1.97631 WP_000339633.1.97727 WP_000339633.1.97732 WP_000339633.1.97736 WP_000339633.1.9775 WP_000339633.1.97846 WP_000339633.1.9799 WP_000339633.1.98006 WP_000339633.1.98019 WP_000339633.1.98022 WP_000339633.1.98110 WP_000339633.1.98146 WP_000339633.1.98170 WP_000339633.1.98219 WP_000339633.1.9826 WP_000339633.1.9841 WP_000339633.1.98495 WP_000339633.1.98531 WP_000339633.1.98577 WP_000339633.1.98676 WP_000339633.1.98677 WP_000339633.1.98760 WP_000339633.1.98843 WP_000339633.1.9898 WP_000339633.1.99072 WP_000339633.1.99098 WP_000339633.1.99184 WP_000339633.1.99267 WP_000339633.1.99276 WP_000339633.1.99626 WP_000339633.1.99646 WP_000339633.1.99657 WP_000339633.1.99660 WP_000339633.1.99712 WP_000339633.1.99813 WP_000339633.1.99858 WP_000339633.1.99889 WP_000339633.1.99958 gi|525827433|ref|YP_008250046.1| gi|386590493|ref|YP_006086893.1| ABAM02000001|CDS_1119018-1118164 ABAO01000003|CDS_119138-118284 ABEL01000001|CDS_364980-364126 AE006468|CDS_620112-619258 CP001120|CDS_668542-667688 CP001363|CDS_620806-619952 FN424405|CDS_658922-658068 gi|526219437|ref|YP_008264812.1| gi|379699780|ref|YP_005241508.1| gi|378987962|ref|YP_005251126.1| gi|194447833|ref|YP_002044594.1| gi|16763940|ref|NP_459555.1| gi|549723267|ref|YP_008643457.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]